5HETA

The third pdz domain from the synaptic protein psd-95 (g330t mutant)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
SPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5hetA00
4F8KA 2KJDA 1U39A 3I1EA 4Q6HA 2HE4A 2GZVA 2Q3GA 2EEJA 3LNXA 3DIWA 2JIKA 1KEFA 5HFBA 3GSLA 2JOAA 3ID4A 2OSGA 2DMZA 2KG2A 2L97A 3WKMA 1N7TA 2H3MA 5DTHA 1WFGA 4R2ZA 1KWAA 4NNLA 1UJDA 1I16A 2JINA 1V1TA 2EGNA 3K1RA 1M5ZA 2YUBA 2KJKA 4NMRA 2HGAA 4K75A 2KAWA 1N6EA 3TSZA 1MFGA 1WHDA 3PS4A 5G1EA 2ZPMA 1UM7A 3SHUA 1RGWA 1UEQA 1UJVA 1L6OA 1Q7XA 5HFEA 2AINA 4AMHA 1N7EA 3KZDA 2KBSA 2RCZA 4NMPA 4HOPB 4RI0A 4E34A 5HJ1A 2OQSA 2KOJA 3EGGC 1W9OA 4YDPA 2D8IA 3VQGA 1IU0A 2FN5A 3DJ1A 3HVQC 3NFLA 4JOPA 4MPAA 2DLUA 2VSVA 2PKTA 1SOTA 2L4TA 5G1DA 1OBXA 4JOJA 4E35A 1NTEA 2EEGA 3RL8A 1PDRA 3KHFA 4Z8JA 1WG6A 3GGEA 1UITA 2D92A 4REYA 4P2AB 4Q2NA 2EEIA 2DLSA 2JREA 5E11A 2M10A 2QBWA 1N7FA 5I7ZA 2H2BA 2KOMA 3STJA 3HPMA 4GHNA 2IWNA 1WIFA 3O5NA 1WI2A 2R4HA 5B6LA 3CS0A 2IWOA 3FY5A 1Y8TA 2JWEA 2KRGA 1X6DA 2JXOA 3TSVA 1RZXA 4PQWA 4NMTA 1TP3A 2YT7A 1WH1A 4NXRA 2YUYA 2EV8A 2EEHA 1I92A 2AWUA 2X7ZA 4JORA 3QIKA 1UJUA 2I6VA 3NFKA 2DM8A 4WYUA 2EXGA 1G9OA 1T2MA 1WHAA 2EJYA 3B76A 1U37A 1WJLA 2KV8A 1B8QA 2FNEA 2V1WA 4NMSA 5HF4A 1N99A 3SOEA 2YT8A 1TE0A 2LC6A 5E6PB 3PDZA 2EGOA 5FHTA 5EYZA 2KJPA 1KY9A 3BPUA 4HOPA 4OAJA 4FGMA 1UM1A 3HPKA 1QAVB 1VB7A 5F67A 2K1ZA 1WI4A 1V6BA 2PZDA 4O06A 2W4FA 3WKLA 2MX6A 5EZ0A 1FC6A 1XZ9A 2QKVA 5H3JA 2DC2A 2I04A 1P1DA 2VPHA 2KPLA 1MFLA 1X45A 3MH4A 2OS6A 4Q2PA 3VQFA 5E22A 2I0LA 2Z17A 2KOHA 1Y7NA 1TQ3A 2E7KA 4LMMA 3QJMA 2LA8A 2QG1A 1U3BA 4JOGA 2Z9IA 3R68A 1YBOA 2OMJA 2AWWA 4GVDA 2OZFA 2KYLA 4UU6A 4XHVA 1WFVA 2PKUA 4Q3HA 2VWRA 5HDYA 1FC7A 2M0UA 2EAQA 1MC7A 3OU0A 2KA9A 2G5MB 4Q2OA 3K82A 3R0HA 3EGHC 4N6XA 5HFDA 3ID1A 2FCFA 3QJNA 1W9EA 3GDSA 4K78A 2WL7A 5D13A 2I0IA 2H2CA 4OEOA 3PV5A 1Q3OA 1VCWA 1RGRA 4YYXA 2MHOA 1BFEA 2CSSA 3DJ3A 4KFWA 2LC7A 1LCYA 4NMOA 4EDJA 1OBZA 4K6YA 1UF1A 1D5GA 1V62A 3MH6A 3GCOA 3ID2A 1N6FA 3JXTA 1WF7A 3DJAA 1BE9A 4NXPA 2LUIA 2YTWA 3GJ9A 1ZUBA 4JL7A 5JXBA 2JILA 3GDVA 2OCSA 1UEWA 1Z87A 1K32A 3PV2A 2V90A 2KQFA 2OPGA 1Q3PA 1V5LA 4K72A 3CBYA 3CH8A 4G69A 3GCNA 2VRFA 2HE2A 3PDVA 1TP5A 1GQ5A 4JOEA 5HFCA 3TMHA 2K20A 2O2TA 3QGLA 2F0AA 3PV4A 4JOFA 1Z86A 1NF3C 2IWPA 1UHPA 2EGKA 2PNTA 2VZ5A 1GM1A 2DJTA 2M3MA 2I4SA 2QKUA 1X5NA 4NMVA 5A2PA 2M0TA 4K76A 3L4FD 3ZRTA 1W9QA 1ZOKA 2LOBA 2PA1A 4L8NA 4NXQA 2QKTA 3CYYA 3K50A 2UZCA 3CBXA 5GLJA 1UFXA 1RY4A 2CS5A 5HEBA 2P3WA 3R69A 1U38A 4NMQA 2REYA 1UEZA 1N6DA 1FCFA 1VAEA 2ENOA 2G2LA 2VSPA 2H3LA 2PDZA 1VA8A 2QT5A 2D90A 5E21A 5HEYA 1QAUA 2IWQA 5F3XA 3O46A 3KZEA 3ID3A 5E1YA 3RL7A 1X8SA 4UU5A 1OZIA 1GQ4A 2Q9VA 1UEPA 4NNMA 1SOZA 2R3YA 4JOKA 4Q6SA 4P0CA 4OEPA 2DAZA 1P1EA 4GVCA 3OTPA 2DKRA 3AXAA 4H11A 2M0ZA 2OGPA 4KFVA 2BYGA 5HEDA 2DB5A 5GNDA 5HETA 5FB8C 2EDZA 1OBYA 4Z33A 2FE5A 3I4WA 3MH7A 1X5QA 1IHJA 3NGHA 1VJ6A 2F5YA 2RRMA 4Q2QA 3SUZA 4E3BA 1IU2A 1FC9A 2M0VA 5HFFA 2KL1A 3LNYA 2CSJA 2EDVA 3SFJA 1QLCA 2ZPLA 2KPKA 1WF8A 2EHRA 3SHWA 1QAVA 3CBZA 1R6JA 5HF1A 3DORA 4IC6A 3CC0A 2W7RA 2L4SA 3GDUA 3RLEA 3QE1A 3TSWA 3I18A 3E17A 3QO6A 4JOHA 1V5QA 2I1NA 2AWXA 3QDOA 1X5RA 4WYTA 2EDPA
