1WFGA

Pdz domain of human rim2b
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
131
structure length
131
Chain Sequence
GSSGSSGHSHSDKHPVTWQPSKDGDRLIGRILLNKRLKDGSVPRDSGAMLGLKVVGGKMTESGRLCAFITKVKKGSLADTVGHLRPGDEVLEWNGRLLQGATFEEVYNIILESKPEPQVELVVSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulating synaptic membrane exocytosis protein 2
publication title PDZ domain of human RIM2B
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 17
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1wfgA00
5E22A 4K6YA 2K20A 2KG2A 3VQGA 2D90A 4RI0A 2KOJA 2OMJA 2BYGA 1FC7A 5FB8C 2MHOA 2IWOA 1QLCA 4PQWA 4REYA 1UM7A 3CBZA 3QIKA 2AINA 4NMVA 4P0CA 2EXGA 5HJ1A 1QAUA 5HFEA 1TQ3A 4YYXA 5B6LA 2I04A 1RZXA 2AWXA 2W4FA 3QO6A 1GQ5A 3GDVA 2KOHA 1X8SA 2GZVA 3TSVA 3QJNA 4JOGA 4E35A 1WH1A 2HE4A 5HFBA 2LOBA 4F8KA 2PNTA 2I6VA 4L8NA 3ID1A 3KZEA 4Q3HA 5HF4A 1TP5A 1TP3A 2JIKA 3R69A 2KJKA 1GM1A 1Q7XA 2KRGA 2PKTA 2R4HA 2M10A 1UJDA 1V1TA 3CBXA 1KEFA 2JREA 2PA1A 3DORA 3MH4A 1XZ9A 1OBYA 1RGRA 2ZPMA 1X6DA 2KL1A 2KBSA 2O2TA 4HOPA 4EDJA 2HE2A 2CS5A 2FN5A 1TE0A 2WL7A 3VQFA 1FC9A 3OU0A 2LUIA 3GCOA 4WYTA 2P3WA 1BE9A 1R6JA 2KPKA 1U37A 1QAVB 1WI2A 1RY4A 2DAZA 1Z87A 4R2ZA 4K78A 1L6OA 3GSLA 4NNMA 2OS6A 2D92A 3L4FD 4UU5A 2EGNA 2DLSA 4AMHA 2ZPLA 2EDVA 1VB7A 2AWWA 3HPMA 2EDZA 2EGKA 1OBZA 3CYYA 2Q3GA 1VA8A 2LC7A 1UEQA 4GVDA 5EZ0A 5I7ZA 2K1ZA 2EDPA 1MFLA 2M0ZA 2OPGA 4O06A 5HFDA 2D8IA 4JOEA 1W9QA 2Q9VA 1NF3C 1BFEA 2VRFA 2MX6A 3R0HA 3FY5A 1D5GA 1SOTA 5HF1A 4KFVA 3NFLA 5A2PA 3SHWA 3QGLA 1X5RA 2I4SA 2R3YA 1X5NA 3BPUA 1WHDA 3DJ3A 1V5QA 1ZOKA 1MC7A 3NFKA 2VWRA 3DJAA 2YTWA 1IU2A 2OZFA 4Q2PA 2I0LA 4Z8JA 4N6XA 2M0TA 5F67A 2OCSA 5HEYA 4NMSA 2OQSA 3K1RA 3CH8A 1WFGA 1P1EA 2PKUA 3RL8A 3GJ9A 2I0IA 1WJLA 2QG1A 4NMTA 1Z86A 2Z17A 3K82A 2QKVA 3TSZA 1Q3PA 2EAQA 4G69A 1WF8A 4E3BA 3O5NA 5E6PB 1P1DA 3WKMA 3GGEA 4GHNA 1UJUA 5HFFA 2VSPA 2QBWA 2VPHA 1N6FA 2F5YA 2YT7A 3JXTA 5HEBA 3DIWA 1Y8TA 2FE5A 2CSSA 1OZIA 2W7RA 1VAEA 3TSWA 2KOMA 3R68A 2E7KA 1OBXA 4NNLA 3ID3A 2KJDA 2HGAA 2JWEA 2RRMA 3EGHC 1N7EA 2L4TA 3B76A 4FGMA 3MH7A 1VCWA 2KA9A 1U39A 2YUBA 1LCYA 1VJ6A 5HFCA 1WF7A 1N6DA 3PV5A 4K72A 3GDSA 2UZCA 2L4SA 4OEOA 4JOKA 3SHUA 2M0UA 3AXAA 3HVQC 2DMZA 4JOPA 1UEWA 3LNXA 2EEHA 1V5LA 1I92A 4JOJA 1Q3OA 2KQFA 1UITA 1WIFA 2YUYA 1T2MA 5E11A 2AWUA 1WI4A 1KY9A 1SOZA 5G1EA 3TMHA 2EV8A 1UM1A 3I1EA 2G5MB 2KAWA 3RL7A 2REYA 1KWAA 3O46A 4IC6A 4NMPA 1YBOA 2KV8A 2JXOA 2DC2A 4H11A 2H3LA 3CC0A 5G1DA 3KHFA 4Q2NA 1PDRA 1GQ4A 2EJYA 1W9EA 3EGGC 1WFVA 2I1NA 3I4WA 4XHVA 2X7ZA 3DJ1A 1NTEA 2H3MA 2L97A 3MH6A 2QT5A 2DLUA 2FNEA 5HETA 1G9OA 5E1YA 1X45A 1U3BA 3QE1A 1IU0A 4E34A 1V62A 2ENOA 5H3JA 3CBYA 2H2BA 2EEIA 2M3MA 4WYUA 3RLEA 4NXPA 5JXBA 3ID2A 2CSJA 1U38A 1QAVA 4LMMA 2VZ5A 4Q2OA 1N6EA 1M5ZA 1K32A 2JINA 2V1WA 4GVCA 2G2LA 2YT8A 2IWPA 1UJVA 1WG6A 2H2CA 1FC6A 1N99A 4KFWA 2KJPA 4NXQA 3WKLA 5D13A 3QDOA 1N7TA 1UEPA 3NGHA 3CS0A 4MPAA 3PDVA 5HEDA 2EHRA 5EYZA 1IHJA 1UFXA 