5HETA

The third pdz domain from the synaptic protein psd-95 (g330t mutant)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
118
structure length
118
Chain Sequence
SPEFLGEEDIPREPRRIVIHRGSTGLGFNIVGTEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 4
publication title Origins of Allostery and Evolvability in Proteins: A Case Study.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide binding protein
total genus 30
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5hetA00
3ID2A 2M0ZA 1NF3C 2OPGA 4JOFA 1T2MA 1V5QA 1UF1A 1V5LA 2JINA 2BYGA 1X5NA 4NMVA 2KAWA 1ZUBA 3L4FD 3HPKA 4E34A 2K1ZA 2KJPA 1WFVA 3I18A 1VJ6A 2E7KA 2HGAA 1X5QA 3EGGC 3R0HA 2Z17A 1Z87A 1TE0A 2EDPA 4NNLA 1VB7A 1MC7A 3E17A 3KHFA 2EHRA 4GHNA 4K75A 3WKMA 2F0AA 1U38A 3DJAA 2HE2A 5GLJA 2D90A 3GCOA 1WIFA 3VQFA 3OU0A 2K20A 2EGKA 2Q9VA 3NFKA 5FHTA 1TP5A 2G2LA 2OS6A 3AXAA 2QG1A 2H3MA 4K72A 1GM1A 1ZOKA 1UJDA 4REYA 2L4TA 2CS5A 2LC6A 2KPLA 4LMMA 2PNTA 1QAVB 1PDRA 3CH8A 2JXOA 2QKUA 4JOPA 5D13A 1IU2A 1LCYA 4KFVA 4UU5A 1RZXA 5HFBA 2ZPMA 2W7RA 3ZRTA 5B6LA 1WF8A 5HF4A 2F5YA 2KG2A 4UU6A 3K50A 2IWQA 4IC6A 4YYXA 5A2PA 1WI2A 2LA8A 1R6JA 3CS0A 2KJKA 4Q2PA 1IU0A 1G9OA 2JILA 4NNMA 3QJNA 3JXTA 1RGWA 4MPAA 2EAQA 2CSJA 1WF7A 1MFGA 3GCNA 2MHOA 3OTPA 4F8KA 5HJ1A 3GGEA 2HE4A 3DORA 1KEFA 2KL1A 2M3MA 1P1DA 2GZVA 3NGHA 4JOJA 3PS4A 1U37A 2KQFA 1RY4A 1WH1A 5HF1A 1I16A 1Q7XA 2IWNA 3RLEA 2UZCA 4Z33A 3TSVA 2QT5A 1V62A 2R4HA 1WG6A 1FCFA 4O06A 3GDSA 4Q6HA 5F67A 1N7FA 4K78A 1NTEA 4HOPB 1Y8TA 4NMPA 2LC7A 3KZEA 4JOGA 1TQ3A 1QAVA 1QAUA 3PV4A 2EDVA 2I4SA 2KA9A 3FY5A 3SHUA 4JOEA 2L97A 2R3YA 2EV8A 2V1WA 3I1EA 5JXBA 1UJUA 3CBZA 3SOEA 5G1DA 4JL7A 3R69A 2VZ5A 1UFXA 2I04A 4FGMA 3MH4A 3GSLA 1RGRA 2KOJA 1N7TA 3ID3A 3K82A 2CSSA 2DJTA 3QDOA 5HEBA 2ENOA 2DMZA 4NXPA 5E6PB 2JIKA 1B8QA 1Q3OA 2X7ZA 2RRMA 1L6OA 3RL8A 4EDJA 2EEJA 2M0TA 2PDZA 1UEWA 2VSPA 3CYYA 2AWUA 1VAEA 5HDYA 3K1RA 2QBWA 3KZDA 1OBYA 2KV8A 4JOKA 5FB8C 1Z86A 4H11A 4JORA 3CC0A 2DM8A 4P0CA 1IHJA 2IWOA 3ID1A 2JWEA 1FC6A 2YT7A 1W9QA 1GQ4A 1WHAA 1OBXA 4HOPA 2AWXA 2KPKA 3SFJA 5I7ZA 3TSZA 2PKTA 2KYLA 1N6EA 2H2CA 4NXQA 1WJLA 2OSGA 1X6DA 1UHPA 1WFGA 2DLUA 1OZIA 1P1EA 2LOBA 2JREA 5E11A 2D8IA 1KWAA 2LUIA 2IWPA 1Y7NA 1I92A 2YTWA 3PV2A 4JOHA 3GJ9A 1N6FA 2KRGA 1FC7A 2RCZA 1UITA 4Q2OA 3STJA 1XZ9A 2EGNA 2VPHA 2I0IA 1W9EA 1UEPA 2OZFA 3PDZA 3CBYA 2YT8A 2Q3GA 3DJ1A 3QO6A 3I4WA 2O2TA 1UEQA 3VQGA 2PZDA 1MFLA 3DIWA 5H3JA 2OQSA 3O46A 1UJVA 3LNYA 4NMSA 1YBOA 4GVCA 1KY9A 1M5ZA 2QKTA 2PKUA 2KOMA 2I1NA 5EZ0A 5GNDA 2D92A 3B76A 1U3BA 2DB5A 2Z9IA 2I0LA 2VSVA 3TSWA 1D5GA 1N99A 1UM1A 2YUBA 3SHWA 2OMJA 1N7EA 1K32A 2AWWA 4NMQA 4OEOA 4NMTA 1BE9A 5EYZA 4OEPA 4P2AB 2FE5A 1X8SA 1W9OA 2FN5A 4N6XA 3HVQC 2FNEA 2PA1A 4Q2NA 2EEIA 3PDVA 4KFWA 2W4FA 5F3XA 2ZPLA 3NFLA 2M10A 5E1YA 5G1EA 4E3BA 3QIKA 5HETA 3MH7A 2H3LA 1BFEA 2YUYA 1Q3PA 5E21A 2REYA 2EJYA 4K6YA 2V90A 1UEZA 2DC2A 2G5MB 2OCSA 2KJDA 1N6DA 2WL7A 3ID4A 1SOZA 2EDZA 1V6BA 