chains in the Genus database with same CATH superfamily
4F8KA 2KJDA 1U39A 3I1EA 4Q6HA 2HE4A 2GZVA 2Q3GA 2EEJA 3LNXA 3DIWA 2JIKA 1KEFA 5HFBA 3GSLA 2JOAA 3ID4A 2OSGA 2DMZA 2KG2A 2L97A 3WKMA 1N7TA 2H3MA 5DTHA 1WFGA 4R2ZA 1KWAA 4NNLA 1UJDA 1I16A 2JINA 1V1TA 2EGNA 3K1RA 1M5ZA 2GEFA 2YUBA 2KJKA 4NMRA 2HGAA 4K75A 2KAWA 1N6EA 3TSZA 1MFGA 1WHDA 5IL9A 3PS4A 5G1EA 2ZPMA 1UM7A 3SHUA 1RGWA 1UEQA 1UJVA 1L6OA 1Q7XA 5HFEA 2AINA 4AMHA 1N7EA 3KZDA 2KBSA 2RCZA 4NMPA 4HOPB 4RI0A 4E34A 5HJ1A 2OQSA 2KOJA 3EGGC 1W9OA 4YDPA 2D8IA 3VQGA 1IU0A 2FN5A 3DJ1A 3HVQC 3NFLA 4JOPA 4MPAA 2DLUA 2VSVA 2PKTA 1SOTA 2L4TA 5G1DA 1OBXA 4JOJA 4E35A 1NTEA 2EEGA 3RL8A 1PDRA 3KHFA 4Z8JA 1WG6A 3GGEA 1UITA 2D92A 4REYA 4P2AB 4Q2NA 2EEIA 2DLSA 2JREA 5E11A 2M10A 2QBWA 1X9ZA 1N7FA 5I7ZA 2H2BA 2KOMA 3STJA 3HPMA 4GHNA 2IWNA 1WIFA 3O5NA 1WI2A 2R4HA 5B6LA 3CS0A 2IWOA 3FY5A 1Y8TA 2JWEA 2KRGA 1X6DA 2JXOA 3TSVA 1RZXA 4JJ0A 4PQWA 4NMTA 1TP3A 2YT7A 1WH1A 4NXRA 2YUYA 2EV8A 2EEHA 1I92A 2AWUA 2X7ZA 4JORA 3QIKA 1UJUA 2I6VA 3NFKA 2DM8A 4WYUA 2EXGA 1G9OA 1T2MA 1WHAA 2EJYA 3B76A 1U37A 1WJLA 2KV8A 1B8QA 2FNEA 2V1WA 4JJ3A 4NMSA 5HF4A 1N99A 3SOEA 2YT8A 1TE0A 2LC6A 5E6PB 3PDZA 2EGOA 5FHTA 5EYZA 2KJPA 1KY9A 3BPUA 4HOPA 4OAJA 4FGMA 1UM1A 3HPKA 1QAVB 1VB7A 5F67A 2K1ZA 1WI4A 1V6BA 2PZDA 4O06A 2W4FA 3WKLA 2MX6A 5EZ0A 1FC6A 1XZ9A 2QKVA 5H3JA 2DC2A 2I04A 1P1DA 2VPHA 2KPLA 1MFLA 1X45A 3MH4A 2OS6A 4Q2PA 3VQFA 5E22A 2I0LA 2Z17A 2KOHA 1Y7NA 1TQ3A 2E7KA 4LMMA 3QJMA 2LA8A 2QG1A 1U3BA 4JOGA 2Z9IA 3R68A 1YBOA 2OMJA 2AWWA 4GVDA 2OZFA 2KYLA 4UU6A 4XHVA 1WFVA 2PKUA 4Q3HA 2VWRA 5HDYA 1FC7A 2M0UA 2EAQA 1MC7A 3OU0A 2KA9A 2G5MB 4Q2OA 3K82A 3R0HA 3EGHC 4N6XA 5HFDA 3ID1A 2FCFA 3QJNA 1W9EA 3GDSA 4K78A 2WL7A 5D13A 2I0IA 2H2CA 4OEOA 3PV5A 2JSNA 1Q3OA 1VCWA 1RGRA 4YYXA 2MHOA 1BFEA 2CSSA 3DJ3A 4KFWA 5B42A 4FLNA 3NCVA 2LC7A 1LCYA 4NMOA 4EDJA 1OBZA 4K6YA 1UF1A 1D5GA 1V62A 3MH6A 3GCOA 3ID2A 1N6FA 3JXTA 1WF7A 3DJAA 1BE9A 4NXPA 2LUIA 2YTWA 3GJ9A 1ZUBA 4JL7A 5JXBA 2JILA 3GDVA 2OCSA 1UEWA 1Z87A 1K32A 3PV2A 2V90A 2KQFA 2OPGA 1Q3PA 1V5LA 4K72A 3CBYA 5ILBA 3CH8A 4G69A 3GCNA 2VRFA 2HE2A 3PDVA 1TP5A 1GQ5A 4JOEA 3KDKA 5HFCA 3TMHA 2K20A 2O2TA 3QGLA 2F0AA 3PV4A 4JOFA 1Z86A 1NF3C 2IWPA 1UHPA 2EGKA 2PNTA 2VZ5A 1GM1A 2DJTA 2M3MA 2I4SA 2QKUA 1X5NA 4NMVA 5A2PA 2M0TA 4K76A 3L4FD 3ZRTA 1W9QA 1ZOKA 2LOBA 2PA1A 4L8NA 4NXQA 2QKTA 3CYYA 3K50A 2UZCA 3CBXA 5GLJA 1UFXA 1RY4A 2CS5A 5HEBA 2P3WA 3R69A 1U38A 4NMQA 2REYA 1UEZA 1N6DA 1FCFA 1VAEA 2ENOA 2G2LA 3GABA 2VSPA 2H3LA 2PDZA 1VA8A 2QT5A 2D90A 5E21A 5HEYA 1QAUA 2IWQA 5F3XA 3O46A 3KZEA 3ID3A 5E1YA 3RL7A 1X8SA 4UU5A 1OZIA 1GQ4A 2Q9VA 1UEPA 4NNMA 1SOZA 