1Y7NA 2EEGA 3SFJA 5GLJA 1RGWA 2DB5A 1UF1A 2M0VA 2PZDA 2QKTA 5HDYA 4Q6SA 2F0AA 2FCFA 1UEZA 5FHTA 5E21A 3QJMA 2DJTA 2KYLA 2IWNA 1V6BA 4NXRA 2JOAA 4K76A 2LA8A 2LC6A 3SUZA 1UHPA 5GNDA 3STJA 2DKRA 4Q6HA 1I16A 3I18A 5F3XA 3KZDA 3LNYA 2EEJA 2QKUA 3GDUA 3PDZA 2Z9IA 3ID4A 4Z33A 4NMOA 2OGPA 2RCZA 2IWQA 3SOEA 1X5QA 4JL7A 3PV2A 3K50A 3ZRTA 1MFGA 2PDZA 4YDPA 1N7FA 2DM8A 4P2AB 3PS4A 4OEPA 4JOHA 3OTPA 1B8QA 1ZUBA 4NMRA 3PV4A 1WHAA 2JILA 2OSGA 3GCNA 5DTHA 4JORA 4NMQA 4OAJA 3HPKA 2VSVA 2EGOA 1W9OA 2KPLA 4K75A 3E17A 1FCFA 4JOFA 4Q2QA 4HOPB 4UU6A 2V90A
chains in the Genus database with same CATH superfamily
5E22A 4K6YA 2K20A 2KG2A 3VQGA 2D90A 4RI0A 2KOJA 2OMJA 2BYGA 1FC7A 5FB8C 2MHOA 2IWOA 1QLCA 4PQWA 4REYA 1UM7A 3CBZA 3QIKA 2AINA 4NMVA 4P0CA 2EXGA 5HJ1A 1QAUA 5HFEA 1TQ3A 4YYXA 5B6LA 2I04A 1RZXA 2AWXA 2W4FA 3QO6A 1GQ5A 3GDVA 2KOHA 1X8SA 2GZVA 3TSVA 3QJNA 4JOGA 4E35A 1WH1A 2HE4A 5HFBA 2LOBA 4F8KA 2PNTA 2I6VA 4L8NA 3ID1A 3KZEA 4Q3HA 5HF4A 1TP5A 1TP3A 2JIKA 3R69A 2KJKA 1GM1A 4JJ3A 1Q7XA 2KRGA 2PKTA 2R4HA 2M10A 1UJDA 1V1TA 3CBXA 1KEFA 2JREA 2PA1A 3DORA 3MH4A 1XZ9A 1OBYA 1RGRA 5IL9A 2ZPMA 1X6DA 2KL1A 2KBSA 2O2TA 4HOPA 4EDJA 2HE2A 2CS5A 2FN5A 1TE0A 2WL7A 3VQFA 1FC9A 3OU0A 2LUIA 3GCOA 4WYTA 2P3WA 1BE9A 1R6JA 2KPKA 1U37A 1QAVB 1WI2A 1RY4A 2DAZA 1Z87A 4R2ZA 4K78A 3KDKA 1L6OA 3GSLA 4NNMA 2OS6A 2D92A 3L4FD 4UU5A 2EGNA 2DLSA 4AMHA 2ZPLA 2EDVA 1VB7A 2AWWA 3HPMA 2EDZA 2EGKA 1OBZA 3CYYA 2Q3GA 1VA8A 2LC7A 1UEQA 4GVDA 5EZ0A 5I7ZA 2K1ZA 2EDPA 1MFLA 2M0ZA 2OPGA 4O06A 5HFDA 2D8IA 4JOEA 1W9QA 2Q9VA 1NF3C 1BFEA 2VRFA 2MX6A 2JSNA 3KDGA 3R0HA 3FY5A 1D5GA 1SOTA 5HF1A 4KFVA 3NFLA 5A2PA 3SHWA 3QGLA 1X5RA 2I4SA 2R3YA 1X5NA 3BPUA 1WHDA 3DJ3A 1V5QA 1ZOKA 1MC7A 3NFKA 2VWRA 3DJAA 2YTWA 1IU2A 2OZFA 4Q2PA 2I0LA 4Z8JA 4N6XA 2M0TA 5F67A 2OCSA 5HEYA 4NMSA 2OQSA 3K1RA 3CH8A 1WFGA 1P1EA 2PKUA 3RL8A 3GJ9A 2I0IA 5B42A 1WJLA 2QG1A 4NMTA 1Z86A 2Z17A 3K82A 2QKVA 3TSZA 1Q3PA 2EAQA 4G69A 1WF8A 4E3BA 3O5NA 5E6PB 1P1DA 3WKMA 3GGEA 4GHNA 1UJUA 5HFFA 1X9ZA 2VSPA 2QBWA 2VPHA 1N6FA 2F5YA 2YT7A 3JXTA 5HEBA 3DIWA 1Y8TA 2FE5A 2CSSA 4FLNA 1OZIA 2W7RA 1VAEA 3TSWA 2KOMA 3R68A 2E7KA 1OBXA 4NNLA 3ID3A 2KJDA 2HGAA 2GEFA 2JWEA 2RRMA 3EGHC 1N7EA 2L4TA 3B76A 4FGMA 4JJ0A 3MH7A 1VCWA 2KA9A 1U39A 2YUBA 1LCYA 1VJ6A 5HFCA 1WF7A 1N6DA 3PV5A 4K72A 3GDSA 2UZCA 2L4SA 4OEOA 4JOKA 3SHUA 2M0UA 3AXAA 3HVQC 2DMZA 4JOPA 1UEWA 3LNXA 2EEHA 1V5LA 1I92A 4JOJA 1Q3OA 2KQFA 1UITA 1WIFA 2YUYA 1T2MA 5E11A 2AWUA 1WI4A 1KY9A 1SOZA 5G1EA 3TMHA 2EV8A 1UM1A 3I1EA 2G5MB 2KAWA 3RL7A 2REYA 1KWAA 3O46A 4IC6A 4NMPA 1YBOA 2KV8A 2JXOA 2DC2A 4H11A 2H3LA 3CC0A 5G1DA 3KHFA 4Q2NA 1PDRA 1GQ4A 2EJYA 1W9EA 3EGGC 1WFVA 2I1NA 3I4WA 4XHVA 2X7ZA 3DJ1A 1NTEA 2H3MA 2L97A 3MH6A 2QT5A 2DLUA 2FNEA 5HETA 1G9OA 5E1YA 1X45A 1U3BA 3QE1A 1IU0A 4E34A 1V62A 2ENOA 5H3JA 3CBYA 2H2BA 2EEIA 2M3MA 4WYUA 3RLEA 4NXPA 5JXBA 3ID2A 2CSJA 1U38A 1QAVA 4LMMA 2VZ5A 4Q2OA 1N6EA 1M5ZA 1K32A 2JINA 2V1WA 4GVCA 2G2LA 2YT8A 