4Q6SA 2JOAA 5HEYA 2AINA 2QKVA 1SOTA 4NMOA 3PV5A 2EXGA 5DTHA 3QE1A 4G69A 1UM7A 4Q2QA 3CBXA 4Z8JA 3GDUA 4E35A 3BPUA 3QJMA 1VA8A 5HEDA 2DKRA 2P3WA 4OAJA 2KOHA 2VWRA 3R68A 1VCWA 3HPMA 3EGHC 4PQWA 1WI4A 4Q3HA 3TMHA 3MH6A 3RL7A 3DJ3A 1U39A 4WYUA 2OGPA 2DAZA 4NXRA 2FCFA 3SUZA 5HFCA 1QLCA 5E22A 2EGOA 1FC9A 2EEHA 2M0VA 5HFDA 5HFFA 2DLSA 4YDPA 1X45A 4RI0A 2VRFA 5HFEA 2M0UA 2I6VA 4AMHA 1TP3A 3GDVA 3QGLA 2H2BA 4XHVA 2L4SA 4WYTA 4K76A 4NMRA 1WHDA 3O5NA 1V1TA 2KBSA 4GVDA 1OBZA 1GQ5A 1X5RA 3WKLA 3LNXA 4L8NA 2MX6A 2EEGA 4R2ZA
chains in the Genus database with same CATH superfamily
3ID2A 2M0ZA 1NF3C 2OPGA 4JOFA 1T2MA 1V5QA 1UF1A 1V5LA 2JINA 2BYGA 1X5NA 4NMVA 2KAWA 1ZUBA 3L4FD 3HPKA 4E34A 2K1ZA 2KJPA 1WFVA 3I18A 3KDGA 1VJ6A 2E7KA 2HGAA 1X5QA 3EGGC 3R0HA 2Z17A 1Z87A 1TE0A 2EDPA 4NNLA 1VB7A 1MC7A 3E17A 3KHFA 2EHRA 4GHNA 4K75A 3WKMA 5IL9A 2F0AA 1U38A 3DJAA 2HE2A 5GLJA 2D90A 3GCOA 1WIFA 3VQFA 3OU0A 2K20A 2EGKA 2Q9VA 3NFKA 5FHTA 1TP5A 2G2LA 2OS6A 3AXAA 2QG1A 2H3MA 4K72A 1GM1A 1ZOKA 1UJDA 4REYA 2L4TA 2CS5A 2LC6A 2KPLA 4LMMA 2PNTA 1QAVB 1PDRA 3CH8A 2JXOA 2QKUA 4JOPA 5D13A 1IU2A 1LCYA 4KFVA 4UU5A 1RZXA 5HFBA 2ZPMA 2W7RA 3ZRTA 5B6LA 1WF8A 5HF4A 2F5YA 2KG2A 4UU6A 3K50A 2IWQA 4IC6A 4YYXA 5A2PA 1WI2A 2LA8A 1R6JA 3CS0A 2KJKA 4Q2PA 1IU0A 1G9OA 2JILA 5ILBA 4NNMA 2JSNA 3QJNA 3JXTA 1RGWA 4MPAA 2EAQA 2CSJA 1WF7A 1MFGA 3GCNA 2MHOA 3OTPA 4F8KA 5HJ1A 3GGEA 2HE4A 3DORA 2GEFA 1KEFA 2KL1A 2M3MA 1P1DA 2GZVA 3NGHA 4JOJA 3PS4A 1U37A 2KQFA 1RY4A 1WH1A 5HF1A 1I16A 1Q7XA 2IWNA 3RLEA 2UZCA 4Z33A 3TSVA 2QT5A 1V62A 2R4HA 1WG6A 1FCFA 4O06A 3GDSA 4Q6HA 5F67A 1N7FA 4K78A 1NTEA 4HOPB 1Y8TA 4NMPA 2LC7A 3KZEA 4JOGA 1TQ3A 1QAVA 1QAUA 3PV4A 2EDVA 2I4SA 2KA9A 3FY5A 3SHUA 4JOEA 2L97A 2R3YA 2EV8A 3KDKA 2V1WA 3I1EA 5JXBA 1UJUA 3CBZA 3SOEA 5G1DA 4JL7A 3R69A 2VZ5A 1UFXA 2I04A 4FGMA 3MH4A 3GSLA 1RGRA 2KOJA 1N7TA 3ID3A 3K82A 2CSSA 2DJTA 3QDOA 5HEBA 2ENOA 2DMZA 4NXPA 5E6PB 2JIKA 1B8QA 1Q3OA 2X7ZA 3NCVA 2RRMA 1L6OA 3RL8A 4EDJA 2EEJA 2M0TA 2PDZA 1UEWA 3GABA 2VSPA 3CYYA 2AWUA 1VAEA 5HDYA 3K1RA 2QBWA 3KZDA 1OBYA 2KV8A 4JOKA 5FB8C 1Z86A 4H11A 4JORA 3CC0A 2DM8A 4P0CA 1IHJA 2IWOA 3ID1A 2JWEA 1FC6A 2YT7A 1W9QA 1GQ4A 1WHAA 1OBXA 4HOPA 2AWXA 2KPKA 3SFJA 5I7ZA 3TSZA 2PKTA 2KYLA 1N6EA 2H2CA 4NXQA 1WJLA 2OSGA 1X6DA 1UHPA 1WFGA 2DLUA 1OZIA 1P1EA 2LOBA 2JREA 5E11A 2D8IA 1KWAA 2LUIA 2IWPA 1Y7NA 1I92A 2YTWA 3PV2A 4JOHA 3GJ9A 1N6FA 2KRGA 1FC7A 2RCZA 1UITA 4Q2OA 3STJA 1XZ9A 2EGNA 2VPHA 2I0IA 1W9EA 1UEPA 2OZFA 3PDZA 3CBYA 4JJ3A 2YT8A 2Q3GA 3DJ1A 3QO6A 3I4WA 2O2TA 1UEQA 3VQGA 2PZDA 1MFLA 3DIWA 5H3JA 2OQSA 3O46A 1UJVA 3LNYA 4NMSA 1YBOA 4GVCA 1KY9A 1M5ZA 2QKTA 2PKUA 2KOMA 2I1NA 5EZ0A 5GNDA 2D92A 3B76A 1U3BA 2DB5A 2Z9IA 2I0LA 2VSVA 3TSWA 1D5GA 4FLNA 1N99A 1UM1A 2YUBA 3SHWA 2OMJA 1N7EA 1K32A 2AWWA 4NMQA 4OEOA 4NMTA 1BE9A 5EYZA 4OEPA 4P2AB 2FE5A 1X8SA 1W9OA 2FN5A 4N6XA 3HVQC 1X9ZA 2FNEA 2PA1A 4Q2NA 2EEIA 3PDVA 4KFWA 2W4FA 5F3XA 2ZPLA 3NFLA 2M10A 5E1YA 