1X5NA

Solution structure of the second pdz domain of harmonin protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
114
structure length
114
Chain Sequence
GSSGSSGSPGNRENKEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTISIVAAAGRELFMTDRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Harmonin
publication title Solution structure of the second PDZ domain of harmonin protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1x5nA00
2K1ZA 2DB5A 1XZ9A 3GDSA 2YT8A 5E11A 2E7KA 1KEFA 1B8QA 3MH7A 3L4FD 1X5QA 2MHOA 2KG2A 2V1WA 1WH1A 3NFLA 3GDUA 2EDPA 5GLJA 1GM1A 2EV8A 3WKMA 5HFDA 2IWNA 4P0CA 1W9OA 3FY5A 2EGNA 4K76A 4NXRA 4Q6HA 2AWUA 1MC7A 1RGRA 2L4TA 2M3MA 4JORA 3DJ3A 4JOEA 4NXQA 2VRFA 2CS5A 5G1DA 1UM7A 5E6PB 4K78A 3CH8A 1IHJA 2EDZA 3KHFA 2PDZA 2KJPA 2JOAA 1OZIA 1WJLA 1SOZA 1WFGA 3JXTA 2EXGA 1RZXA 3GCOA 3B76A 4Q3HA 2KV8A 1WFVA 4G69A 1VCWA 2PNTA 5HF4A 3TMHA 2JXOA 2Z9IA 2OGPA 3QJMA 2YUBA 1QLCA 2OS6A 3ID2A 5I7ZA 3KZEA 3CC0A 1WF7A 4HOPA 2G5MB 1W9QA 2EGKA 2KYLA 4O06A 2ZPLA 2MX6A 4Q2NA 1KY9A 3RL8A 1IU2A 2Z17A 3SHUA 2DLSA 2KA9A 4REYA 2OZFA 3DJ1A 4Q2OA 2FN5A 1UM1A 2IWQA 1Z87A 3O46A 4JL7A 4N6XA 5H3JA 1YBOA 5FB8C 2EEJA 2HE4A 4NNLA 2HE2A 1FC6A 3R68A 1VAEA 2M0UA 2W4FA 3WKLA 1UHPA 4JOFA 1Q7XA 1SOTA 3VQFA 4P2AB 1R6JA 3KZDA 3LNXA 2W7RA 1TP3A 2M0ZA 2PKUA 5B6LA 2VWRA 3QIKA 1V5LA 1N99A 3STJA 1WI4A 4JOHA 1U3BA 2EEIA 4OEOA 2DLUA 3R69A 4GVDA 2V90A 1UEWA 1VB7A 4L8NA 2DC2A 2DJTA 2H2CA 2FNEA 1M5ZA 2FE5A 4NMPA 2H3MA 2EEHA 2M0VA 2OQSA 4UU6A 1IU0A 1V1TA 3EGHC 1I16A 5HJ1A 2R4HA 1Q3OA 1QAVB 4JOGA 2I0IA 4UU5A 2D90A 2ZPMA 2VPHA 4K6YA 2CSJA 2KPKA 3GDVA 4E35A 2KRGA 3PV4A 2D92A 3EGGC 5HFFA 1V62A 2QBWA 3CS0A 3MH4A 1X45A 2VSVA 1BE9A 1UJDA 1Q3PA 1N6DA 2OMJA 2R3YA 3PV5A 2ENOA 3GSLA 2EDVA 5FHTA 3QDOA 5HFBA 3CBZA 4K72A 1MFGA 4WYTA 3K82A 1U38A 2IWOA 4NMRA 4NMSA 1UEPA 1X6DA 2AWWA 3ID1A 2KL1A 1UJUA 1RY4A 1K32A 3GCNA 4Z33A 1NTEA 4NXPA 3OTPA 3K50A 4NMVA 3CYYA 1N7FA 3PDZA 5HFEA 3ID4A 3ID3A 2VSPA 2I1NA 5E1YA 4AMHA 4OAJA 2LUIA 2Q3GA 2I0LA 2KOMA 3DJAA 4K75A 1G9OA 1U39A 5HEYA 3CBXA 3SHWA 2D8IA 3AXAA 3RLEA 2KAWA 2LC6A 4LMMA 3MH6A 1WHAA 1GQ5A 3HVQC 4XHVA 3LNYA 1WF8A 5F67A 1UEQA 4HOPB 1RGWA 2K20A 2O2TA 1X8SA 1L6OA 5G1EA 2QKVA 4R2ZA 2CSSA 4JOKA 2FCFA 1QAUA 5E21A 3SFJA 1FCFA 2F5YA 3I1EA 1ZOKA 1GQ4A 2H3LA 1TE0A 3PV2A 3TSWA 2EEGA 3NGHA 2H2BA 1WHDA 5GNDA 4NMTA 5DTHA 5F3XA 1V5QA 2I4SA 1VA8A 3HPMA 1U37A 5HEDA 2M0TA 2QG1A 2WL7A 5HEBA 3ZRTA 1WIFA 1KWAA 1NF3C 2LOBA 2Q9VA 1ZUBA 1P1DA 2OCSA 5E22A 2F0AA 2UZCA 2REYA 2DM8A 2KBSA 1UJVA 2YTWA 3O5NA 5D13A 3PDVA 2G2LA 4E3BA 2KJKA 1QAVA 4JOPA 4JOJA 2QT5A 2AWXA 2QKUA 4GHNA 1T2MA 1VJ6A 3I4WA 2DMZA 3DORA 4EDJA 2P3WA 2X7ZA 