2IWPA 1UJVA 1WG6A 2H2CA 1FC6A 1N99A 4KFWA 2KJPA 4NXQA 3WKLA 5D13A 3QDOA 1N7TA 1UEPA 3NGHA 3CS0A 3NCVA 4MPAA 3PDVA 5HEDA 2EHRA 5EYZA 1IHJA 1UFXA 1Y7NA 2EEGA 3SFJA 5GLJA 1RGWA 2DB5A 1UF1A 2M0VA 2PZDA 2QKTA 5HDYA 4Q6SA 2F0AA 2FCFA 1UEZA 5FHTA 5E21A 3QJMA 2DJTA 2KYLA 2IWNA 1V6BA 4NXRA 2JOAA 4K76A 2LA8A 2LC6A 3SUZA 1UHPA 5GNDA 3STJA 2DKRA 4Q6HA 1I16A 3I18A 5F3XA 3KZDA 3LNYA 2EEJA 3GABA 2QKUA 3GDUA 3PDZA 5ILBA 2Z9IA 3ID4A 4Z33A 4NMOA 2OGPA 2RCZA 2IWQA 3SOEA 1X5QA 4JL7A 3PV2A 3K50A 3ZRTA 1MFGA 2PDZA 4YDPA 1N7FA 2DM8A 4P2AB 3PS4A 4OEPA 4JOHA 3OTPA 1B8QA 1ZUBA 4NMRA 3PV4A 1WHAA 2JILA 2OSGA 3GCNA 5DTHA 4JORA 4NMQA 4OAJA 3HPKA 2VSVA 2EGOA 1W9OA 2KPLA 4K75A 3E17A 1FCFA 4JOFA 4Q2QA 4HOPB 4UU6A 2V90A
chains in the Genus database with same CATH topology
5E22A 4K6YA 2K20A 2KG2A 3VQGA 2D90A 4RI0A 2KOJA 2OMJA 2BYGA 1FC7A 5FB8C 2MHOA 2IWOA 1QLCA 4PQWA 4REYA 1UM7A 3CBZA 3QIKA 2AINA 4NMVA 4P0CA 2EXGA 5HJ1A 1QAUA 5HFEA 1TQ3A 4YYXA 5B6LA 2I04A 1RZXA 2AWXA 2W4FA 3QO6A 1GQ5A 3GDVA 2KOHA 1X8SA 2GZVA 3TSVA 3QJNA 4JOGA 4E35A 1WH1A 2HE4A 5HFBA 2LOBA 4F8KA 2PNTA 2I6VA 4L8NA 3ID1A 3KZEA 4Q3HA 5HF4A 1TP5A 1TP3A 2JIKA 3R69A 2KJKA 1GM1A 4JJ3A 1Q7XA 2KRGA 2PKTA 2R4HA 2M10A 1UJDA 1V1TA 3CBXA 1KEFA 2JREA 2PA1A 3DORA 3MH4A 1XZ9A 1OBYA 1RGRA 5IL9A 2ZPMA 1X6DA 2KL1A 2KBSA 2O2TA 4HOPA 4EDJA 2HE2A 2CS5A 2FN5A 1TE0A 2WL7A 3VQFA 1FC9A 3OU0A 2LUIA 3GCOA 4WYTA 2P3WA 1BE9A 1R6JA 2KPKA 1U37A 1QAVB 1WI2A 1RY4A 2DAZA 1Z87A 4R2ZA 4K78A 3KDKA 1L6OA 3GSLA 4NNMA 2OS6A 2D92A 3L4FD 4UU5A 2EGNA 2DLSA 4AMHA 2ZPLA 2EDVA 1VB7A 2AWWA 3HPMA 2EDZA 2EGKA 1OBZA 3CYYA 2Q3GA 1VA8A 2LC7A 1UEQA 4GVDA 5EZ0A 5I7ZA 2K1ZA 2EDPA 1MFLA 2M0ZA 2OPGA 4O06A 5HFDA 2D8IA 4JOEA 1W9QA 2Q9VA 1NF3C 1BFEA 2VRFA 2MX6A 2JSNA 3KDGA 3R0HA 3FY5A 1D5GA 1SOTA 5HF1A 4KFVA 3NFLA 5A2PA 3SHWA 3QGLA 1X5RA 2I4SA 2R3YA 1X5NA 3BPUA 1WHDA 3DJ3A 1V5QA 1ZOKA 1MC7A 3NFKA 2VWRA 3DJAA 2YTWA 1IU2A 2OZFA 4Q2PA 2I0LA 4Z8JA 4N6XA 2M0TA 5F67A 2OCSA 5HEYA 4NMSA 2OQSA 3K1RA 3CH8A 1WFGA 1P1EA 2PKUA 3RL8A 3GJ9A 2I0IA 5B42A 1WJLA 2QG1A 4NMTA 1Z86A 2Z17A 3K82A 2QKVA 3TSZA 1Q3PA 2EAQA 4G69A 1WF8A 4E3BA 3O5NA 5E6PB 1P1DA 3WKMA 3GGEA 4GHNA 1UJUA 5HFFA 1X9ZA 2VSPA 2QBWA 2VPHA 1N6FA 2F5YA 2YT7A 3JXTA 5HEBA 3DIWA 1Y8TA 2FE5A 2CSSA 4FLNA 1OZIA 2W7RA 1VAEA 3TSWA 2KOMA 3R68A 2E7KA 1OBXA 4NNLA 3ID3A 2KJDA 2HGAA 2GEFA 2JWEA 2RRMA 3EGHC 1N7EA 2L4TA 3B76A 4FGMA 4JJ0A 3MH7A 1VCWA 2KA9A 1U39A 2YUBA 1LCYA 1VJ6A 5HFCA 1WF7A 1N6DA 3PV5A 4K72A 3GDSA 2UZCA 2L4SA 4OEOA 4JOKA 3SHUA 2M0UA 3AXAA 3HVQC 2DMZA 4JOPA 1UEWA 3LNXA 2EEHA 1V5LA 1I92A 4JOJA 1Q3OA 2KQFA 1UITA 1WIFA 2YUYA 1T2MA 5E11A 2AWUA 1WI4A 1KY9A 1SOZA 5G1EA 3TMHA 2EV8A 1UM1A 3I1EA 2G5MB 2KAWA 3RL7A 2REYA 1KWAA 3O46A 4IC6A 4NMPA 1YBOA 2KV8A 2JXOA 2DC2A 4H11A 2H3LA 3CC0A 5G1DA 3KHFA 4Q2NA 1PDRA 1GQ4A 2EJYA 1W9EA 3EGGC 1WFVA 2I1NA 3I4WA 4XHVA 2X7ZA 3DJ1A 1NTEA 2H3MA 2L97A 3MH6A 2QT5A 2DLUA 2FNEA 5HETA 1G9OA 5E1YA 1X45A 1U3BA 3QE1A 1IU0A 4E34A 