5G1EA 4E3BA 3QIKA 5HETA 3MH7A 2H3LA 1BFEA 2YUYA 1Q3PA 5E21A 2REYA 2EJYA 4K6YA 2V90A 1UEZA 2DC2A 2G5MB 2OCSA 2KJDA 1N6DA 2WL7A 3ID4A 1SOZA 2EDZA 1V6BA 4Q6SA 2JOAA 5HEYA 2AINA 2QKVA 1SOTA 4NMOA 3PV5A 2EXGA 5DTHA 3QE1A 4G69A 1UM7A 4Q2QA 3CBXA 4Z8JA 3GDUA 4JJ0A 3BPUA 4E35A 3QJMA 1VA8A 5HEDA 2DKRA 2P3WA 4OAJA 2KOHA 2VWRA 3R68A 1VCWA 3HPMA 3EGHC 4PQWA 1WI4A 4Q3HA 3TMHA 3MH6A 3RL7A 3DJ3A 1U39A 4WYUA 2OGPA 2DAZA 4NXRA 2FCFA 3SUZA 5HFCA 1QLCA 5E22A 2EGOA 1FC9A 2EEHA 2M0VA 5HFDA 5HFFA 2DLSA 4YDPA 1X45A 4RI0A 2VRFA 5HFEA 2M0UA 2I6VA 4AMHA 1TP3A 3GDVA 3QGLA 2H2BA 4XHVA 2L4SA 4WYTA 4K76A 4NMRA 1WHDA 3O5NA 1V1TA 2KBSA 4GVDA 1OBZA 1GQ5A 1X5RA 3WKLA 3LNXA 4L8NA 2MX6A 5B42A 2EEGA 4R2ZA
chains in the Genus database with same CATH topology
3ID2A 2M0ZA 1NF3C 2OPGA 4JOFA 1T2MA 1V5QA 1UF1A 1V5LA 2JINA 2BYGA 1X5NA 4NMVA 2KAWA 1ZUBA 3L4FD 3HPKA 4E34A 2K1ZA 2KJPA 1WFVA 3I18A 3KDGA 1VJ6A 2E7KA 2HGAA 1X5QA 3EGGC 3R0HA 2Z17A 1Z87A 1TE0A 2EDPA 4NNLA 1VB7A 1MC7A 3E17A 3KHFA 2EHRA 4GHNA 4K75A 3WKMA 5IL9A 2F0AA 1U38A 3DJAA 2HE2A 5GLJA 2D90A 3GCOA 1WIFA 3VQFA 3OU0A 2K20A 2EGKA 2Q9VA 3NFKA 5FHTA 1TP5A 2G2LA 2OS6A 3AXAA 2QG1A 2H3MA 4K72A 1GM1A 1ZOKA 1UJDA 4REYA 2L4TA 2CS5A 2LC6A 2KPLA 4LMMA 2PNTA 1QAVB 1PDRA 3CH8A 2JXOA 2QKUA 4JOPA 5D13A 1IU2A 1LCYA 4KFVA 4UU5A 1RZXA 5HFBA 2ZPMA 2W7RA 3ZRTA 5B6LA 1WF8A 5HF4A 2F5YA 2KG2A 4UU6A 3K50A 2IWQA 4IC6A 4YYXA 5A2PA 1WI2A 2LA8A 1R6JA 3CS0A 2KJKA 4Q2PA 1IU0A 1G9OA 2JILA 5ILBA 4NNMA 2JSNA 3QJNA 3JXTA 1RGWA 4MPAA 2EAQA 2CSJA 1WF7A 1MFGA 3GCNA 2MHOA 3OTPA 4F8KA 5HJ1A 3GGEA 2HE4A 3DORA 2GEFA 1KEFA 2KL1A 2M3MA 1P1DA 2GZVA 3NGHA 4JOJA 3PS4A 1U37A 2KQFA 1RY4A 1WH1A 5HF1A 1I16A 1Q7XA 2IWNA 3RLEA 2UZCA 4Z33A 3TSVA 2QT5A 1V62A 2R4HA 1WG6A 1FCFA 4O06A 3GDSA 4Q6HA 5F67A 1N7FA 4K78A 1NTEA 4HOPB 1Y8TA 4NMPA 2LC7A 3KZEA 4JOGA 1TQ3A 1QAVA 1QAUA 3PV4A 2EDVA 2I4SA 2KA9A 3FY5A 3SHUA 4JOEA 2L97A 2R3YA 2EV8A 3KDKA 2V1WA 3I1EA 5JXBA 1UJUA 3CBZA 3SOEA 5G1DA 4JL7A 3R69A 2VZ5A 1UFXA 2I04A 4FGMA 3MH4A 3GSLA 1RGRA 2KOJA 1N7TA 3ID3A 3K82A 2CSSA 2DJTA 3QDOA 5HEBA 2ENOA 2DMZA 4NXPA 5E6PB 2JIKA 1B8QA 1Q3OA 2X7ZA 3NCVA 2RRMA 1L6OA 3RL8A 4EDJA 2EEJA 2M0TA 2PDZA 1UEWA 3GABA 2VSPA 3CYYA 2AWUA 1VAEA 5HDYA 3K1RA 2QBWA 3KZDA 1OBYA 2KV8A 4JOKA 5FB8C 1Z86A 4H11A 4JORA 3CC0A 2DM8A 4P0CA 1IHJA 2IWOA 3ID1A 2JWEA 1FC6A 2YT7A 1W9QA 1GQ4A 1WHAA 1OBXA 4HOPA 2AWXA 2KPKA 3SFJA 5I7ZA 3TSZA 2PKTA 2KYLA 1N6EA 2H2CA 4NXQA 1WJLA 2OSGA 1X6DA 1UHPA 1WFGA 2DLUA 1OZIA 1P1EA 2LOBA 2JREA 5E11A 2D8IA 1KWAA 2LUIA 2IWPA 1Y7NA 1I92A 2YTWA 3PV2A 4JOHA 3GJ9A 1N6FA 2KRGA 1FC7A 2RCZA 1UITA 4Q2OA 3STJA 1XZ9A 2EGNA 2VPHA 2I0IA 1W9EA 1UEPA 2OZFA 3PDZA 3CBYA 4JJ3A 2YT8A 2Q3GA 3DJ1A 3QO6A 3I4WA 2O2TA 1UEQA 3VQGA 2PZDA 1MFLA 3DIWA 5H3JA 2OQSA 3O46A 1UJVA 3LNYA 4NMSA 1YBOA 4GVCA 1KY9A 1M5ZA 2QKTA 2PKUA 2KOMA 2I1NA 5EZ0A 5GNDA 2D92A 3B76A 1U3BA 2DB5A 2Z9IA 2I0LA 2VSVA 3TSWA 1D5GA 4FLNA 1N99A 1UM1A 2YUBA 3SHWA 2OMJA 1N7EA 1K32A 