2LA8A 5HFCA 3BPUA 1OBYA 3SUZA 2DKRA 2JREA 4YYXA 2BYGA 3CBYA 4NNMA 3NFKA 2KQFA 4E34A 1UFXA 1UF1A 2RCZA 2IWPA 3QO6A 3QJNA 4H11A 2PZDA 1UITA 2JWEA 4Q6SA 3QE1A 1X5NA 2GZVA 3QGLA 4Q2PA 2EAQA 2OPGA 1N7EA 3SOEA 4RI0A 1W9EA 2RRMA 1PDRA 3HPKA 2PKTA 5A2PA 1Y7NA 1P1EA 3VQGA 4PQWA 2DAZA 2VZ5A 4IC6A 3PS4A 2I6VA 5HDYA 2L97A 3TSZA 1Y8TA 4MPAA 2AINA 1FC7A 4YDPA 1FC9A 2EJYA 1N6FA 2EHRA 4NMOA 1UEZA 1D5GA 1LCYA 2PA1A 2OSGA 3TSVA 2JIKA 4OEPA 2EGOA 1N7TA 2QKTA 3R0HA 4WYUA 1N6EA 4FGMA 4F8KA 2I04A 4KFWA 5EYZA 2KOHA 2LC7A 1OBZA 2JINA 3OU0A 5HETA 2KPLA 2L4SA 3GJ9A 2HGAA 4GVCA 4NMQA 1OBXA 2KOJA 3RL7A 3DIWA 2KJDA 2YUYA 1BFEA 1X5RA 1V6BA 4Z8JA 2JILA 1TP5A 4KFVA 5EZ0A 1TQ3A 4Q2QA 1WI2A 3E17A 2YT7A 1Z86A 3GGEA 3I18A 2M10A 5HF1A 5JXBA 1MFLA 3K1RA 1WG6A 1I92A
chains in the Genus database with same CATH superfamily
2K1ZA 2DB5A 1XZ9A 3GDSA 2YT8A 5E11A 2E7KA 1KEFA 1B8QA 3MH7A 3L4FD 1X5QA 2MHOA 2KG2A 2V1WA 1WH1A 3NFLA 3GDUA 4JJ0A 2EDPA 5GLJA 1GM1A 2EV8A 3WKMA 5HFDA 2IWNA 4P0CA 1W9OA 3FY5A 2EGNA 4K76A 4NXRA 4Q6HA 2AWUA 4FLNA 1MC7A 1RGRA 2L4TA 2M3MA 4JORA 3DJ3A 4JOEA 4NXQA 2VRFA 2CS5A 5G1DA 1UM7A 5E6PB 3KDKA 4K78A 3CH8A 1IHJA 2EDZA 3KDGA 3KHFA 2PDZA 2KJPA 2JOAA 1OZIA 1WJLA 1SOZA 3NCVA 1WFGA 3JXTA 2EXGA 1RZXA 3GCOA 3B76A 4Q3HA 2KV8A 1WFVA 4G69A 1VCWA 2PNTA 5HF4A 3TMHA 2JXOA 2Z9IA 2OGPA 3QJMA 2YUBA 5IL9A 1QLCA 2OS6A 3ID2A 5I7ZA 3KZEA 3CC0A 1WF7A 4HOPA 2G5MB 1W9QA 2EGKA 2KYLA 4O06A 2ZPLA 2MX6A 4Q2NA 1KY9A 3RL8A 1IU2A 2Z17A 3SHUA 2DLSA 1X9ZA 2KA9A 4REYA 2OZFA 3DJ1A 4Q2OA 2FN5A 1UM1A 2IWQA 1Z87A 3O46A 4JL7A 4N6XA 5H3JA 1YBOA 5FB8C 2EEJA 2HE4A 4NNLA 2HE2A 1FC6A 3R68A 1VAEA 2M0UA 2W4FA 3WKLA 1UHPA 4JOFA 1Q7XA 1SOTA 3VQFA 4P2AB 1R6JA 3KZDA 3LNXA 2W7RA 1TP3A 2M0ZA 2PKUA 5B6LA 2VWRA 3QIKA 1V5LA 1N99A 3STJA 1WI4A 4JOHA 1U3BA 2EEIA 4OEOA 2DLUA 3R69A 4GVDA 2V90A 1UEWA 1VB7A 4L8NA 2DC2A 2DJTA 2H2CA 2FNEA 1M5ZA 2FE5A 4NMPA 2H3MA 2EEHA 2M0VA 2OQSA 4UU6A 1IU0A 1V1TA 3EGHC 1I16A 5HJ1A 2R4HA 1Q3OA 1QAVB 4JOGA 2I0IA 4UU5A 2D90A 2ZPMA 2VPHA 4K6YA 2CSJA 2KPKA 3GDVA 4E35A 2KRGA 3PV4A 2D92A 3EGGC 5HFFA 1V62A 2QBWA 3CS0A 3MH4A 1X45A 2VSVA 1BE9A 1UJDA 1Q3PA 1N6DA 2OMJA 2R3YA 3PV5A 2ENOA 3GSLA 2EDVA 5FHTA 3QDOA 5HFBA 3CBZA 4K72A 1MFGA 4WYTA 3K82A 1U38A 2IWOA 4NMRA 4NMSA 1UEPA 1X6DA 2AWWA 2GEFA 3ID1A 2KL1A 1UJUA 1RY4A 1K32A 3GCNA 4Z33A 1NTEA 4NXPA 3OTPA 3K50A 4NMVA 3CYYA 1N7FA 3PDZA 5HFEA 3ID4A 2VSPA 3ID3A 2I1NA 5E1YA 4AMHA 4OAJA 2LUIA 2Q3GA 2I0LA 2KOMA 3DJAA 4K75A 1G9OA 1U39A 5HEYA 3CBXA 3SHWA 2D8IA 3AXAA 3RLEA 2KAWA 2LC6A 4LMMA 3MH6A 1WHAA 1GQ5A 3HVQC 4XHVA 3LNYA 1WF8A 5F67A 1UEQA 4HOPB 1RGWA 2K20A 2O2TA 1X8SA 1L6OA 5G1EA 2QKVA 4R2ZA 2CSSA 4JOKA 2FCFA 1QAUA 5B42A 