2R3YA 4JOKA 4Q6SA 4P0CA 4OEPA 2DAZA 1P1EA 4GVCA 3OTPA 2DKRA 3AXAA 4H11A 2M0ZA 2OGPA 4KFVA 2BYGA 3KDGA 5HEDA 2DB5A 5GNDA 5HETA 5FB8C 2EDZA 1OBYA 4Z33A 2FE5A 3I4WA 3MH7A 1X5QA 1IHJA 3NGHA 1VJ6A 2F5YA 2RRMA 4Q2QA 3SUZA 4E3BA 1IU2A 1FC9A 2M0VA 5HFFA 2KL1A 3LNYA 2CSJA 2EDVA 3SFJA 1QLCA 2ZPLA 2KPKA 1WF8A 2EHRA 3SHWA 1QAVA 3CBZA 1R6JA 5HF1A 3DORA 4IC6A 3CC0A 2W7RA 2L4SA 3GDUA 3RLEA 3QE1A 3TSWA 3I18A 3E17A 3QO6A 4JOHA 1V5QA 2I1NA 2AWXA 3QDOA 1X5RA 4WYTA 2EDPA
chains in the Genus database with same CATH topology
4F8KA 2KJDA 1U39A 3I1EA 4Q6HA 2HE4A 2GZVA 2Q3GA 2EEJA 3LNXA 3DIWA 2JIKA 1KEFA 5HFBA 3GSLA 2JOAA 3ID4A 2OSGA 2DMZA 2KG2A 2L97A 3WKMA 1N7TA 2H3MA 5DTHA 1WFGA 4R2ZA 1KWAA 4NNLA 1UJDA 1I16A 2JINA 1V1TA 2EGNA 3K1RA 1M5ZA 2GEFA 2YUBA 2KJKA 4NMRA 2HGAA 4K75A 2KAWA 1N6EA 3TSZA 1MFGA 1WHDA 5IL9A 3PS4A 5G1EA 2ZPMA 1UM7A 3SHUA 1RGWA 1UEQA 1UJVA 1L6OA 1Q7XA 5HFEA 2AINA 4AMHA 1N7EA 3KZDA 2KBSA 2RCZA 4NMPA 4HOPB 4RI0A 4E34A 5HJ1A 2OQSA 2KOJA 3EGGC 1W9OA 4YDPA 2D8IA 3VQGA 1IU0A 2FN5A 3DJ1A 3HVQC 3NFLA 4JOPA 4MPAA 2DLUA 2VSVA 2PKTA 1SOTA 2L4TA 5G1DA 1OBXA 4JOJA 4E35A 1NTEA 2EEGA 3RL8A 1PDRA 3KHFA 4Z8JA 1WG6A 3GGEA 1UITA 2D92A 4REYA 4P2AB 4Q2NA 2EEIA 2DLSA 2JREA 5E11A 2M10A 2QBWA 1X9ZA 1N7FA 5I7ZA 2H2BA 2KOMA 3STJA 3HPMA 4GHNA 2IWNA 1WIFA 3O5NA 1WI2A 2R4HA 5B6LA 3CS0A 2IWOA 3FY5A 1Y8TA 2JWEA 2KRGA 1X6DA 2JXOA 3TSVA 1RZXA 4JJ0A 4PQWA 4NMTA 1TP3A 2YT7A 1WH1A 4NXRA 2YUYA 2EV8A 2EEHA 1I92A 2AWUA 2X7ZA 4JORA 3QIKA 1UJUA 2I6VA 3NFKA 2DM8A 4WYUA 2EXGA 1G9OA 1T2MA 1WHAA 2EJYA 3B76A 1U37A 1WJLA 2KV8A 1B8QA 2FNEA 2V1WA 4JJ3A 4NMSA 5HF4A 1N99A 3SOEA 2YT8A 1TE0A 2LC6A 5E6PB 3PDZA 2EGOA 5FHTA 5EYZA 2KJPA 1KY9A 3BPUA 4HOPA 4OAJA 4FGMA 1UM1A 3HPKA 1QAVB 1VB7A 5F67A 2K1ZA 1WI4A 1V6BA 2PZDA 4O06A 2W4FA 3WKLA 2MX6A 5EZ0A 1FC6A 1XZ9A 2QKVA 5H3JA 2DC2A 2I04A 1P1DA 2VPHA 2KPLA 1MFLA 1X45A 3MH4A 2OS6A 4Q2PA 3VQFA 5E22A 2I0LA 2Z17A 2KOHA 1Y7NA 1TQ3A 2E7KA 4LMMA 3QJMA 2LA8A 2QG1A 1U3BA 4JOGA 2Z9IA 3R68A 1YBOA 2OMJA 2AWWA 4GVDA 2OZFA 2KYLA 4UU6A 4XHVA 1WFVA 2PKUA 4Q3HA 2VWRA 5HDYA 1FC7A 2M0UA 2EAQA 1MC7A 3OU0A 2KA9A 2G5MB 4Q2OA 3K82A 3R0HA 3EGHC 4N6XA 5HFDA 3ID1A 2FCFA 3QJNA 1W9EA 3GDSA 4K78A 2WL7A 5D13A 2I0IA 2H2CA 4OEOA 3PV5A 2JSNA 1Q3OA 1VCWA 1RGRA 4YYXA 2MHOA 1BFEA 2CSSA 3DJ3A 4KFWA 5B42A 4FLNA 3NCVA 2LC7A 1LCYA 4NMOA 4EDJA 1OBZA 4K6YA 1UF1A 1D5GA 1V62A 3MH6A 3GCOA 3ID2A 1N6FA 3JXTA 1WF7A 3DJAA 1BE9A 4NXPA 2LUIA 2YTWA 3GJ9A 1ZUBA 4JL7A 5JXBA 2JILA 3GDVA 2OCSA 1UEWA 1Z87A 1K32A 3PV2A 2V90A 2KQFA 2OPGA 1Q3PA 1V5LA 4K72A 3CBYA 5ILBA 3CH8A 4G69A 3GCNA 2VRFA 2HE2A 3PDVA 1TP5A 1GQ5A 4JOEA 3KDKA 5HFCA 3TMHA 2K20A 2O2TA 3QGLA 2F0AA 3PV4A 4JOFA 1Z86A 1NF3C 2IWPA 1UHPA 2EGKA 2PNTA 2VZ5A 1GM1A 2DJTA 2M3MA 2I4SA 2QKUA 1X5NA 4NMVA 5A2PA 2M0TA 4K76A 3L4FD 3ZRTA 1W9QA 1ZOKA 2LOBA 2PA1A 4L8NA 4NXQA 2QKTA 3CYYA 3K50A 2UZCA 3CBXA 5GLJA 1UFXA 1RY4A 2CS5A 5HEBA 2P3WA 3R69A 1U38A 