2AWWA 4NMQA 4OEOA 4NMTA 1BE9A 5EYZA 4OEPA 4P2AB 2FE5A 1X8SA 1W9OA 2FN5A 4N6XA 3HVQC 1X9ZA 2FNEA 2PA1A 4Q2NA 2EEIA 3PDVA 4KFWA 2W4FA 5F3XA 2ZPLA 3NFLA 2M10A 5E1YA 5G1EA 4E3BA 3QIKA 5HETA 3MH7A 2H3LA 1BFEA 2YUYA 1Q3PA 5E21A 2REYA 2EJYA 4K6YA 2V90A 1UEZA 2DC2A 2G5MB 2OCSA 2KJDA 1N6DA 2WL7A 3ID4A 1SOZA 2EDZA 1V6BA 4Q6SA 2JOAA 5HEYA 2AINA 2QKVA 1SOTA 4NMOA 3PV5A 2EXGA 5DTHA 3QE1A 4G69A 1UM7A 4Q2QA 3CBXA 4Z8JA 3GDUA 4JJ0A 3BPUA 4E35A 3QJMA 1VA8A 5HEDA 2DKRA 2P3WA 4OAJA 2KOHA 2VWRA 3R68A 1VCWA 3HPMA 3EGHC 4PQWA 1WI4A 4Q3HA 3TMHA 3MH6A 3RL7A 3DJ3A 1U39A 4WYUA 2OGPA 2DAZA 4NXRA 2FCFA 3SUZA 5HFCA 1QLCA 5E22A 2EGOA 1FC9A 2EEHA 2M0VA 5HFDA 5HFFA 2DLSA 4YDPA 1X45A 4RI0A 2VRFA 5HFEA 2M0UA 2I6VA 4AMHA 1TP3A 3GDVA 3QGLA 2H2BA 4XHVA 2L4SA 4WYTA 4K76A 4NMRA 1WHDA 3O5NA 1V1TA 2KBSA 4GVDA 1OBZA 1GQ5A 1X5RA 3WKLA 3LNXA 4L8NA 2MX6A 5B42A 2EEGA 4R2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ID2 A;  2M0Z A;  1NF3 C;  2OPG A;  4JOF A;  1T2M A;  1V5Q A;  1UF1 A;  1V5L A;  2JIN A;  2BYG A;  1X5N A;  4NMV A;  2KAW A;  1ZUB A;  3L4F D;  3HPK A;  4E34 A;  2K1Z A;  2KJP A;  1WFV A;  3I18 A;  1VJ6 A;  2E7K A;  2HGA A;  1X5Q A;  3EGG C;  3R0H A;  2Z17 A;  1Z87 A;  1TE0 A;  2EDP A;  4NNL A;  1VB7 A;  1MC7 A;  3E17 A;  3KHF A;  2EHR A;  4GHN A;  4K75 A;  3WKM A;  2F0A A;  1U38 A;  3DJA A;  2HE2 A;  5GLJ A;  2D90 A;  3GCO A;  1WIF A;  3VQF A;  3OU0 A;  2K20 A;  2EGK A;  2Q9V A;  3NFK A;  5FHT A;  1TP5 A;  2G2L A;  2OS6 A;  3AXA A;  2QG1 A;  2H3M A;  4K72 A;  1GM1 A;  1ZOK A;  1UJD A;  4REY A;  2L4T A;  2CS5 A;  2LC6 A;  2KPL A;  4LMM A;  2PNT A;  1QAV B;  1PDR A;  3CH8 A;  2JXO A;  2QKU A;  4JOP A;  5D13 A;  1IU2 A;  1LCY A;  4KFV A;  4UU5 A;  1RZX A;  5HFB A;  2ZPM A;  2W7R A;  3ZRT A;  5B6L A;  1WF8 A;  5HF4 A;  2F5Y A;  2KG2 A;  4UU6 A;  3K50 A;  2IWQ A;  4IC6 A;  4YYX A;  5A2P A;  1WI2 A;  2LA8 A;  1R6J A;  3CS0 A;  2KJK A;  4Q2P A;  1IU0 A;  1G9O A;  2JIL A;  4NNM A;  3QJN A;  3JXT A;  1RGW A;  4MPA A;  2EAQ A;  2CSJ A;  1WF7 A;  1MFG A;  3GCN A;  2MHO A;  3OTP A;  4F8K A;  5HJ1 A;  3GGE A;  2HE4 A;  3DOR A;  1KEF A;  2KL1 A;  2M3M A;  1P1D A;  2GZV A;  3NGH A;  4JOJ A;  3PS4 A;  1U37 A;  2KQF A;  1RY4 A;  1WH1 A;  5HF1 A;  1I16 A;  1Q7X A;  2IWN A;  3RLE A;  2UZC A;  4Z33 A;  3TSV A;  2QT5 A;  1V62 A;  2R4H A;  1WG6 A;  1FCF A;  4O06 A;  3GDS A;  4Q6H A;  5F67 A;  1N7F A;  4K78 A;  1NTE A;  4HOP B;  1Y8T A;  4NMP A;  2LC7 A;  3KZE A;  4JOG A;  1TQ3 A;  1QAV A;  1QAU A;  3PV4 A;  2EDV A;  2I4S A;  2KA9 A;  3FY5 A;  3SHU A;  4JOE A;  2L97 A;  2R3Y A;  2EV8 A;  2V1W A;  3I1E A;  5JXB A;  1UJU A;  3CBZ A;  3SOE A;  5G1D A;  4JL7 A;  3R69 A;  2VZ5 A;  1UFX A;  2I04 A;  4FGM A;  3MH4 A;  3GSL A;  1RGR A;  2KOJ A;  1N7T A;  3ID3 A;  3K82 A;  2CSS A;  2DJT A;  3QDO A;  5HEB A;  2ENO A;  2DMZ A;  4NXP A;  5E6P B;  2JIK A;  1B8Q A;  1Q3O A;  2X7Z A;  2RRM A;  1L6O A;  3RL8 A;  4EDJ A;  2EEJ A;  2M0T A;  2PDZ A;  1UEW A;  2VSP A;  3CYY A;  2AWU A;  1VAE A;  5HDY A;  3K1R A;  2QBW A;  3KZD A;  1OBY A;  2KV8 A;  4JOK A;  5FB8 C;  1Z86 A;  4H11 A;  4JOR A;  3CC0 A;  2DM8 A;  4P0C A;  1IHJ A;  2IWO A;  3ID1 A;  2JWE A;  1FC6 A;  2YT7 A;  1W9Q A;  1GQ4 A;  1WHA A;  1OBX A;  4HOP A;  2AWX A;  2KPK A;  3SFJ A;  5I7Z A;  3TSZ A;  2PKT A;  2KYL A;  1N6E A;  2H2C A;  4NXQ A;  1WJL A;  2OSG A;  1X6D A;  1UHP A;  1WFG A;  2DLU A;  1OZI A;  1P1E A;  2LOB A;  2JRE A;  5E11 A;  2D8I A;  1KWA A;  2LUI A;  2IWP A;  1Y7N A;  1I92 A;  2YTW A;  3PV2 A;  4JOH A;  3GJ9 A;  1N6F A;  2KRG A;  1FC7 A;  2RCZ A;  1UIT A;  4Q2O A;  3STJ A;  1XZ9 A;  2EGN A;  2VPH A;  2I0I A;  1W9E A;  1UEP A;  2OZF A;  3PDZ A;  3CBY A;  2YT8 A;  2Q3G A;  3DJ1 A;  3QO6 A;  3I4W A;  2O2T A;  1UEQ A;  3VQG A;  2PZD A;  1MFL A;  3DIW A;  5H3J A;  2OQS A;  3O46 A;  1UJV A;  3LNY A;  4NMS A;  1YBO A;  4GVC A;  1KY9 A;  1M5Z A;  2QKT A;  2PKU A;  2KOM A;  2I1N A;  5EZ0 A;  5GND A;  2D92 A;  3B76 A;  1U3B A;  2DB5 A;  2Z9I A;  2I0L A;  2VSV A;  3TSW A;  1D5G A;  1N99 A;  1UM1 A;  2YUB A;  3SHW A;  2OMJ A;  1N7E A;  1K32 A;  2AWW A;  4NMQ A;  4OEO A;  4NMT A;  1BE9 A;  5EYZ A;  4OEP A;  4P2A B;  2FE5 A;  1X8S A;  1W9O A;  2FN5 A;  4N6X A;  3HVQ C;  2FNE A;  2PA1 A;  4Q2N A;  2EEI A;  3PDV A;  4KFW A;  2W4F A;  5F3X A;  2ZPL A;  3NFL A;  2M10 A;  5E1Y A;  5G1E A;  4E3B A;  3QIK A;  5HET A;  3MH7 A;  2H3L A;  1BFE A;  2YUY A;  1Q3P A;  5E21 A;  2REY A;  2EJY A;  4K6Y A;  2V90 A;  1UEZ A;  2DC2 A;  2G5M B;  2OCS A;  2KJD A;  1N6D A;  2WL7 A;  3ID4 A;  1SOZ A;  2EDZ A;  1V6B A;  4Q6S A;  2JOA A;  5HEY A;  2AIN A;  2QKV A;  1SOT A;  4NMO A;  3PV5 A;  2EXG A;  5DTH A;  3QE1 A;  4G69 A;  1UM7 A;  4Q2Q A;  3CBX A;  4Z8J A;  3GDU A;  4E35 A;  3BPU A;  3QJM A;  1VA8 A;  5HED A;  2DKR A;  2P3W A;  4OAJ A;  2KOH A;  2VWR A;  3R68 A;  1VCW A;  3HPM A;  3EGH C;  4PQW A;  1WI4 A;  4Q3H A;  3TMH A;  3MH6 A;  3RL7 A;  3DJ3 A;  1U39 A;  4WYU A;  2OGP A;  2DAZ A;  4NXR A;  2FCF A;  3SUZ A;  5HFC A;  1QLC A;  5E22 A;  2EGO A;  1FC9 A;  2EEH A;  2M0V A;  5HFD A;  5HFF A;  2DLS A;  4YDP A;  1X45 A;  4RI0 A;  2VRF A;  5HFE A;  2M0U A;  2I6V A;  4AMH A;  1TP3 A;  3GDV A;  3QGL A;  2H2B A;  4XHV A;  2L4S A;  4WYT A;  4K76 A;  4NMR A;  1WHD A;  3O5N A;  1V1T A;  2KBS A;  4GVD A;  1OBZ A;  1GQ5 A;  1X5R A;  3WKL A;  3LNX A;  4L8N A;  2MX6 A;  2EEG A;  4R2Z A; 
#chains in the Genus database with same CATH topology
 3ID2 A;  2M0Z A;  1NF3 C;  2OPG A;  4JOF A;  1T2M A;  1V5Q A;  1UF1 A;  1V5L A;  2JIN A;  2BYG A;  1X5N A;  4NMV A;  2KAW A;  1ZUB A;  3L4F D;  3HPK A;  4E34 A;  2K1Z A;  2KJP A;  1WFV A;  3I18 A;  3KDG A;  1VJ6 A;  2E7K A;  2HGA A;  1X5Q A;  3EGG C;  3R0H A;  2Z17 A;  1Z87 A;  1TE0 A;  2EDP A;  4NNL A;  1VB7 A;  1MC7 A;  3E17 A;  3KHF A;  2EHR A;  4GHN A;  4K75 A;  3WKM A;  5IL9 A;  2F0A A;  1U38 A;  3DJA A;  2HE2 A;  