5E21A 3SFJA 1FCFA 2F5YA 3I1EA 1ZOKA 5ILBA 1GQ4A 2H3LA 1TE0A 3PV2A 3TSWA 2EEGA 3NGHA 2H2BA 1WHDA 5GNDA 4NMTA 5DTHA 5F3XA 1V5QA 2I4SA 1VA8A 3HPMA 1U37A 5HEDA 2M0TA 2QG1A 2WL7A 5HEBA 3ZRTA 1WIFA 1KWAA 1NF3C 2LOBA 2Q9VA 1ZUBA 1P1DA 2OCSA 5E22A 2F0AA 2UZCA 2REYA 2DM8A 2KBSA 1UJVA 2YTWA 3O5NA 5D13A 3PDVA 2G2LA 4E3BA 2KJKA 1QAVA 4JOPA 4JOJA 2QT5A 2AWXA 2QKUA 4GHNA 1T2MA 1VJ6A 3I4WA 2DMZA 3DORA 4EDJA 2P3WA 2X7ZA 2LA8A 5HFCA 3GABA 3BPUA 1OBYA 3SUZA 2DKRA 2JREA 4YYXA 2BYGA 3CBYA 4NNMA 3NFKA 2KQFA 4E34A 1UFXA 1UF1A 2RCZA 2IWPA 3QO6A 3QJNA 4H11A 2PZDA 1UITA 2JWEA 4Q6SA 3QE1A 1X5NA 2GZVA 3QGLA 4Q2PA 2EAQA 2OPGA 1N7EA 3SOEA 4RI0A 1W9EA 2RRMA 1PDRA 3HPKA 2PKTA 5A2PA 1Y7NA 1P1EA 4JJ3A 3VQGA 4PQWA 2DAZA 2VZ5A 4IC6A 3PS4A 2I6VA 5HDYA 2L97A 3TSZA 1Y8TA 4MPAA 2AINA 1FC7A 4YDPA 1FC9A 2EJYA 1N6FA 2EHRA 4NMOA 1UEZA 1D5GA 1LCYA 2PA1A 2OSGA 3TSVA 2JIKA 4OEPA 2EGOA 1N7TA 2QKTA 3R0HA 4WYUA 1N6EA 4FGMA 4F8KA 2I04A 4KFWA 5EYZA 2KOHA 2LC7A 1OBZA 2JINA 3OU0A 5HETA 2KPLA 2L4SA 3GJ9A 2HGAA 4GVCA 4NMQA 1OBXA 2KOJA 3RL7A 3DIWA 2KJDA 2YUYA 1BFEA 1X5RA 1V6BA 2JSNA 4Z8JA 2JILA 1TP5A 4KFVA 5EZ0A 1TQ3A 4Q2QA 1WI2A 3E17A 2YT7A 1Z86A 3GGEA 3I18A 2M10A 5HF1A 5JXBA 1MFLA 3K1RA 1WG6A 1I92A
chains in the Genus database with same CATH topology
2K1ZA 2DB5A 1XZ9A 3GDSA 2YT8A 5E11A 2E7KA 1KEFA 1B8QA 3MH7A 3L4FD 1X5QA 2MHOA 2KG2A 2V1WA 1WH1A 3NFLA 3GDUA 4JJ0A 2EDPA 5GLJA 1GM1A 2EV8A 3WKMA 5HFDA 2IWNA 4P0CA 1W9OA 3FY5A 2EGNA 4K76A 4NXRA 4Q6HA 2AWUA 4FLNA 1MC7A 1RGRA 2L4TA 2M3MA 4JORA 3DJ3A 4JOEA 4NXQA 2VRFA 2CS5A 5G1DA 1UM7A 5E6PB 3KDKA 4K78A 3CH8A 1IHJA 2EDZA 3KDGA 3KHFA 2PDZA 2KJPA 2JOAA 1OZIA 1WJLA 1SOZA 3NCVA 1WFGA 3JXTA 2EXGA 1RZXA 3GCOA 3B76A 4Q3HA 2KV8A 1WFVA 4G69A 1VCWA 2PNTA 5HF4A 3TMHA 2JXOA 2Z9IA 2OGPA 3QJMA 2YUBA 5IL9A 1QLCA 2OS6A 3ID2A 5I7ZA 3KZEA 3CC0A 1WF7A 4HOPA 2G5MB 1W9QA 2EGKA 2KYLA 4O06A 2ZPLA 2MX6A 4Q2NA 1KY9A 3RL8A 1IU2A 2Z17A 3SHUA 2DLSA 1X9ZA 2KA9A 4REYA 2OZFA 3DJ1A 4Q2OA 2FN5A 1UM1A 2IWQA 1Z87A 3O46A 4JL7A 4N6XA 5H3JA 1YBOA 5FB8C 2EEJA 2HE4A 4NNLA 2HE2A 1FC6A 3R68A 1VAEA 2M0UA 2W4FA 3WKLA 1UHPA 4JOFA 1Q7XA 1SOTA 3VQFA 4P2AB 1R6JA 3KZDA 3LNXA 2W7RA 1TP3A 2M0ZA 2PKUA 5B6LA 2VWRA 3QIKA 1V5LA 1N99A 3STJA 1WI4A 4JOHA 1U3BA 2EEIA 4OEOA 2DLUA 3R69A 4GVDA 2V90A 1UEWA 1VB7A 4L8NA 2DC2A 2DJTA 2H2CA 2FNEA 1M5ZA 2FE5A 4NMPA 2H3MA 2EEHA 2M0VA 2OQSA 4UU6A 1IU0A 1V1TA 3EGHC 1I16A 5HJ1A 2R4HA 1Q3OA 1QAVB 4JOGA 2I0IA 4UU5A 2D90A 2ZPMA 2VPHA 4K6YA 2CSJA 2KPKA 3GDVA 4E35A 2KRGA 3PV4A 2D92A 3EGGC 5HFFA 1V62A 2QBWA 3CS0A 3MH4A 1X45A 2VSVA 1BE9A 1UJDA 1Q3PA 1N6DA 2OMJA 2R3YA 3PV5A 2ENOA 3GSLA 2EDVA 5FHTA 3QDOA 5HFBA 3CBZA 4K72A 1MFGA 4WYTA 3K82A 