4NMQA 2REYA 1UEZA 1N6DA 1FCFA 1VAEA 2ENOA 2G2LA 3GABA 2VSPA 2H3LA 2PDZA 1VA8A 2QT5A 2D90A 5E21A 5HEYA 1QAUA 2IWQA 5F3XA 3O46A 3KZEA 3ID3A 5E1YA 3RL7A 1X8SA 4UU5A 1OZIA 1GQ4A 2Q9VA 1UEPA 4NNMA 1SOZA 2R3YA 4JOKA 4Q6SA 4P0CA 4OEPA 2DAZA 1P1EA 4GVCA 3OTPA 2DKRA 3AXAA 4H11A 2M0ZA 2OGPA 4KFVA 2BYGA 3KDGA 5HEDA 2DB5A 5GNDA 5HETA 5FB8C 2EDZA 1OBYA 4Z33A 2FE5A 3I4WA 3MH7A 1X5QA 1IHJA 3NGHA 1VJ6A 2F5YA 2RRMA 4Q2QA 3SUZA 4E3BA 1IU2A 1FC9A 2M0VA 5HFFA 2KL1A 3LNYA 2CSJA 2EDVA 3SFJA 1QLCA 2ZPLA 2KPKA 1WF8A 2EHRA 3SHWA 1QAVA 3CBZA 1R6JA 5HF1A 3DORA 4IC6A 3CC0A 2W7RA 2L4SA 3GDUA 3RLEA 3QE1A 3TSWA 3I18A 3E17A 3QO6A 4JOHA 1V5QA 2I1NA 2AWXA 3QDOA 1X5RA 4WYTA 2EDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8K A;  2KJD A;  1U39 A;  3I1E A;  4Q6H A;  2HE4 A;  2GZV A;  2Q3G A;  2EEJ A;  3LNX A;  3DIW A;  2JIK A;  1KEF A;  5HFB A;  3GSL A;  2JOA A;  3ID4 A;  2OSG A;  2DMZ A;  2KG2 A;  2L97 A;  3WKM A;  1N7T A;  2H3M A;  5DTH A;  1WFG A;  4R2Z A;  1KWA A;  4NNL A;  1UJD A;  1I16 A;  2JIN A;  1V1T A;  2EGN A;  3K1R A;  1M5Z A;  2YUB A;  2KJK A;  4NMR A;  2HGA A;  4K75 A;  2KAW A;  1N6E A;  3TSZ A;  1MFG A;  1WHD A;  3PS4 A;  5G1E A;  2ZPM A;  1UM7 A;  3SHU A;  1RGW A;  1UEQ A;  1UJV A;  1L6O A;  1Q7X A;  5HFE A;  2AIN A;  4AMH A;  1N7E A;  3KZD A;  2KBS A;  2RCZ A;  4NMP A;  4HOP B;  4RI0 A;  4E34 A;  5HJ1 A;  2OQS A;  2KOJ A;  3EGG C;  1W9O A;  4YDP A;  2D8I A;  3VQG A;  1IU0 A;  2FN5 A;  3DJ1 A;  3HVQ C;  3NFL A;  4JOP A;  4MPA A;  2DLU A;  2VSV A;  2PKT A;  1SOT A;  2L4T A;  5G1D A;  1OBX A;  4JOJ A;  4E35 A;  1NTE A;  2EEG A;  3RL8 A;  1PDR A;  3KHF A;  4Z8J A;  1WG6 A;  3GGE A;  1UIT A;  2D92 A;  4REY A;  4P2A B;  4Q2N A;  2EEI A;  2DLS A;  2JRE A;  5E11 A;  2M10 A;  2QBW A;  1N7F A;  5I7Z A;  2H2B A;  2KOM A;  3STJ A;  3HPM A;  4GHN A;  2IWN A;  1WIF A;  3O5N A;  1WI2 A;  2R4H A;  5B6L A;  3CS0 A;  2IWO A;  3FY5 A;  1Y8T A;  2JWE A;  2KRG A;  1X6D A;  2JXO A;  3TSV A;  1RZX A;  4PQW A;  4NMT A;  1TP3 A;  2YT7 A;  1WH1 A;  4NXR A;  2YUY A;  2EV8 A;  2EEH A;  1I92 A;  2AWU A;  2X7Z A;  4JOR A;  3QIK A;  1UJU A;  2I6V A;  3NFK A;  2DM8 A;  4WYU A;  2EXG A;  1G9O A;  1T2M A;  1WHA A;  2EJY A;  3B76 A;  1U37 A;  1WJL A;  2KV8 A;  1B8Q A;  2FNE A;  2V1W A;  4NMS A;  5HF4 A;  1N99 A;  3SOE A;  2YT8 A;  1TE0 A;  2LC6 A;  5E6P B;  3PDZ A;  2EGO A;  5FHT A;  5EYZ A;  2KJP A;  1KY9 A;  3BPU A;  4HOP A;  4OAJ A;  4FGM A;  1UM1 A;  3HPK A;  1QAV B;  1VB7 A;  5F67 A;  2K1Z A;  1WI4 A;  1V6B A;  2PZD A;  4O06 A;  2W4F A;  3WKL A;  2MX6 A;  5EZ0 A;  1FC6 A;  1XZ9 A;  2QKV A;  5H3J A;  2DC2 A;  2I04 A;  1P1D A;  2VPH A;  2KPL A;  1MFL A;  1X45 A;  3MH4 A;  2OS6 A;  4Q2P A;  3VQF A;  5E22 A;  2I0L A;  2Z17 A;  2KOH A;  1Y7N A;  1TQ3 A;  2E7K A;  4LMM A;  3QJM A;  2LA8 A;  2QG1 A;  1U3B A;  4JOG A;  2Z9I A;  3R68 A;  1YBO A;  2OMJ A;  2AWW A;  4GVD A;  2OZF