5GLJ A;  2D90 A;  3GCO A;  1WIF A;  3VQF A;  3OU0 A;  2K20 A;  2EGK A;  2Q9V A;  3NFK A;  5FHT A;  1TP5 A;  2G2L A;  2OS6 A;  3AXA A;  2QG1 A;  2H3M A;  4K72 A;  1GM1 A;  1ZOK A;  1UJD A;  4REY A;  2L4T A;  2CS5 A;  2LC6 A;  2KPL A;  4LMM A;  2PNT A;  1QAV B;  1PDR A;  3CH8 A;  2JXO A;  2QKU A;  4JOP A;  5D13 A;  1IU2 A;  1LCY A;  4KFV A;  4UU5 A;  1RZX A;  5HFB A;  2ZPM A;  2W7R A;  3ZRT A;  5B6L A;  1WF8 A;  5HF4 A;  2F5Y A;  2KG2 A;  4UU6 A;  3K50 A;  2IWQ A;  4IC6 A;  4YYX A;  5A2P A;  1WI2 A;  2LA8 A;  1R6J A;  3CS0 A;  2KJK A;  4Q2P A;  1IU0 A;  1G9O A;  2JIL A;  5ILB A;  4NNM A;  2JSN A;  3QJN A;  3JXT A;  1RGW A;  4MPA A;  2EAQ A;  2CSJ A;  1WF7 A;  1MFG A;  3GCN A;  2MHO A;  3OTP A;  4F8K A;  5HJ1 A;  3GGE A;  2HE4 A;  3DOR A;  2GEF A;  1KEF A;  2KL1 A;  2M3M A;  1P1D A;  2GZV A;  3NGH A;  4JOJ A;  3PS4 A;  1U37 A;  2KQF A;  1RY4 A;  1WH1 A;  5HF1 A;  1I16 A;  1Q7X A;  2IWN A;  3RLE A;  2UZC A;  4Z33 A;  3TSV A;  2QT5 A;  1V62 A;  2R4H A;  1WG6 A;  1FCF A;  4O06 A;  3GDS A;  4Q6H A;  5F67 A;  1N7F A;  4K78 A;  1NTE A;  4HOP B;  1Y8T A;  4NMP A;  2LC7 A;  3KZE A;  4JOG A;  1TQ3 A;  1QAV A;  1QAU A;  3PV4 A;  2EDV A;  2I4S A;  2KA9 A;  3FY5 A;  3SHU A;  4JOE A;  2L97 A;  2R3Y A;  2EV8 A;  3KDK A;  2V1W A;  3I1E A;  5JXB A;  1UJU A;  3CBZ A;  3SOE A;  5G1D A;  4JL7 A;  3R69 A;  2VZ5 A;  1UFX A;  2I04 A;  4FGM A;  3MH4 A;  3GSL A;  1RGR A;  2KOJ A;  1N7T A;  3ID3 A;  3K82 A;  2CSS A;  2DJT A;  3QDO A;  5HEB A;  2ENO A;  2DMZ A;  4NXP A;  5E6P B;  2JIK A;  1B8Q A;  1Q3O A;  2X7Z A;  3NCV A;  2RRM A;  1L6O A;  3RL8 A;  4EDJ A;  2EEJ A;  2M0T A;  2PDZ A;  1UEW A;  3GAB A;  2VSP A;  3CYY A;  2AWU A;  1VAE A;  5HDY A;  3K1R A;  2QBW A;  3KZD A;  1OBY A;  2KV8 A;  4JOK A;  5FB8 C;  1Z86 A;  4H11 A;  4JOR A;  3CC0 A;  2DM8 A;  4P0C A;  1IHJ A;  2IWO A;  3ID1 A;  2JWE A;  1FC6 A;  2YT7 A;  1W9Q A;  1GQ4 A;  1WHA A;  1OBX A;  4HOP A;  2AWX A;  2KPK A;  3SFJ A;  5I7Z A;  3TSZ A;  2PKT A;  2KYL A;  1N6E A;  2H2C A;  4NXQ A;  1WJL A;  2OSG A;  1X6D A;  1UHP A;  1WFG A;  2DLU A;  1OZI A;  1P1E A;  2LOB A;  2JRE A;  5E11 A;  2D8I A;  1KWA A;  2LUI A;  2IWP A;  1Y7N A;  1I92 A;  2YTW A;  3PV2 A;  4JOH A;  3GJ9 A;  1N6F A;  2KRG A;  1FC7 A;  2RCZ A;  1UIT A;  4Q2O A;  3STJ A;  1XZ9 A;  2EGN A;  2VPH A;  2I0I A;  1W9E A;  1UEP A;  2OZF A;  3PDZ A;  3CBY A;  4JJ3 A;  2YT8 A;  2Q3G A;  3DJ1 A;  3QO6 A;  3I4W A;  2O2T A;  1UEQ A;  3VQG A;  2PZD A;  1MFL A;  3DIW A;  5H3J A;  2OQS A;  3O46 A;  1UJV A;  3LNY A;  4NMS A;  1YBO A;  4GVC A;  1KY9 A;  1M5Z A;  2QKT A;  2PKU A;  2KOM A;  2I1N A;  5EZ0 A;  5GND A;  2D92 A;  3B76 A;  1U3B A;  2DB5 A;  2Z9I A;  2I0L A;  2VSV A;  3TSW A;  1D5G A;  4FLN A;  1N99 A;  1UM1 A;  2YUB A;  3SHW A;  2OMJ A;  1N7E A;  1K32 A;  2AWW A;  4NMQ A;  4OEO A;  4NMT A;  1BE9 A;  5EYZ A;  4OEP A;  4P2A B;  2FE5 A;  1X8S A;  1W9O A;  2FN5 A;  4N6X A;  