1U38A 2IWOA 4NMRA 4NMSA 1UEPA 1X6DA 2AWWA 2GEFA 3ID1A 2KL1A 1UJUA 1RY4A 1K32A 3GCNA 4Z33A 1NTEA 4NXPA 3OTPA 3K50A 4NMVA 3CYYA 1N7FA 3PDZA 5HFEA 3ID4A 2VSPA 3ID3A 2I1NA 5E1YA 4AMHA 4OAJA 2LUIA 2Q3GA 2I0LA 2KOMA 3DJAA 4K75A 1G9OA 1U39A 5HEYA 3CBXA 3SHWA 2D8IA 3AXAA 3RLEA 2KAWA 2LC6A 4LMMA 3MH6A 1WHAA 1GQ5A 3HVQC 4XHVA 3LNYA 1WF8A 5F67A 1UEQA 4HOPB 1RGWA 2K20A 2O2TA 1X8SA 1L6OA 5G1EA 2QKVA 4R2ZA 2CSSA 4JOKA 2FCFA 1QAUA 5B42A 5E21A 3SFJA 1FCFA 2F5YA 3I1EA 1ZOKA 5ILBA 1GQ4A 2H3LA 1TE0A 3PV2A 3TSWA 2EEGA 3NGHA 2H2BA 1WHDA 5GNDA 4NMTA 5DTHA 5F3XA 1V5QA 2I4SA 1VA8A 3HPMA 1U37A 5HEDA 2M0TA 2QG1A 2WL7A 5HEBA 3ZRTA 1WIFA 1KWAA 1NF3C 2LOBA 2Q9VA 1ZUBA 1P1DA 2OCSA 5E22A 2F0AA 2UZCA 2REYA 2DM8A 2KBSA 1UJVA 2YTWA 3O5NA 5D13A 3PDVA 2G2LA 4E3BA 2KJKA 1QAVA 4JOPA 4JOJA 2QT5A 2AWXA 2QKUA 4GHNA 1T2MA 1VJ6A 3I4WA 2DMZA 3DORA 4EDJA 2P3WA 2X7ZA 2LA8A 5HFCA 3GABA 3BPUA 1OBYA 3SUZA 2DKRA 2JREA 4YYXA 2BYGA 3CBYA 4NNMA 3NFKA 2KQFA 4E34A 1UFXA 1UF1A 2RCZA 2IWPA 3QO6A 3QJNA 4H11A 2PZDA 1UITA 2JWEA 4Q6SA 3QE1A 1X5NA 2GZVA 3QGLA 4Q2PA 2EAQA 2OPGA 1N7EA 3SOEA 4RI0A 1W9EA 2RRMA 1PDRA 3HPKA 2PKTA 5A2PA 1Y7NA 1P1EA 4JJ3A 3VQGA 4PQWA 2DAZA 2VZ5A 4IC6A 3PS4A 2I6VA 5HDYA 2L97A 3TSZA 1Y8TA 4MPAA 2AINA 1FC7A 4YDPA 1FC9A 2EJYA 1N6FA 2EHRA 4NMOA 1UEZA 1D5GA 1LCYA 2PA1A 2OSGA 3TSVA 2JIKA 4OEPA 2EGOA 1N7TA 2QKTA 3R0HA 4WYUA 1N6EA 4FGMA 4F8KA 2I04A 4KFWA 5EYZA 2KOHA 2LC7A 1OBZA 2JINA 3OU0A 5HETA 2KPLA 2L4SA 3GJ9A 2HGAA 4GVCA 4NMQA 1OBXA 2KOJA 3RL7A 3DIWA 2KJDA 2YUYA 1BFEA 1X5RA 1V6BA 2JSNA 4Z8JA 2JILA 1TP5A 4KFVA 5EZ0A 1TQ3A 4Q2QA 1WI2A 3E17A 2YT7A 1Z86A 3GGEA 3I18A 2M10A 5HF1A 5JXBA 1MFLA 3K1RA 1WG6A 1I92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1Z A;  2DB5 A;  1XZ9 A;  3GDS A;  2YT8 A;  5E11 A;  2E7K A;  1KEF A;  1B8Q A;  3MH7 A;  3L4F D;  1X5Q A;  2MHO A;  2KG2 A;  2V1W A;  1WH1 A;  3NFL A;  3GDU A;  2EDP A;  5GLJ A;  1GM1 A;  2EV8 A;  3WKM A;  5HFD A;  2IWN A;  4P0C A;  1W9O A;  3FY5 A;  2EGN A;  4K76 A;  4NXR A;  4Q6H A;  2AWU A;  1MC7 A;  1RGR A;  2L4T A;  2M3M A;  4JOR A;  3DJ3 A;  4JOE A;  4NXQ A;  2VRF A;  2CS5 A;  5G1D A;  1UM7 A;  5E6P B;  4K78 A;  3CH8 A;  1IHJ A;  2EDZ A;  3KHF A;  2PDZ A;  2KJP A;  2JOA A;  1OZI A;  1WJL A;  1SOZ A;  1WFG A;  3JXT A;  2EXG A;  1RZX A;  3GCO A;  3B76 A;  4Q3H A;  2KV8 A;  1WFV A;  4G69 A;  1VCW A;  2PNT A;  5HF4 A;  3TMH A;  2JXO A;  2Z9I A;  2OGP A;  3QJM A;  2YUB A;  1QLC A;  2OS6 A;  3ID2 A;  5I7Z A;  3KZE A;  3CC0 A;  1WF7 A;  4HOP A;  2G5M B;  1W9Q A;  2EGK A;  2KYL A;  4O06 A;  2ZPL A;  2MX6 A;  4Q2N A;  1KY9 A;  3RL8 A;  1IU2 A;  2Z17 A;  3SHU A;  2DLS A;  2KA9 A;  4REY A;  2OZF A;  