1V62A 2ENOA 5H3JA 3CBYA 2H2BA 2EEIA 2M3MA 4WYUA 3RLEA 4NXPA 5JXBA 3ID2A 2CSJA 1U38A 1QAVA 4LMMA 2VZ5A 4Q2OA 1N6EA 1M5ZA 1K32A 2JINA 2V1WA 4GVCA 2G2LA 2YT8A 2IWPA 1UJVA 1WG6A 2H2CA 1FC6A 1N99A 4KFWA 2KJPA 4NXQA 3WKLA 5D13A 3QDOA 1N7TA 1UEPA 3NGHA 3CS0A 3NCVA 4MPAA 3PDVA 5HEDA 2EHRA 5EYZA 1IHJA 1UFXA 1Y7NA 2EEGA 3SFJA 5GLJA 1RGWA 2DB5A 1UF1A 2M0VA 2PZDA 2QKTA 5HDYA 4Q6SA 2F0AA 2FCFA 1UEZA 5FHTA 5E21A 3QJMA 2DJTA 2KYLA 2IWNA 1V6BA 4NXRA 2JOAA 4K76A 2LA8A 2LC6A 3SUZA 1UHPA 5GNDA 3STJA 2DKRA 4Q6HA 1I16A 3I18A 5F3XA 3KZDA 3LNYA 2EEJA 3GABA 2QKUA 3GDUA 3PDZA 5ILBA 2Z9IA 3ID4A 4Z33A 4NMOA 2OGPA 2RCZA 2IWQA 3SOEA 1X5QA 4JL7A 3PV2A 3K50A 3ZRTA 1MFGA 2PDZA 4YDPA 1N7FA 2DM8A 4P2AB 3PS4A 4OEPA 4JOHA 3OTPA 1B8QA 1ZUBA 4NMRA 3PV4A 1WHAA 2JILA 2OSGA 3GCNA 5DTHA 4JORA 4NMQA 4OAJA 3HPKA 2VSVA 2EGOA 1W9OA 2KPLA 4K75A 3E17A 1FCFA 4JOFA 4Q2QA 4HOPB 4UU6A 2V90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E22 A;  4K6Y A;  2K20 A;  2KG2 A;  3VQG A;  2D90 A;  4RI0 A;  2KOJ A;  2OMJ A;  2BYG A;  1FC7 A;  5FB8 C;  2MHO A;  2IWO A;  1QLC A;  4PQW A;  4REY A;  1UM7 A;  3CBZ A;  3QIK A;  2AIN A;  4NMV A;  4P0C A;  2EXG A;  5HJ1 A;  1QAU A;  5HFE A;  1TQ3 A;  4YYX A;  5B6L A;  2I04 A;  1RZX A;  2AWX A;  2W4F A;  3QO6 A;  1GQ5 A;  3GDV A;  2KOH A;  1X8S A;  2GZV A;  3TSV A;  3QJN A;  4JOG A;  4E35 A;  1WH1 A;  2HE4 A;  5HFB A;  2LOB A;  4F8K A;  2PNT A;  2I6V A;  4L8N A;  3ID1 A;  3KZE A;  4Q3H A;  5HF4 A;  1TP5 A;  1TP3 A;  2JIK A;  3R69 A;  2KJK A;  1GM1 A;  1Q7X A;  2KRG A;  2PKT A;  2R4H A;  2M10 A;  1UJD A;  1V1T A;  3CBX A;  1KEF A;  2JRE A;  2PA1 A;  3DOR A;  3MH4 A;  1XZ9 A;  1OBY A;  1RGR A;  2ZPM A;  1X6D A;  2KL1 A;  2KBS A;  2O2T A;  4HOP A;  4EDJ A;  2HE2 A;  2CS5 A;  2FN5 A;  1TE0 A;  2WL7 A;  3VQF A;  1FC9 A;  3OU0 A;  2LUI A;  3GCO A;  4WYT A;  2P3W A;  1BE9 A;  1R6J A;  2KPK A;  1U37 A;  1QAV B;  1WI2 A;  1RY4 A;  2DAZ A;  1Z87 A;  4R2Z A;  4K78 A;  1L6O A;  3GSL A;  4NNM A;  2OS6 A;  2D92 A;  3L4F D;  4UU5 A;  2EGN A;  2DLS A;  4AMH A;  2ZPL A;  2EDV A;  1VB7 A;  2AWW A;  3HPM A;  2EDZ A;  2EGK A;  1OBZ A;  3CYY A;  2Q3G A;  1VA8 A;  2LC7 A;  1UEQ A;  4GVD A;  5EZ0 A;  5I7Z A;  2K1Z A;  2EDP A;  1MFL A;  2M0Z A;  2OPG A;  4O06 A;  5HFD A;  2D8I A;  4JOE A;  1W9Q A;  2Q9V A;  1NF3 C;  1BFE A;  2VRF A;  2MX6 A;  3R0H A;  3FY5 A;  1D5G A;  1SOT A;  5HF1 A;  4KFV A;  3NFL A;  5A2P A;  3SHW A;  3QGL A;  1X5R A;  2I4S A;  2R3Y A;  1X5N A;  3BPU A;  1WHD A;  3DJ3 A;  1V5Q A;  1ZOK A;  1MC7 A;  3NFK A;  2VWR A;  3DJA A;  2YTW A;  1IU2 A;  2OZF A;  4Q2P A;  2I0L A;  4Z8J A;  4N6X A;  2M0T A;  5F67 A;  2OCS A;  5HEY A;  4NMS A;  2OQS A;  3K1R A;  3CH8 A;  1WFG A;  1P1E A;  2PKU A;  3RL8 A;  3GJ9 A;  2I0I A;  1WJL A;  2QG1 A;  4NMT A;  1Z86 A;  2Z17 A;  3K82 A;  2QKV A;  3TSZ A;  1Q3P A;  2EAQ A;  4G69 A;  1WF8 A;  4E3B A;  3O5N A;  5E6P B;  1P1D A;  3WKM A;  3GGE A;  4GHN A;  1UJU A;  5HFF A;  2VSP A;  2QBW A;  2VPH A;  1N6F A;  2F5Y A;  2YT7 A;  3JXT A;  5HEB A;  3DIW A;  1Y8T A;  2FE5 A;  2CSS A;  1OZI A;  2W7R A;  1VAE A;  3TSW A;  2KOM A;  3R68 A;  2E7K A;  1OBX A;  4NNL A;  3ID3 A;  2KJD A;  2HGA A;  2JWE A;  2RRM A;  3EGH C;  1N7E A;  2L4T A;  3B76 A;  4FGM A;  3MH7 A;  1VCW A;  2KA9 A;  1U39 A;  2YUB A;  1LCY A;  1VJ6 A;  5HFC A;  1WF7 A;  1N6D A;  3PV5 A;  4K72 A;  3GDS A;  2UZC A;  2L4S A;  4OEO A;  4JOK A;  3SHU A;  2M0U A;  3AXA A;  3HVQ C;  2DMZ A;  4JOP A;  1UEW A;  3LNX A;  2EEH A;  1V5L A;  1I92 A;  4JOJ A;  1Q3O A;  2KQF A;  1UIT A;  1WIF A;  2YUY A;  1T2M A;  5E11 A;  2AWU A;  1WI4 A;  1KY9 A;  1SOZ A;  5G1E A;  3TMH A;  2EV8 A;  1UM1 A;  3I1E A;  2G5M B;  2KAW A;  3RL7 A;  2REY A;  1KWA A;  3O46 A;  4IC6 A;  4NMP A;  1YBO A;  2KV8 A;  2JXO A;  2DC2 A;  4H11 A;  2H3L A;  3CC0 A;  5G1D A;  3KHF A;  4Q2N A;  1PDR A;  1GQ4 A;  2EJY A;  1W9E A;  3EGG C;  1WFV A;  2I1N A;  3I4W A;  4XHV A;  2X7Z A;  3DJ1 A;  1NTE A;  2H3M A;  2L97 A;  3MH6 A;  2QT5 A;  2DLU A;  2FNE A;  5HET A;  1G9O A;  5E1Y A;  1X45 A;  1U3B A;  3QE1 A;  1IU0 A;  4E34 A;  1V62 A;  2ENO A;  5H3J A;  3CBY A;  2H2B A;  2EEI A;  2M3M A;  4WYU A;  3RLE A;  4NXP A;  5JXB A;  3ID2 A;  2CSJ A;  1U38 A;  1QAV A;  4LMM A;  2VZ5 A;  4Q2O A;  1N6E A;  1M5Z A;  1K32 A;  2JIN A;  2V1W A;  4GVC A;  2G2L A;  2YT8 A;  2IWP A;  1UJV A;  1WG6 A;  2H2C A;  1FC6 A;  1N99 A;  4KFW A;  2KJP A;  4NXQ A;  3WKL A;  5D13 A;  3QDO A;  1N7T A;  1UEP A;  3NGH A;  3CS0 A;  4MPA A;  3PDV A;  5HED A;  2EHR A;  5EYZ A;  1IHJ A;  1UFX A;  1Y7N A;  2EEG A;  3SFJ A;  5GLJ A;  1RGW A;  2DB5 A;  1UF1 A;  2M0V A;  2PZD A;  2QKT A;  5HDY A;  4Q6S A;  2F0A A;  2FCF A;  1UEZ A;  5FHT A;  5E21 A;  3QJM A;  2DJT A;  2KYL A;  2IWN A;  1V6B A;  4NXR A;  2JOA A;  4K76 A;  2LA8 A;  2LC6 A;  3SUZ A;  1UHP A;  5GND A;  3STJ A;  2DKR A;  4Q6H A;  1I16 A;  3I18 A;  5F3X A;  3KZD A;  3LNY A;  2EEJ A;  2QKU A;  3GDU A;  3PDZ A;  2Z9I A;  3ID4 A;  4Z33 A;  4NMO A;  2OGP A;  2RCZ A;  2IWQ A;  3SOE A;  1X5Q A;  4JL7 A;  3PV2 A;  3K50 A;  3ZRT A;  1MFG A;  2PDZ A;  4YDP A;  1N7F A;  2DM8 A;  4P2A B;  3PS4 A;  4OEP A;  4JOH A;  3OTP A;  1B8Q A;  1ZUB A;  4NMR A;  3PV4 A;  1WHA A;  2JIL A;  2OSG A;  3GCN A;  5DTH A;  4JOR A;  4NMQ A;  4OAJ A;  3HPK A;  2VSV A;  2EGO A;  1W9O A;  2KPL A;  4K75 A;  3E17 A;  1FCF A;  4JOF A;  4Q2Q A;  4HOP B;  4UU6 A;  2V90 A; 
#chains in the Genus database with same CATH topology