3HVQ C;  1X9Z A;  2FNE A;  2PA1 A;  4Q2N A;  2EEI A;  3PDV A;  4KFW A;  2W4F A;  5F3X A;  2ZPL A;  3NFL A;  2M10 A;  5E1Y A;  5G1E A;  4E3B A;  3QIK A;  5HET A;  3MH7 A;  2H3L A;  1BFE A;  2YUY A;  1Q3P A;  5E21 A;  2REY A;  2EJY A;  4K6Y A;  2V90 A;  1UEZ A;  2DC2 A;  2G5M B;  2OCS A;  2KJD A;  1N6D A;  2WL7 A;  3ID4 A;  1SOZ A;  2EDZ A;  1V6B A;  4Q6S A;  2JOA A;  5HEY A;  2AIN A;  2QKV A;  1SOT A;  4NMO A;  3PV5 A;  2EXG A;  5DTH A;  3QE1 A;  4G69 A;  1UM7 A;  4Q2Q A;  3CBX A;  4Z8J A;  3GDU A;  4JJ0 A;  3BPU A;  4E35 A;  3QJM A;  1VA8 A;  5HED A;  2DKR A;  2P3W A;  4OAJ A;  2KOH A;  2VWR A;  3R68 A;  1VCW A;  3HPM A;  3EGH C;  4PQW A;  1WI4 A;  4Q3H A;  3TMH A;  3MH6 A;  3RL7 A;  3DJ3 A;  1U39 A;  4WYU A;  2OGP A;  2DAZ A;  4NXR A;  2FCF A;  3SUZ A;  5HFC A;  1QLC A;  5E22 A;  2EGO A;  1FC9 A;  2EEH A;  2M0V A;  5HFD A;  5HFF A;  2DLS A;  4YDP A;  1X45 A;  4RI0 A;  2VRF A;  5HFE A;  2M0U A;  2I6V A;  4AMH A;  1TP3 A;  3GDV A;  3QGL A;  2H2B A;  4XHV A;  2L4S A;  4WYT A;  4K76 A;  4NMR A;  1WHD A;  3O5N A;  1V1T A;  2KBS A;  4GVD A;  1OBZ A;  1GQ5 A;  1X5R A;  3WKL A;  3LNX A;  4L8N A;  2MX6 A;  5B42 A;  2EEG A;  4R2Z A; 
#chains in the Genus database with same CATH homology
 3ID2 A;  2M0Z A;  1NF3 C;  2OPG A;  4JOF A;  1T2M A;  1V5Q A;  1UF1 A;  1V5L A;  2JIN A;  2BYG A;  1X5N A;  4NMV A;  2KAW A;  1ZUB A;  3L4F D;  3HPK A;  4E34 A;  2K1Z A;  2KJP A;  1WFV A;  3I18 A;  3KDG A;  1VJ6 A;  2E7K A;  2HGA A;  1X5Q A;  3EGG C;  3R0H A;  2Z17 A;  1Z87 A;  1TE0 A;  2EDP A;  4NNL A;  1VB7 A;  1MC7 A;  3E17 A;  3KHF A;  2EHR A;  4GHN A;  4K75 A;  3WKM A;  5IL9 A;  2F0A A;  1U38 A;  3DJA A;  2HE2 A;  5GLJ A;  2D90 A;  3GCO A;  1WIF A;  3VQF A;  3OU0 A;  2K20 A;  2EGK A;  2Q9V A;  3NFK A;  5FHT A;  1TP5 A;  2G2L A;  2OS6 A;  3AXA A;  2QG1 A;  2H3M A;  4K72 A;  1GM1 A;  1ZOK A;  1UJD A;  4REY A;  2L4T A;  2CS5 A;  2LC6 A;  2KPL A;  4LMM A;  2PNT A;  1QAV B;  1PDR A;  3CH8 A;  2JXO A;  2QKU A;  4JOP A;  5D13 A;  1IU2 A;  1LCY A;  4KFV A;  4UU5 A;  1RZX A;  5HFB A;  2ZPM A;  2W7R A;  3ZRT A;  5B6L A;  1WF8 A;  5HF4 A;  2F5Y A;  2KG2 A;  4UU6 A;  3K50 A;  2IWQ A;  4IC6 A;  4YYX A;  5A2P A;  1WI2 A;  2LA8 A;  1R6J A;  3CS0 A;  2KJK A;  4Q2P A;  1IU0 A;  1G9O A;  2JIL A;  5ILB A;  4NNM A;  2JSN A;  3QJN A;  3JXT A;  1RGW A;  4MPA A;  2EAQ A;  2CSJ A;  1WF7 A;  1MFG A;  3GCN A;  2MHO A;  3OTP A;  4F8K A;  5HJ1 A;  3GGE A;  2HE4 A;  3DOR A;  2GEF A;  1KEF A;  2KL1 A;  2M3M A;  1P1D A;  2GZV A;  3NGH A;  4JOJ A;  3PS4 A;  1U37 A;  2KQF A;  1RY4 A;  1WH1 A;  5HF1 A;  1I16 A;  1Q7X A;  2IWN A;  3RLE A;  2UZC A;  4Z33 A;  3TSV A;  2QT5 A;  1V62 A;  2R4H A;  1WG6 A;  1FCF A;  4O06 A;  3GDS A;  4Q6H A;  5F67 A;  1N7F A;  4K78 A;  1NTE A;  4HOP B;  1Y8T A;  4NMP A;  2LC7 A;  3KZE A;  4JOG A;  1TQ3 A;  1QAV A;  1QAU A;  3PV4 A;  2EDV A;  2I4S A;  2KA9 A;  3FY5 A;  3SHU A;  4JOE A;  2L97 