3DJ1 A;  4Q2O A;  2FN5 A;  1UM1 A;  2IWQ A;  1Z87 A;  3O46 A;  4JL7 A;  4N6X A;  5H3J A;  1YBO A;  5FB8 C;  2EEJ A;  2HE4 A;  4NNL A;  2HE2 A;  1FC6 A;  3R68 A;  1VAE A;  2M0U A;  2W4F A;  3WKL A;  1UHP A;  4JOF A;  1Q7X A;  1SOT A;  3VQF A;  4P2A B;  1R6J A;  3KZD A;  3LNX A;  2W7R A;  1TP3 A;  2M0Z A;  2PKU A;  5B6L A;  2VWR A;  3QIK A;  1V5L A;  1N99 A;  3STJ A;  1WI4 A;  4JOH A;  1U3B A;  2EEI A;  4OEO A;  2DLU A;  3R69 A;  4GVD A;  2V90 A;  1UEW A;  1VB7 A;  4L8N A;  2DC2 A;  2DJT A;  2H2C A;  2FNE A;  1M5Z A;  2FE5 A;  4NMP A;  2H3M A;  2EEH A;  2M0V A;  2OQS A;  4UU6 A;  1IU0 A;  1V1T A;  3EGH C;  1I16 A;  5HJ1 A;  2R4H A;  1Q3O A;  1QAV B;  4JOG A;  2I0I A;  4UU5 A;  2D90 A;  2ZPM A;  2VPH A;  4K6Y A;  2CSJ A;  2KPK A;  3GDV A;  4E35 A;  2KRG A;  3PV4 A;  2D92 A;  3EGG C;  5HFF A;  1V62 A;  2QBW A;  3CS0 A;  3MH4 A;  1X45 A;  2VSV A;  1BE9 A;  1UJD A;  1Q3P A;  1N6D A;  2OMJ A;  2R3Y A;  3PV5 A;  2ENO A;  3GSL A;  2EDV A;  5FHT A;  3QDO A;  5HFB A;  3CBZ A;  4K72 A;  1MFG A;  4WYT A;  3K82 A;  1U38 A;  2IWO A;  4NMR A;  4NMS A;  1UEP A;  1X6D A;  2AWW A;  3ID1 A;  2KL1 A;  1UJU A;  1RY4 A;  1K32 A;  3GCN A;  4Z33 A;  1NTE A;  4NXP A;  3OTP A;  3K50 A;  4NMV A;  3CYY A;  1N7F A;  3PDZ A;  5HFE A;  3ID4 A;  3ID3 A;  2VSP A;  2I1N A;  5E1Y A;  4AMH A;  4OAJ A;  2LUI A;  2Q3G A;  2I0L A;  2KOM A;  3DJA A;  4K75 A;  1G9O A;  1U39 A;  5HEY A;  3CBX A;  3SHW A;  2D8I A;  3AXA A;  3RLE A;  2KAW A;  2LC6 A;  4LMM A;  3MH6 A;  1WHA A;  1GQ5 A;  3HVQ C;  4XHV A;  3LNY A;  1WF8 A;  5F67 A;  1UEQ A;  4HOP B;  1RGW A;  2K20 A;  2O2T A;  1X8S A;  1L6O A;  5G1E A;  2QKV A;  4R2Z A;  2CSS A;  4JOK A;  2FCF A;  1QAU A;  5E21 A;  3SFJ A;  1FCF A;  2F5Y A;  3I1E A;  1ZOK A;  1GQ4 A;  2H3L A;  1TE0 A;  3PV2 A;  3TSW A;  2EEG A;  3NGH A;  2H2B A;  1WHD A;  5GND A;  4NMT A;  5DTH A;  5F3X A;  1V5Q A;  2I4S A;  1VA8 A;  3HPM A;  1U37 A;  5HED A;  2M0T A;  2QG1 A;  2WL7 A;  5HEB A;  3ZRT A;  1WIF A;  1KWA A;  1NF3 C;  2LOB A;  2Q9V A;  1ZUB A;  1P1D A;  2OCS A;  5E22 A;  2F0A A;  2UZC A;  2REY A;  2DM8 A;  2KBS A;  1UJV A;  2YTW A;  3O5N A;  5D13 A;  3PDV A;  2G2L A;  4E3B A;  2KJK A;  1QAV A;  4JOP A;  4JOJ A;  2QT5 A;  2AWX A;  2QKU A;  4GHN A;  1T2M A;  1VJ6 A;  3I4W A;  2DMZ A;  3DOR A;  4EDJ A;  2P3W A;  2X7Z A;  2LA8 A;  5HFC A;  3BPU A;  1OBY A;  3SUZ A;  2DKR A;  2JRE A;  4YYX A;  2BYG A;  3CBY A;  4NNM A;  3NFK A;  2KQF A;  4E34 A;  1UFX A;  1UF1 A;  2RCZ A;  2IWP A;  3QO6 A;  3QJN A;  4H11 A;  2PZD A;  1UIT A;  2JWE A;  4Q6S A;  3QE1 A;  1X5N A;  2GZV A;  3QGL A;  4Q2P A;  2EAQ A;  2OPG A;  1N7E A;  3SOE