 5E22 A;  4K6Y A;  2K20 A;  2KG2 A;  3VQG A;  2D90 A;  4RI0 A;  2KOJ A;  2OMJ A;  2BYG A;  1FC7 A;  5FB8 C;  2MHO A;  2IWO A;  1QLC A;  4PQW A;  4REY A;  1UM7 A;  3CBZ A;  3QIK A;  2AIN A;  4NMV A;  4P0C A;  2EXG A;  5HJ1 A;  1QAU A;  5HFE A;  1TQ3 A;  4YYX A;  5B6L A;  2I04 A;  1RZX A;  2AWX A;  2W4F A;  3QO6 A;  1GQ5 A;  3GDV A;  2KOH A;  1X8S A;  2GZV A;  3TSV A;  3QJN A;  4JOG A;  4E35 A;  1WH1 A;  2HE4 A;  5HFB A;  2LOB A;  4F8K A;  2PNT A;  2I6V A;  4L8N A;  3ID1 A;  3KZE A;  4Q3H A;  5HF4 A;  1TP5 A;  1TP3 A;  2JIK A;  3R69 A;  2KJK A;  1GM1 A;  4JJ3 A;  1Q7X A;  2KRG A;  2PKT A;  2R4H A;  2M10 A;  1UJD A;  1V1T A;  3CBX A;  1KEF A;  2JRE A;  2PA1 A;  3DOR A;  3MH4 A;  1XZ9 A;  1OBY A;  1RGR A;  5IL9 A;  2ZPM A;  1X6D A;  2KL1 A;  2KBS A;  2O2T A;  4HOP A;  4EDJ A;  2HE2 A;  2CS5 A;  2FN5 A;  1TE0 A;  2WL7 A;  3VQF A;  1FC9 A;  3OU0 A;  2LUI A;  3GCO A;  4WYT A;  2P3W A;  1BE9 A;  1R6J A;  2KPK A;  1U37 A;  1QAV B;  1WI2 A;  1RY4 A;  2DAZ A;  1Z87 A;  4R2Z A;  4K78 A;  3KDK A;  1L6O A;  3GSL A;  4NNM A;  2OS6 A;  2D92 A;  3L4F D;  4UU5 A;  2EGN A;  2DLS A;  4AMH A;  2ZPL A;  2EDV A;  1VB7 A;  2AWW A;  3HPM A;  2EDZ A;  2EGK A;  1OBZ A;  3CYY A;  2Q3G A;  1VA8 A;  2LC7 A;  1UEQ A;  4GVD A;  5EZ0 A;  5I7Z A;  2K1Z A;  2EDP A;  1MFL A;  2M0Z A;  2OPG A;  4O06 A;  5HFD A;  2D8I A;  4JOE A;  1W9Q A;  2Q9V A;  1NF3 C;  1BFE A;  2VRF A;  2MX6 A;  2JSN A;  3KDG A;  3R0H A;  3FY5 A;  1D5G A;  1SOT A;  5HF1 A;  4KFV A;  3NFL A;  5A2P A;  3SHW A;  3QGL A;  1X5R A;  2I4S A;  2R3Y A;  1X5N A;  3BPU A;  1WHD A;  3DJ3 A;  1V5Q A;  1ZOK A;  1MC7 A;  3NFK A;  2VWR A;  3DJA A;  2YTW A;  1IU2 A;  2OZF A;  4Q2P A;  2I0L A;  4Z8J A;  4N6X A;  2M0T A;  5F67 A;  2OCS A;  5HEY A;  4NMS A;  2OQS A;  3K1R A;  3CH8 A;  1WFG A;  1P1E A;  2PKU A;  3RL8 A;  3GJ9 A;  2I0I A;  5B42 A;  1WJL A;  2QG1 A;  4NMT A;  1Z86 A;  2Z17 A;  3K82 A;  2QKV A;  3TSZ A;  1Q3P A;  2EAQ A;  4G69 A;  1WF8 A;  4E3B A;  3O5N A;  5E6P B;  1P1D A;  3WKM A;  3GGE A;  4GHN A;  1UJU A;  5HFF A;  1X9Z A;  2VSP A;  2QBW A;  2VPH A;  1N6F A;  2F5Y A;  2YT7 A;  3JXT A;  5HEB A;  3DIW A;  1Y8T A;  2FE5 A;  2CSS A;  4FLN A;  1OZI A;  2W7R A;  1VAE A;  3TSW A;  2KOM A;  3R68 A;  2E7K A;  1OBX A;  4NNL A;  3ID3 A;  2KJD A;  2HGA A;  2GEF A;  2JWE A;  2RRM A;  3EGH C;  1N7E A;  2L4T A;  3B76 A;  4FGM A;  4JJ0 A;  3MH7 A;  1VCW A;  2KA9 A;  1U39 A;  2YUB A;  1LCY A;  1VJ6 A;  5HFC A;  1WF7 A;  1N6D A;  3PV5 A;  4K72 A;  3GDS A;  2UZC A;  2L4S A;  4OEO A;  4JOK A;  3SHU A;  2M0U A;  3AXA A;  3HVQ C;  2DMZ A;  4JOP A;  1UEW A;  3LNX A;  2EEH A;  1V5L A;  1I92 A;  4JOJ A;  1Q3O A;  2KQF A;  1UIT A;  1WIF A;  2YUY A;  1T2M A;  5E11 A;  2AWU A;  1WI4 A;  1KY9 A;  1SOZ A;  5G1E A;  3TMH A;  2EV8 A;  1UM1 A;  3I1E A;  2G5M B;  2KAW A;  3RL7 A;  2REY A;  1KWA A;  3O46 A;  4IC6 A;  4NMP A;  1YBO A;  2KV8 A;  2JXO A;  2DC2 A;  4H11 A;  2H3L A;  3CC0 A;  5G1D A;  3KHF A;  4Q2N A;  1PDR A;  1GQ4 A;  2EJY A;  1W9E A;  3EGG C;  1WFV A;  2I1N A;  3I4W A;  4XHV A;  2X7Z A;  3DJ1 A;  1NTE A;  2H3M A;  2L97 A;  3MH6 A;  2QT5 A;  2DLU A;  2FNE A;  5HET A;  1G9O A;  5E1Y A;  1X45 A;  1U3B A;  3QE1 A;  1IU0 A;  4E34 A;  1V62 A;  2ENO A;  5H3J A;  3CBY A;  2H2B A;  2EEI A;  2M3M A;  4WYU A;  3RLE A;  4NXP A;  5JXB A;  3ID2 A;  2CSJ A;  1U38 A;  1QAV