A;  2KYL A;  4UU6 A;  4XHV A;  1WFV A;  2PKU A;  4Q3H A;  2VWR A;  5HDY A;  1FC7 A;  2M0U A;  2EAQ A;  1MC7 A;  3OU0 A;  2KA9 A;  2G5M B;  4Q2O A;  3K82 A;  3R0H A;  3EGH C;  4N6X A;  5HFD A;  3ID1 A;  2FCF A;  3QJN A;  1W9E A;  3GDS A;  4K78 A;  2WL7 A;  5D13 A;  2I0I A;  2H2C A;  4OEO A;  3PV5 A;  1Q3O A;  1VCW A;  1RGR A;  4YYX A;  2MHO A;  1BFE A;  2CSS A;  3DJ3 A;  4KFW A;  2LC7 A;  1LCY A;  4NMO A;  4EDJ A;  1OBZ A;  4K6Y A;  1UF1 A;  1D5G A;  1V62 A;  3MH6 A;  3GCO A;  3ID2 A;  1N6F A;  3JXT A;  1WF7 A;  3DJA A;  1BE9 A;  4NXP A;  2LUI A;  2YTW A;  3GJ9 A;  1ZUB A;  4JL7 A;  5JXB A;  2JIL A;  3GDV A;  2OCS A;  1UEW A;  1Z87 A;  1K32 A;  3PV2 A;  2V90 A;  2KQF A;  2OPG A;  1Q3P A;  1V5L A;  4K72 A;  3CBY A;  3CH8 A;  4G69 A;  3GCN A;  2VRF A;  2HE2 A;  3PDV A;  1TP5 A;  1GQ5 A;  4JOE A;  5HFC A;  3TMH A;  2K20 A;  2O2T A;  3QGL A;  2F0A A;  3PV4 A;  4JOF A;  1Z86 A;  1NF3 C;  2IWP A;  1UHP A;  2EGK A;  2PNT A;  2VZ5 A;  1GM1 A;  2DJT A;  2M3M A;  2I4S A;  2QKU A;  1X5N A;  4NMV A;  5A2P A;  2M0T A;  4K76 A;  3L4F D;  3ZRT A;  1W9Q A;  1ZOK A;  2LOB A;  2PA1 A;  4L8N A;  4NXQ A;  2QKT A;  3CYY A;  3K50 A;  2UZC A;  3CBX A;  5GLJ A;  1UFX A;  1RY4 A;  2CS5 A;  5HEB A;  2P3W A;  3R69 A;  1U38 A;  4NMQ A;  2REY A;  1UEZ A;  1N6D A;  1FCF A;  1VAE A;  2ENO A;  2G2L A;  2VSP A;  2H3L A;  2PDZ A;  1VA8 A;  2QT5 A;  2D90 A;  5E21 A;  5HEY A;  1QAU A;  2IWQ A;  5F3X A;  3O46 A;  3KZE A;  3ID3 A;  5E1Y A;  3RL7 A;  1X8S A;  4UU5 A;  1OZI A;  1GQ4 A;  2Q9V A;  1UEP A;  4NNM A;  1SOZ A;  2R3Y A;  4JOK A;  4Q6S A;  4P0C A;  4OEP A;  2DAZ A;  1P1E A;  4GVC A;  3OTP A;  2DKR A;  3AXA A;  4H11 A;  2M0Z A;  2OGP A;  4KFV A;  2BYG A;  5HED A;  2DB5 A;  5GND A;  5HET A;  5FB8 C;  2EDZ A;  1OBY A;  4Z33 A;  2FE5 A;  3I4W A;  3MH7 A;  1X5Q A;  1IHJ A;  3NGH A;  1VJ6 A;  2F5Y A;  2RRM A;  4Q2Q A;  3SUZ A;  4E3B A;  1IU2 A;  1FC9 A;  2M0V A;  5HFF A;  2KL1 A;  3LNY A;  2CSJ A;  2EDV A;  3SFJ A;  1QLC A;  2ZPL A;  2KPK A;  1WF8 A;  2EHR A;  3SHW A;  1QAV A;  3CBZ A;  1R6J A;  5HF1 A;  3DOR A;  4IC6 A;  3CC0 A;  2W7R A;  2L4S A;  3GDU A;  3RLE A;  3QE1 A;  3TSW A;  3I18 A;  3E17 A;  3QO6 A;  4JOH A;  1V5Q A;  2I1N A;  2AWX A;  3QDO A;  1X5R A;  4WYT A;  2EDP A; 
#chains in the Genus database with same CATH topology
 4F8K A;  2KJD A;  1U39 A;  3I1E A;  4Q6H A;  2HE4 A;  2GZV A;  2Q3G A;  2EEJ A;  3LNX A;  3DIW A;  2JIK A;  1KEF A;  5HFB A;  3GSL A;  2JOA A;  3ID4 A;  2OSG A;  2DMZ A;  2KG2 A;  2L97 A;  3WKM A;  1N7T A;  2H3M A;  5DTH A;  1WFG A;  4R2Z A;  1KWA A;  4NNL A;  1UJD A;  1I16 A;  2JIN A;  1V1T A;  2EGN A;  3K1R A;  1M5Z A;  2GEF A;  2YUB A;  2KJK A;  4NMR A;  2HGA A;  4K75 A;  2KAW A;  1N6E A;  3TSZ A;  1MFG A;  1WHD A;  5IL9 A;  3PS4 A;  5G1E A;  2ZPM A;  1UM7 A;  3SHU A;  1RGW A;  1UEQ A;  1UJV A;  1L6O A;  1Q7X A;  5HFE A;  2AIN