A;  4RI0 A;  1W9E A;  2RRM A;  1PDR A;  3HPK A;  2PKT A;  5A2P A;  1Y7N A;  1P1E A;  3VQG A;  4PQW A;  2DAZ A;  2VZ5 A;  4IC6 A;  3PS4 A;  2I6V A;  5HDY A;  2L97 A;  3TSZ A;  1Y8T A;  4MPA A;  2AIN A;  1FC7 A;  4YDP A;  1FC9 A;  2EJY A;  1N6F A;  2EHR A;  4NMO A;  1UEZ A;  1D5G A;  1LCY A;  2PA1 A;  2OSG A;  3TSV A;  2JIK A;  4OEP A;  2EGO A;  1N7T A;  2QKT A;  3R0H A;  4WYU A;  1N6E A;  4FGM A;  4F8K A;  2I04 A;  4KFW A;  5EYZ A;  2KOH A;  2LC7 A;  1OBZ A;  2JIN A;  3OU0 A;  5HET A;  2KPL A;  2L4S A;  3GJ9 A;  2HGA A;  4GVC A;  4NMQ A;  1OBX A;  2KOJ A;  3RL7 A;  3DIW A;  2KJD A;  2YUY A;  1BFE A;  1X5R A;  1V6B A;  4Z8J A;  2JIL A;  1TP5 A;  4KFV A;  5EZ0 A;  1TQ3 A;  4Q2Q A;  1WI2 A;  3E17 A;  2YT7 A;  1Z86 A;  3GGE A;  3I18 A;  2M10 A;  5HF1 A;  5JXB A;  1MFL A;  3K1R A;  1WG6 A;  1I92 A; 
#chains in the Genus database with same CATH topology
 2K1Z A;  2DB5 A;  1XZ9 A;  3GDS A;  2YT8 A;  5E11 A;  2E7K A;  1KEF A;  1B8Q A;  3MH7 A;  3L4F D;  1X5Q A;  2MHO A;  2KG2 A;  2V1W A;  1WH1 A;  3NFL A;  3GDU A;  4JJ0 A;  2EDP A;  5GLJ A;  1GM1 A;  2EV8 A;  3WKM A;  5HFD A;  2IWN A;  4P0C A;  1W9O A;  3FY5 A;  2EGN A;  4K76 A;  4NXR A;  4Q6H A;  2AWU A;  4FLN A;  1MC7 A;  1RGR A;  2L4T A;  2M3M A;  4JOR A;  3DJ3 A;  4JOE A;  4NXQ A;  2VRF A;  2CS5 A;  5G1D A;  1UM7 A;  5E6P B;  3KDK A;  4K78 A;  3CH8 A;  1IHJ A;  2EDZ A;  3KDG A;  3KHF A;  2PDZ A;  2KJP A;  2JOA A;  1OZI A;  1WJL A;  1SOZ A;  3NCV A;  1WFG A;  3JXT A;  2EXG A;  1RZX A;  3GCO A;  3B76 A;  4Q3H A;  2KV8 A;  1WFV A;  4G69 A;  1VCW A;  2PNT A;  5HF4 A;  3TMH A;  2JXO A;  2Z9I A;  2OGP A;  3QJM A;  2YUB A;  5IL9 A;  1QLC A;  2OS6 A;  3ID2 A;  5I7Z A;  3KZE A;  3CC0 A;  1WF7 A;  4HOP A;  2G5M B;  1W9Q A;  2EGK A;  2KYL A;  4O06 A;  2ZPL A;  2MX6 A;  4Q2N A;  1KY9 A;  3RL8 A;  1IU2 A;  2Z17 A;  3SHU A;  2DLS A;  1X9Z A;  2KA9 A;  4REY A;  2OZF A;  3DJ1 A;  4Q2O A;  2FN5 A;  1UM1 A;  2IWQ A;  1Z87 A;  3O46 A;  4JL7 A;  4N6X A;  5H3J A;  1YBO A;  5FB8 C;  2EEJ A;  2HE4 A;  4NNL A;  2HE2 A;  1FC6 A;  3R68 A;  1VAE A;  2M0U A;  2W4F A;  3WKL A;  1UHP A;  4JOF A;  1Q7X A;  1SOT A;  3VQF A;  4P2A B;  1R6J A;  3KZD A;  3LNX A;  2W7R A;  1TP3 A;  2M0Z A;  2PKU A;  5B6L A;  2VWR A;  3QIK A;  1V5L A;  1N99 A;  3STJ A;  1WI4 A;  4JOH A;  1U3B A;  2EEI A;  4OEO A;  2DLU A;  3R69 A;  4GVD A;  2V90 A;  1UEW A;  1VB7 A;  4L8N A;  2DC2 A;  2DJT A;  2H2C A;  2FNE A;  1M5Z A;  2FE5 A;  4NMP A;  2H3M A;  2EEH A;  2M0V A;  2OQS A;  4UU6 A;  1IU0 A;  1V1T A;  3EGH C;  1I16 A;  5HJ1 A;  2R4H A;  1Q3O A;  1QAV B;  4JOG A;  2I0I A;  4UU5 A;  2D90 A;  2ZPM A;  2VPH A;  4K6Y