A;  4LMM A;  2VZ5 A;  4Q2O A;  1N6E A;  1M5Z A;  1K32 A;  2JIN A;  2V1W A;  4GVC A;  2G2L A;  2YT8 A;  2IWP A;  1UJV A;  1WG6 A;  2H2C A;  1FC6 A;  1N99 A;  4KFW A;  2KJP A;  4NXQ A;  3WKL A;  5D13 A;  3QDO A;  1N7T A;  1UEP A;  3NGH A;  3CS0 A;  3NCV A;  4MPA A;  3PDV A;  5HED A;  2EHR A;  5EYZ A;  1IHJ A;  1UFX A;  1Y7N A;  2EEG A;  3SFJ A;  5GLJ A;  1RGW A;  2DB5 A;  1UF1 A;  2M0V A;  2PZD A;  2QKT A;  5HDY A;  4Q6S A;  2F0A A;  2FCF A;  1UEZ A;  5FHT A;  5E21 A;  3QJM A;  2DJT A;  2KYL A;  2IWN A;  1V6B A;  4NXR A;  2JOA A;  4K76 A;  2LA8 A;  2LC6 A;  3SUZ A;  1UHP A;  5GND A;  3STJ A;  2DKR A;  4Q6H A;  1I16 A;  3I18 A;  5F3X A;  3KZD A;  3LNY A;  2EEJ A;  3GAB A;  2QKU A;  3GDU A;  3PDZ A;  5ILB A;  2Z9I A;  3ID4 A;  4Z33 A;  4NMO A;  2OGP A;  2RCZ A;  2IWQ A;  3SOE A;  1X5Q A;  4JL7 A;  3PV2 A;  3K50 A;  3ZRT A;  1MFG A;  2PDZ A;  4YDP A;  1N7F A;  2DM8 A;  4P2A B;  3PS4 A;  4OEP A;  4JOH A;  3OTP A;  1B8Q A;  1ZUB A;  4NMR A;  3PV4 A;  1WHA A;  2JIL A;  2OSG A;  3GCN A;  5DTH A;  4JOR A;  4NMQ A;  4OAJ A;  3HPK A;  2VSV A;  2EGO A;  1W9O A;  2KPL A;  4K75 A;  3E17 A;  1FCF A;  4JOF A;  4Q2Q A;  4HOP B;  4UU6 A;  2V90 A; 
#chains in the Genus database with same CATH homology
 5E22 A;  4K6Y A;  2K20 A;  2KG2 A;  3VQG A;  2D90 A;  4RI0 A;  2KOJ A;  2OMJ A;  2BYG A;  1FC7 A;  5FB8 C;  2MHO A;  2IWO A;  1QLC A;  4PQW A;  4REY A;  1UM7 A;  3CBZ A;  3QIK A;  2AIN A;  4NMV A;  4P0C A;  2EXG A;  5HJ1 A;  1QAU A;  5HFE A;  1TQ3 A;  4YYX A;  5B6L A;  2I04 A;  1RZX A;  2AWX A;  2W4F A;  3QO6 A;  1GQ5 A;  3GDV A;  2KOH A;  1X8S A;  2GZV A;  3TSV A;  3QJN A;  4JOG A;  4E35 A;  1WH1 A;  2HE4 A;  5HFB A;  2LOB A;  4F8K A;  2PNT A;  2I6V A;  4L8N A;  3ID1 A;  3KZE A;  4Q3H A;  5HF4 A;  1TP5 A;  1TP3 A;  2JIK A;  3R69 A;  2KJK A;  1GM1 A;  4JJ3 A;  1Q7X A;  2KRG A;  2PKT A;  2R4H A;  2M10 A;  1UJD A;  1V1T A;  3CBX A;  1KEF A;  2JRE A;  2PA1 A;  3DOR A;  3MH4 A;  1XZ9 A;  1OBY A;  1RGR A;  5IL9 A;  2ZPM A;  1X6D A;  2KL1 A;  2KBS A;  2O2T A;  4HOP A;  4EDJ A;  2HE2 A;  2CS5 A;  2FN5 A;  1TE0 A;  2WL7 A;  3VQF A;  1FC9 A;  3OU0 A;  2LUI A;  3GCO A;  4WYT A;  2P3W A;  1BE9 A;  1R6J A;  2KPK A;  1U37 A;  1QAV B;  1WI2 A;  1RY4 A;  2DAZ A;  1Z87 A;  4R2Z A;  4K78 A;  3KDK A;  1L6O A;  3GSL A;  4NNM A;  2OS6 A;  2D92 A;  3L4F D;  4UU5 A;  2EGN A;  2DLS A;  4AMH A;  2ZPL A;  2EDV A;  1VB7 A;  2AWW A;  3HPM A;  2EDZ A;  2EGK A;  1OBZ A;  3CYY A;  2Q3G A;  1VA8 A;  2LC7 A;  1UEQ A;  4GVD A;  5EZ0 A;  5I7Z A;  2K1Z A;  2EDP A;  1MFL A;  2M0Z A;  2OPG A;  4O06 A;  5HFD A;  2D8I A;  4JOE A;  1W9Q A;  2Q9V A;  1NF3 C;  1BFE A;  2VRF A;  2MX6 A;  2JSN A;  3KDG A;  3R0H A;  3FY5 A;  1D5G A;  1SOT A;  5HF1 A;  4KFV A;  3NFL A;  5A2P A;  3SHW A;  3QGL A;  1X5R A;  2I4S A;  2R3Y A;  1X5N A;  3BPU A;  1WHD A;  3DJ3 A;  1V5Q A;  1ZOK A;  1MC7 A;  3NFK A;  2VWR A;  3DJA A;  2YTW A;  1IU2 A;  