A;  4AMH A;  1N7E A;  3KZD A;  2KBS A;  2RCZ A;  4NMP A;  4HOP B;  4RI0 A;  4E34 A;  5HJ1 A;  2OQS A;  2KOJ A;  3EGG C;  1W9O A;  4YDP A;  2D8I A;  3VQG A;  1IU0 A;  2FN5 A;  3DJ1 A;  3HVQ C;  3NFL A;  4JOP A;  4MPA A;  2DLU A;  2VSV A;  2PKT A;  1SOT A;  2L4T A;  5G1D A;  1OBX A;  4JOJ A;  4E35 A;  1NTE A;  2EEG A;  3RL8 A;  1PDR A;  3KHF A;  4Z8J A;  1WG6 A;  3GGE A;  1UIT A;  2D92 A;  4REY A;  4P2A B;  4Q2N A;  2EEI A;  2DLS A;  2JRE A;  5E11 A;  2M10 A;  2QBW A;  1X9Z A;  1N7F A;  5I7Z A;  2H2B A;  2KOM A;  3STJ A;  3HPM A;  4GHN A;  2IWN A;  1WIF A;  3O5N A;  1WI2 A;  2R4H A;  5B6L A;  3CS0 A;  2IWO A;  3FY5 A;  1Y8T A;  2JWE A;  2KRG A;  1X6D A;  2JXO A;  3TSV A;  1RZX A;  4JJ0 A;  4PQW A;  4NMT A;  1TP3 A;  2YT7 A;  1WH1 A;  4NXR A;  2YUY A;  2EV8 A;  2EEH A;  1I92 A;  2AWU A;  2X7Z A;  4JOR A;  3QIK A;  1UJU A;  2I6V A;  3NFK A;  2DM8 A;  4WYU A;  2EXG A;  1G9O A;  1T2M A;  1WHA A;  2EJY A;  3B76 A;  1U37 A;  1WJL A;  2KV8 A;  1B8Q A;  2FNE A;  2V1W A;  4JJ3 A;  4NMS A;  5HF4 A;  1N99 A;  3SOE A;  2YT8 A;  1TE0 A;  2LC6 A;  5E6P B;  3PDZ A;  2EGO A;  5FHT A;  5EYZ A;  2KJP A;  1KY9 A;  3BPU A;  4HOP A;  4OAJ A;  4FGM A;  1UM1 A;  3HPK A;  1QAV B;  1VB7 A;  5F67 A;  2K1Z A;  1WI4 A;  1V6B A;  2PZD A;  4O06 A;  2W4F A;  3WKL A;  2MX6 A;  5EZ0 A;  1FC6 A;  1XZ9 A;  2QKV A;  5H3J A;  2DC2 A;  2I04 A;  1P1D A;  2VPH A;  2KPL A;  1MFL A;  1X45 A;  3MH4 A;  2OS6 A;  4Q2P A;  3VQF A;  5E22 A;  2I0L A;  2Z17 A;  2KOH A;  1Y7N A;  1TQ3 A;  2E7K A;  4LMM A;  3QJM A;  2LA8 A;  2QG1 A;  1U3B A;  4JOG A;  2Z9I A;  3R68 A;  1YBO A;  2OMJ A;  2AWW A;  4GVD A;  2OZF A;  2KYL A;  4UU6 A;  4XHV A;  1WFV A;  2PKU A;  4Q3H A;  2VWR A;  5HDY A;  1FC7 A;  2M0U A;  2EAQ A;  1MC7 A;  3OU0 A;  2KA9 A;  2G5M B;  4Q2O A;  3K82 A;  3R0H A;  3EGH C;  4N6X A;  5HFD A;  3ID1 A;  2FCF A;  3QJN A;  1W9E A;  3GDS A;  4K78 A;  2WL7 A;  5D13 A;  2I0I A;  2H2C A;  4OEO A;  3PV5 A;  2JSN A;  1Q3O A;  1VCW A;  1RGR A;  4YYX A;  2MHO A;  1BFE A;  2CSS A;  3DJ3 A;  4KFW A;  5B42 A;  4FLN A;  3NCV A;  2LC7 A;  1LCY A;  4NMO A;  4EDJ A;  1OBZ A;  4K6Y A;  1UF1 A;  1D5G A;  1V62 A;  3MH6 A;  3GCO A;  3ID2 A;  1N6F A;  3JXT A;  1WF7 A;  3DJA A;  1BE9 A;  4NXP A;  2LUI A;  2YTW A;  3GJ9 A;  1ZUB A;  4JL7 A;  5JXB A;  2JIL A;  3GDV A;  2OCS A;  1UEW A;  1Z87 A;  1K32 A;  3PV2 A;  2V90 A;  2KQF A;  2OPG A;  1Q3P A;  1V5L A;  4K72 A;  3CBY A;  5ILB A;  3CH8 A;  4G69 A;  3GCN A;  2VRF A;  2HE2 A;  3PDV A;  1TP5 A;  1GQ5 A;  4JOE A;  3KDK A;  5HFC A;  3TMH A;  2K20 A;  2O2T A;  3QGL A;  2F0A A;  3PV4 A;  4JOF A;  1Z86 A;  1NF3 C;  2IWP A;  1UHP A;  2EGK A;  2PNT A;  2VZ5 A;  1GM1 A;  2DJT A;  2M3M A;  2I4S A;  2QKU A;  1X5N A;  4NMV A;  5A2P A;  2M0T A;  4K76 A;  3L4F D;  3ZRT A;  1W9Q A;  1ZOK A;  2LOB A;  2PA1 A;  4L8N A;  4NXQ A;  2QKT A;  3CYY A;  3K50 A;  2UZC