A;  2CSJ A;  2KPK A;  3GDV A;  4E35 A;  2KRG A;  3PV4 A;  2D92 A;  3EGG C;  5HFF A;  1V62 A;  2QBW A;  3CS0 A;  3MH4 A;  1X45 A;  2VSV A;  1BE9 A;  1UJD A;  1Q3P A;  1N6D A;  2OMJ A;  2R3Y A;  3PV5 A;  2ENO A;  3GSL A;  2EDV A;  5FHT A;  3QDO A;  5HFB A;  3CBZ A;  4K72 A;  1MFG A;  4WYT A;  3K82 A;  1U38 A;  2IWO A;  4NMR A;  4NMS A;  1UEP A;  1X6D A;  2AWW A;  2GEF A;  3ID1 A;  2KL1 A;  1UJU A;  1RY4 A;  1K32 A;  3GCN A;  4Z33 A;  1NTE A;  4NXP A;  3OTP A;  3K50 A;  4NMV A;  3CYY A;  1N7F A;  3PDZ A;  5HFE A;  3ID4 A;  2VSP A;  3ID3 A;  2I1N A;  5E1Y A;  4AMH A;  4OAJ A;  2LUI A;  2Q3G A;  2I0L A;  2KOM A;  3DJA A;  4K75 A;  1G9O A;  1U39 A;  5HEY A;  3CBX A;  3SHW A;  2D8I A;  3AXA A;  3RLE A;  2KAW A;  2LC6 A;  4LMM A;  3MH6 A;  1WHA A;  1GQ5 A;  3HVQ C;  4XHV A;  3LNY A;  1WF8 A;  5F67 A;  1UEQ A;  4HOP B;  1RGW A;  2K20 A;  2O2T A;  1X8S A;  1L6O A;  5G1E A;  2QKV A;  4R2Z A;  2CSS A;  4JOK A;  2FCF A;  1QAU A;  5B42 A;  5E21 A;  3SFJ A;  1FCF A;  2F5Y A;  3I1E A;  1ZOK A;  5ILB A;  1GQ4 A;  2H3L A;  1TE0 A;  3PV2 A;  3TSW A;  2EEG A;  3NGH A;  2H2B A;  1WHD A;  5GND A;  4NMT A;  5DTH A;  5F3X A;  1V5Q A;  2I4S A;  1VA8 A;  3HPM A;  1U37 A;  5HED A;  2M0T A;  2QG1 A;  2WL7 A;  5HEB A;  3ZRT A;  1WIF A;  1KWA A;  1NF3 C;  2LOB A;  2Q9V A;  1ZUB A;  1P1D A;  2OCS A;  5E22 A;  2F0A A;  2UZC A;  2REY A;  2DM8 A;  2KBS A;  1UJV A;  2YTW A;  3O5N A;  5D13 A;  3PDV A;  2G2L A;  4E3B A;  2KJK A;  1QAV A;  4JOP A;  4JOJ A;  2QT5 A;  2AWX A;  2QKU A;  4GHN A;  1T2M A;  1VJ6 A;  3I4W A;  2DMZ A;  3DOR A;  4EDJ A;  2P3W A;  2X7Z A;  2LA8 A;  5HFC A;  3GAB A;  3BPU A;  1OBY A;  3SUZ A;  2DKR A;  2JRE A;  4YYX A;  2BYG A;  3CBY A;  4NNM A;  3NFK A;  2KQF A;  4E34 A;  1UFX A;  1UF1 A;  2RCZ A;  2IWP A;  3QO6 A;  3QJN A;  4H11 A;  2PZD A;  1UIT A;  2JWE A;  4Q6S A;  3QE1 A;  1X5N A;  2GZV A;  3QGL A;  4Q2P A;  2EAQ A;  2OPG A;  1N7E A;  3SOE A;  4RI0 A;  1W9E A;  2RRM A;  1PDR A;  3HPK A;  2PKT A;  5A2P A;  1Y7N A;  1P1E A;  4JJ3 A;  3VQG A;  4PQW A;  2DAZ A;  2VZ5 A;  4IC6 A;  3PS4 A;  2I6V A;  5HDY A;  2L97 A;  3TSZ A;  1Y8T A;  4MPA A;  2AIN A;  1FC7 A;  4YDP A;  1FC9 A;  2EJY A;  1N6F A;  2EHR A;  4NMO A;  1UEZ A;  1D5G A;  1LCY A;  2PA1 A;  2OSG A;  3TSV A;  2JIK A;  4OEP A;  2EGO A;  1N7T A;  2QKT A;  3R0H A;  4WYU A;  1N6E A;  4FGM A;  4F8K A;  2I04 A;  4KFW A;  5EYZ A;  2KOH A;  2LC7 A;  1OBZ A;  2JIN A;  3OU0 A;  5HET A;  2KPL A;  2L4S A;  3GJ9 A;  2HGA A;  4GVC A;  4NMQ A;  1OBX A;  2KOJ A;  3RL7 A;  3DIW A;  2KJD A;  2YUY A;  1BFE A;  1X5R A;  1V6B A;  2JSN A;  4Z8J A;  2JIL A;  1TP5 A;  4KFV A;  5EZ0 A;  1TQ3 A;  4Q2Q A;  1WI2 A;  3E17 A;  2YT7 A;  1Z86 A;  3GGE A;  3I18 A;  2M10 A;  5HF1 A;  5JXB A;  1MFL A;  3K1R A;  1WG6 A;  1I92 A; 