A;  2R3Y A;  2EV8 A;  3KDK A;  2V1W A;  3I1E A;  5JXB A;  1UJU A;  3CBZ A;  3SOE A;  5G1D A;  4JL7 A;  3R69 A;  2VZ5 A;  1UFX A;  2I04 A;  4FGM A;  3MH4 A;  3GSL A;  1RGR A;  2KOJ A;  1N7T A;  3ID3 A;  3K82 A;  2CSS A;  2DJT A;  3QDO A;  5HEB A;  2ENO A;  2DMZ A;  4NXP A;  5E6P B;  2JIK A;  1B8Q A;  1Q3O A;  2X7Z A;  3NCV A;  2RRM A;  1L6O A;  3RL8 A;  4EDJ A;  2EEJ A;  2M0T A;  2PDZ A;  1UEW A;  3GAB A;  2VSP A;  3CYY A;  2AWU A;  1VAE A;  5HDY A;  3K1R A;  2QBW A;  3KZD A;  1OBY A;  2KV8 A;  4JOK A;  5FB8 C;  1Z86 A;  4H11 A;  4JOR A;  3CC0 A;  2DM8 A;  4P0C A;  1IHJ A;  2IWO A;  3ID1 A;  2JWE A;  1FC6 A;  2YT7 A;  1W9Q A;  1GQ4 A;  1WHA A;  1OBX A;  4HOP A;  2AWX A;  2KPK A;  3SFJ A;  5I7Z A;  3TSZ A;  2PKT A;  2KYL A;  1N6E A;  2H2C A;  4NXQ A;  1WJL A;  2OSG A;  1X6D A;  1UHP A;  1WFG A;  2DLU A;  1OZI A;  1P1E A;  2LOB A;  2JRE A;  5E11 A;  2D8I A;  1KWA A;  2LUI A;  2IWP A;  1Y7N A;  1I92 A;  2YTW A;  3PV2 A;  4JOH A;  3GJ9 A;  1N6F A;  2KRG A;  1FC7 A;  2RCZ A;  1UIT A;  4Q2O A;  3STJ A;  1XZ9 A;  2EGN A;  2VPH A;  2I0I A;  1W9E A;  1UEP A;  2OZF A;  3PDZ A;  3CBY A;  4JJ3 A;  2YT8 A;  2Q3G A;  3DJ1 A;  3QO6 A;  3I4W A;  2O2T A;  1UEQ A;  3VQG A;  2PZD A;  1MFL A;  3DIW A;  5H3J A;  2OQS A;  3O46 A;  1UJV A;  3LNY A;  4NMS A;  1YBO A;  4GVC A;  1KY9 A;  1M5Z A;  2QKT A;  2PKU A;  2KOM A;  2I1N A;  5EZ0 A;  5GND A;  2D92 A;  3B76 A;  1U3B A;  2DB5 A;  2Z9I A;  2I0L A;  2VSV A;  3TSW A;  1D5G A;  4FLN A;  1N99 A;  1UM1 A;  2YUB A;  3SHW A;  2OMJ A;  1N7E A;  1K32 A;  2AWW A;  4NMQ A;  4OEO A;  4NMT A;  1BE9 A;  5EYZ A;  4OEP A;  4P2A B;  2FE5 A;  1X8S A;  1W9O A;  2FN5 A;  4N6X A;  3HVQ C;  1X9Z A;  2FNE A;  2PA1 A;  4Q2N A;  2EEI A;  3PDV A;  4KFW A;  2W4F A;  5F3X A;  2ZPL A;  3NFL A;  2M10 A;  5E1Y A;  5G1E A;  4E3B A;  3QIK A;  5HET A;  3MH7 A;  2H3L A;  1BFE A;  2YUY A;  1Q3P A;  5E21 A;  2REY A;  2EJY A;  4K6Y A;  2V90 A;  1UEZ A;  2DC2 A;  2G5M B;  2OCS A;  2KJD A;  1N6D A;  2WL7 A;  3ID4 A;  1SOZ A;  2EDZ A;  1V6B A;  4Q6S A;  2JOA A;  5HEY A;  2AIN A;  2QKV A;  1SOT A;  4NMO A;  3PV5 A;  2EXG A;  5DTH A;  3QE1 A;  4G69 A;  1UM7 A;  4Q2Q A;  3CBX A;  4Z8J A;  3GDU A;  4JJ0 A;  3BPU A;  4E35 A;  3QJM A;  1VA8 A;  5HED A;  2DKR A;  2P3W A;  4OAJ A;  2KOH A;  2VWR A;  3R68 A;  1VCW A;  3HPM A;  3EGH C;  4PQW A;  1WI4 A;  4Q3H A;  3TMH A;  3MH6 A;  3RL7 A;  3DJ3 A;  1U39 A;  4WYU A;  2OGP A;  2DAZ A;  4NXR A;  2FCF A;  3SUZ A;  5HFC A;  1QLC A;  5E22 A;  2EGO A;  1FC9 A;  2EEH A;  2M0V A;  5HFD A;  5HFF A;  2DLS A;  4YDP A;  1X45 A;  4RI0 A;  2VRF A;  5HFE A;  2M0U A;  2I6V A;  4AMH A;  1TP3 A;  3GDV A;  3QGL A;  2H2B A;  4XHV A;  2L4S A;  4WYT A;  4K76 A;  4NMR A;  1WHD A;  3O5N A;  1V1T A;  2KBS A;  4GVD A;  1OBZ A;  1GQ5 A;  1X5R A;  3WKL A;  3LNX A;  4L8N A;  2MX6 A;  5B42 A;  2EEG A;  4R2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...