A;  3CBX A;  5GLJ A;  1UFX A;  1RY4 A;  2CS5 A;  5HEB A;  2P3W A;  3R69 A;  1U38 A;  4NMQ A;  2REY A;  1UEZ A;  1N6D A;  1FCF A;  1VAE A;  2ENO A;  2G2L A;  3GAB A;  2VSP A;  2H3L A;  2PDZ A;  1VA8 A;  2QT5 A;  2D90 A;  5E21 A;  5HEY A;  1QAU A;  2IWQ A;  5F3X A;  3O46 A;  3KZE A;  3ID3 A;  5E1Y A;  3RL7 A;  1X8S A;  4UU5 A;  1OZI A;  1GQ4 A;  2Q9V A;  1UEP A;  4NNM A;  1SOZ A;  2R3Y A;  4JOK A;  4Q6S A;  4P0C A;  4OEP A;  2DAZ A;  1P1E A;  4GVC A;  3OTP A;  2DKR A;  3AXA A;  4H11 A;  2M0Z A;  2OGP A;  4KFV A;  2BYG A;  3KDG A;  5HED A;  2DB5 A;  5GND A;  5HET A;  5FB8 C;  2EDZ A;  1OBY A;  4Z33 A;  2FE5 A;  3I4W A;  3MH7 A;  1X5Q A;  1IHJ A;  3NGH A;  1VJ6 A;  2F5Y A;  2RRM A;  4Q2Q A;  3SUZ A;  4E3B A;  1IU2 A;  1FC9 A;  2M0V A;  5HFF A;  2KL1 A;  3LNY A;  2CSJ A;  2EDV A;  3SFJ A;  1QLC A;  2ZPL A;  2KPK A;  1WF8 A;  2EHR A;  3SHW A;  1QAV A;  3CBZ A;  1R6J A;  5HF1 A;  3DOR A;  4IC6 A;  3CC0 A;  2W7R A;  2L4S A;  3GDU A;  3RLE A;  3QE1 A;  3TSW A;  3I18 A;  3E17 A;  3QO6 A;  4JOH A;  1V5Q A;  2I1N A;  2AWX A;  3QDO A;  1X5R A;  4WYT A;  2EDP A; 
#chains in the Genus database with same CATH homology
 4F8K A;  2KJD A;  1U39 A;  3I1E A;  4Q6H A;  2HE4 A;  2GZV A;  2Q3G A;  2EEJ A;  3LNX A;  3DIW A;  2JIK A;  1KEF A;  5HFB A;  3GSL A;  2JOA A;  3ID4 A;  2OSG A;  2DMZ A;  2KG2 A;  2L97 A;  3WKM A;  1N7T A;  2H3M A;  5DTH A;  1WFG A;  4R2Z A;  1KWA A;  4NNL A;  1UJD A;  1I16 A;  2JIN A;  1V1T A;  2EGN A;  3K1R A;  1M5Z A;  2GEF A;  2YUB A;  2KJK A;  4NMR A;  2HGA A;  4K75 A;  2KAW A;  1N6E A;  3TSZ A;  1MFG A;  1WHD A;  5IL9 A;  3PS4 A;  5G1E A;  2ZPM A;  1UM7 A;  3SHU A;  1RGW A;  1UEQ A;  1UJV A;  1L6O A;  1Q7X A;  5HFE A;  2AIN A;  4AMH A;  1N7E A;  3KZD A;  2KBS A;  2RCZ A;  4NMP A;  4HOP B;  4RI0 A;  4E34 A;  5HJ1 A;  2OQS A;  2KOJ A;  3EGG C;  1W9O A;  4YDP A;  2D8I A;  3VQG A;  1IU0 A;  2FN5 A;  3DJ1 A;  3HVQ C;  3NFL A;  4JOP A;  4MPA A;  2DLU A;  2VSV A;  2PKT A;  1SOT A;  2L4T A;  5G1D A;  1OBX A;  4JOJ A;  4E35 A;  1NTE A;  2EEG A;  3RL8 A;  1PDR A;  3KHF A;  4Z8J A;  1WG6 A;  3GGE A;  1UIT A;  2D92 A;  4REY A;  4P2A B;  4Q2N A;  2EEI A;  2DLS A;  2JRE A;  5E11 A;  2M10 A;  2QBW A;  1X9Z A;  1N7F A;  5I7Z A;  2H2B A;  2KOM A;  3STJ A;  3HPM A;  4GHN A;  2IWN A;  1WIF A;  3O5N A;  1WI2 A;  2R4H A;  5B6L A;  3CS0 A;  2IWO A;  3FY5 A;  1Y8T A;  2JWE A;  2KRG A;  1X6D A;  2JXO A;  3TSV A;  1RZX A;  4JJ0 A;  4PQW A;  4NMT A;  1TP3 A;  2YT7 A;  1WH1 A;  4NXR A;  2YUY A;  2EV8 A;  2EEH A;  1I92 A;  2AWU A;  2X7Z A;  4JOR A;  3QIK A;  1UJU A;  2I6V A;  3NFK A;  2DM8 A;  4WYU A;  2EXG A;  1G9O A;  1T2M A;  1WHA A;  2EJY A;  3B76 A;  1U37 A;  1WJL A;  2KV8 A;  1B8Q A;  2FNE A;  2V1W A;  4JJ3 A;  4NMS A;  5HF4 A;  1N99 A;  3SOE A;  2YT8 A;  1TE0 A;  2LC6 A;  5E6P B;  3PDZ A;  2EGO A;  5FHT A;  5EYZ A;  2KJP A;  1KY9 A;  3BPU