2OZF A;  4Q2P A;  2I0L A;  4Z8J A;  4N6X A;  2M0T A;  5F67 A;  2OCS A;  5HEY A;  4NMS A;  2OQS A;  3K1R A;  3CH8 A;  1WFG A;  1P1E A;  2PKU A;  3RL8 A;  3GJ9 A;  2I0I A;  5B42 A;  1WJL A;  2QG1 A;  4NMT A;  1Z86 A;  2Z17 A;  3K82 A;  2QKV A;  3TSZ A;  1Q3P A;  2EAQ A;  4G69 A;  1WF8 A;  4E3B A;  3O5N A;  5E6P B;  1P1D A;  3WKM A;  3GGE A;  4GHN A;  1UJU A;  5HFF A;  1X9Z A;  2VSP A;  2QBW A;  2VPH A;  1N6F A;  2F5Y A;  2YT7 A;  3JXT A;  5HEB A;  3DIW A;  1Y8T A;  2FE5 A;  2CSS A;  4FLN A;  1OZI A;  2W7R A;  1VAE A;  3TSW A;  2KOM A;  3R68 A;  2E7K A;  1OBX A;  4NNL A;  3ID3 A;  2KJD A;  2HGA A;  2GEF A;  2JWE A;  2RRM A;  3EGH C;  1N7E A;  2L4T A;  3B76 A;  4FGM A;  4JJ0 A;  3MH7 A;  1VCW A;  2KA9 A;  1U39 A;  2YUB A;  1LCY A;  1VJ6 A;  5HFC A;  1WF7 A;  1N6D A;  3PV5 A;  4K72 A;  3GDS A;  2UZC A;  2L4S A;  4OEO A;  4JOK A;  3SHU A;  2M0U A;  3AXA A;  3HVQ C;  2DMZ A;  4JOP A;  1UEW A;  3LNX A;  2EEH A;  1V5L A;  1I92 A;  4JOJ A;  1Q3O A;  2KQF A;  1UIT A;  1WIF A;  2YUY A;  1T2M A;  5E11 A;  2AWU A;  1WI4 A;  1KY9 A;  1SOZ A;  5G1E A;  3TMH A;  2EV8 A;  1UM1 A;  3I1E A;  2G5M B;  2KAW A;  3RL7 A;  2REY A;  1KWA A;  3O46 A;  4IC6 A;  4NMP A;  1YBO A;  2KV8 A;  2JXO A;  2DC2 A;  4H11 A;  2H3L A;  3CC0 A;  5G1D A;  3KHF A;  4Q2N A;  1PDR A;  1GQ4 A;  2EJY A;  1W9E A;  3EGG C;  1WFV A;  2I1N A;  3I4W A;  4XHV A;  2X7Z A;  3DJ1 A;  1NTE A;  2H3M A;  2L97 A;  3MH6 A;  2QT5 A;  2DLU A;  2FNE A;  5HET A;  1G9O A;  5E1Y A;  1X45 A;  1U3B A;  3QE1 A;  1IU0 A;  4E34 A;  1V62 A;  2ENO A;  5H3J A;  3CBY A;  2H2B A;  2EEI A;  2M3M A;  4WYU A;  3RLE A;  4NXP A;  5JXB A;  3ID2 A;  2CSJ A;  1U38 A;  1QAV A;  4LMM A;  2VZ5 A;  4Q2O A;  1N6E A;  1M5Z A;  1K32 A;  2JIN A;  2V1W A;  4GVC A;  2G2L A;  2YT8 A;  2IWP A;  1UJV A;  1WG6 A;  2H2C A;  1FC6 A;  1N99 A;  4KFW A;  2KJP A;  4NXQ A;  3WKL A;  5D13 A;  3QDO A;  1N7T A;  1UEP A;  3NGH A;  3CS0 A;  3NCV A;  4MPA A;  3PDV A;  5HED A;  2EHR A;  5EYZ A;  1IHJ A;  1UFX A;  1Y7N A;  2EEG A;  3SFJ A;  5GLJ A;  1RGW A;  2DB5 A;  1UF1 A;  2M0V A;  2PZD A;  2QKT A;  5HDY A;  4Q6S A;  2F0A A;  2FCF A;  1UEZ A;  5FHT A;  5E21 A;  3QJM A;  2DJT A;  2KYL A;  2IWN A;  1V6B A;  4NXR A;  2JOA A;  4K76 A;  2LA8 A;  2LC6 A;  3SUZ A;  1UHP A;  5GND A;  3STJ A;  2DKR A;  4Q6H A;  1I16 A;  3I18 A;  5F3X A;  3KZD A;  3LNY A;  2EEJ A;  3GAB A;  2QKU A;  3GDU A;  3PDZ A;  5ILB A;  2Z9I A;  3ID4 A;  4Z33 A;  4NMO A;  2OGP A;  2RCZ A;  2IWQ A;  3SOE A;  1X5Q A;  4JL7 A;  3PV2 A;  3K50 A;  3ZRT A;  1MFG A;  2PDZ A;  4YDP A;  1N7F A;  2DM8 A;  4P2A B;  3PS4 A;  4OEP A;  4JOH A;  3OTP A;  1B8Q A;  1ZUB A;  4NMR A;  3PV4 A;  1WHA A;  2JIL A;  2OSG A;  3GCN A;  5DTH A;  4JOR A;  4NMQ A;  4OAJ A;  3HPK A;  2VSV A;  2EGO A;  1W9O A;  2KPL A;  4K75 A;  3E17 A;  1FCF A;  4JOF A;  4Q2Q A;  4HOP B;  4UU6 A;  2V90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...