A;  4HOP A;  4OAJ A;  4FGM A;  1UM1 A;  3HPK A;  1QAV B;  1VB7 A;  5F67 A;  2K1Z A;  1WI4 A;  1V6B A;  2PZD A;  4O06 A;  2W4F A;  3WKL A;  2MX6 A;  5EZ0 A;  1FC6 A;  1XZ9 A;  2QKV A;  5H3J A;  2DC2 A;  2I04 A;  1P1D A;  2VPH A;  2KPL A;  1MFL A;  1X45 A;  3MH4 A;  2OS6 A;  4Q2P A;  3VQF A;  5E22 A;  2I0L A;  2Z17 A;  2KOH A;  1Y7N A;  1TQ3 A;  2E7K A;  4LMM A;  3QJM A;  2LA8 A;  2QG1 A;  1U3B A;  4JOG A;  2Z9I A;  3R68 A;  1YBO A;  2OMJ A;  2AWW A;  4GVD A;  2OZF A;  2KYL A;  4UU6 A;  4XHV A;  1WFV A;  2PKU A;  4Q3H A;  2VWR A;  5HDY A;  1FC7 A;  2M0U A;  2EAQ A;  1MC7 A;  3OU0 A;  2KA9 A;  2G5M B;  4Q2O A;  3K82 A;  3R0H A;  3EGH C;  4N6X A;  5HFD A;  3ID1 A;  2FCF A;  3QJN A;  1W9E A;  3GDS A;  4K78 A;  2WL7 A;  5D13 A;  2I0I A;  2H2C A;  4OEO A;  3PV5 A;  2JSN A;  1Q3O A;  1VCW A;  1RGR A;  4YYX A;  2MHO A;  1BFE A;  2CSS A;  3DJ3 A;  4KFW A;  5B42 A;  4FLN A;  3NCV A;  2LC7 A;  1LCY A;  4NMO A;  4EDJ A;  1OBZ A;  4K6Y A;  1UF1 A;  1D5G A;  1V62 A;  3MH6 A;  3GCO A;  3ID2 A;  1N6F A;  3JXT A;  1WF7 A;  3DJA A;  1BE9 A;  4NXP A;  2LUI A;  2YTW A;  3GJ9 A;  1ZUB A;  4JL7 A;  5JXB A;  2JIL A;  3GDV A;  2OCS A;  1UEW A;  1Z87 A;  1K32 A;  3PV2 A;  2V90 A;  2KQF A;  2OPG A;  1Q3P A;  1V5L A;  4K72 A;  3CBY A;  5ILB A;  3CH8 A;  4G69 A;  3GCN A;  2VRF A;  2HE2 A;  3PDV A;  1TP5 A;  1GQ5 A;  4JOE A;  3KDK A;  5HFC A;  3TMH A;  2K20 A;  2O2T A;  3QGL A;  2F0A A;  3PV4 A;  4JOF A;  1Z86 A;  1NF3 C;  2IWP A;  1UHP A;  2EGK A;  2PNT A;  2VZ5 A;  1GM1 A;  2DJT A;  2M3M A;  2I4S A;  2QKU A;  1X5N A;  4NMV A;  5A2P A;  2M0T A;  4K76 A;  3L4F D;  3ZRT A;  1W9Q A;  1ZOK A;  2LOB A;  2PA1 A;  4L8N A;  4NXQ A;  2QKT A;  3CYY A;  3K50 A;  2UZC A;  3CBX A;  5GLJ A;  1UFX A;  1RY4 A;  2CS5 A;  5HEB A;  2P3W A;  3R69 A;  1U38 A;  4NMQ A;  2REY A;  1UEZ A;  1N6D A;  1FCF A;  1VAE A;  2ENO A;  2G2L A;  3GAB A;  2VSP A;  2H3L A;  2PDZ A;  1VA8 A;  2QT5 A;  2D90 A;  5E21 A;  5HEY A;  1QAU A;  2IWQ A;  5F3X A;  3O46 A;  3KZE A;  3ID3 A;  5E1Y A;  3RL7 A;  1X8S A;  4UU5 A;  1OZI A;  1GQ4 A;  2Q9V A;  1UEP A;  4NNM A;  1SOZ A;  2R3Y A;  4JOK A;  4Q6S A;  4P0C A;  4OEP A;  2DAZ A;  1P1E A;  4GVC A;  3OTP A;  2DKR A;  3AXA A;  4H11 A;  2M0Z A;  2OGP A;  4KFV A;  2BYG A;  3KDG A;  5HED A;  2DB5 A;  5GND A;  5HET A;  5FB8 C;  2EDZ A;  1OBY A;  4Z33 A;  2FE5 A;  3I4W A;  3MH7 A;  1X5Q A;  1IHJ A;  3NGH A;  1VJ6 A;  2F5Y A;  2RRM A;  4Q2Q A;  3SUZ A;  4E3B A;  1IU2 A;  1FC9 A;  2M0V A;  5HFF A;  2KL1 A;  3LNY A;  2CSJ A;  2EDV A;  3SFJ A;  1QLC A;  2ZPL A;  2KPK A;  1WF8 A;  2EHR A;  3SHW A;  1QAV A;  3CBZ A;  1R6J A;  5HF1 A;  3DOR A;  4IC6 A;  3CC0 A;  2W7R A;  2L4S A;  3GDU A;  3RLE A;  3QE1 A;  3TSW A;  3I18 A;  3E17 A;  3QO6 A;  4JOH A;  1V5Q A;  2I1N A;  2AWX A;  3QDO A;  1X5R A;  4WYT A;  2EDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...