#chains in the Genus database with same CATH homology
 2K1Z A;  2DB5 A;  1XZ9 A;  3GDS A;  2YT8 A;  5E11 A;  2E7K A;  1KEF A;  1B8Q A;  3MH7 A;  3L4F D;  1X5Q A;  2MHO A;  2KG2 A;  2V1W A;  1WH1 A;  3NFL A;  3GDU A;  4JJ0 A;  2EDP A;  5GLJ A;  1GM1 A;  2EV8 A;  3WKM A;  5HFD A;  2IWN A;  4P0C A;  1W9O A;  3FY5 A;  2EGN A;  4K76 A;  4NXR A;  4Q6H A;  2AWU A;  4FLN A;  1MC7 A;  1RGR A;  2L4T A;  2M3M A;  4JOR A;  3DJ3 A;  4JOE A;  4NXQ A;  2VRF A;  2CS5 A;  5G1D A;  1UM7 A;  5E6P B;  3KDK A;  4K78 A;  3CH8 A;  1IHJ A;  2EDZ A;  3KDG A;  3KHF A;  2PDZ A;  2KJP A;  2JOA A;  1OZI A;  1WJL A;  1SOZ A;  3NCV A;  1WFG A;  3JXT A;  2EXG A;  1RZX A;  3GCO A;  3B76 A;  4Q3H A;  2KV8 A;  1WFV A;  4G69 A;  1VCW A;  2PNT A;  5HF4 A;  3TMH A;  2JXO A;  2Z9I A;  2OGP A;  3QJM A;  2YUB A;  5IL9 A;  1QLC A;  2OS6 A;  3ID2 A;  5I7Z A;  3KZE A;  3CC0 A;  1WF7 A;  4HOP A;  2G5M B;  1W9Q A;  2EGK A;  2KYL A;  4O06 A;  2ZPL A;  2MX6 A;  4Q2N A;  1KY9 A;  3RL8 A;  1IU2 A;  2Z17 A;  3SHU A;  2DLS A;  1X9Z A;  2KA9 A;  4REY A;  2OZF A;  3DJ1 A;  4Q2O A;  2FN5 A;  1UM1 A;  2IWQ A;  1Z87 A;  3O46 A;  4JL7 A;  4N6X A;  5H3J A;  1YBO A;  5FB8 C;  2EEJ A;  2HE4 A;  4NNL A;  2HE2 A;  1FC6 A;  3R68 A;  1VAE A;  2M0U A;  2W4F A;  3WKL A;  1UHP A;  4JOF A;  1Q7X A;  1SOT A;  3VQF A;  4P2A B;  1R6J A;  3KZD A;  3LNX A;  2W7R A;  1TP3 A;  2M0Z A;  2PKU A;  5B6L A;  2VWR A;  3QIK A;  1V5L A;  1N99 A;  3STJ A;  1WI4 A;  4JOH A;  1U3B A;  2EEI A;  4OEO A;  2DLU A;  3R69 A;  4GVD A;  2V90 A;  1UEW A;  1VB7 A;  4L8N A;  2DC2 A;  2DJT A;  2H2C A;  2FNE A;  1M5Z A;  2FE5 A;  4NMP A;  2H3M A;  2EEH A;  2M0V A;  2OQS A;  4UU6 A;  1IU0 A;  1V1T A;  3EGH C;  1I16 A;  5HJ1 A;  2R4H A;  1Q3O A;  1QAV B;  4JOG A;  2I0I A;  4UU5 A;  2D90 A;  2ZPM A;  2VPH A;  4K6Y A;  2CSJ A;  2KPK A;  3GDV A;  4E35 A;  2KRG A;  3PV4 A;  2D92 A;  3EGG C;  5HFF A;  1V62 A;  2QBW A;  3CS0 A;  3MH4 A;  1X45 A;  2VSV A;  1BE9 A;  1UJD A;  1Q3P A;  1N6D A;  2OMJ A;  2R3Y A;  3PV5 A;  2ENO A;  3GSL A;  2EDV A;  5FHT A;  3QDO A;  5HFB A;  3CBZ A;  4K72 A;  1MFG A;  4WYT A;  3K82 A;  1U38 A;  2IWO A;  4NMR A;  4NMS A;  1UEP A;  1X6D A;  2AWW A;  2GEF A;  3ID1 A;  2KL1 A;  1UJU A;  1RY4 A;  1K32 A;  3GCN A;  4Z33 A;  1NTE A;  4NXP A;  3OTP A;  3K50 A;  4NMV A;  3CYY A;  1N7F A;  3PDZ A;  5HFE A;  3ID4 A;  2VSP A;  3ID3 A;  2I1N A;  5E1Y A;  4AMH A;  4OAJ A;  2LUI A;  2Q3G A;  2I0L A;  2KOM A;  3DJA A;  4K75 A;  1G9O A;  1U39 A;  5HEY A;  3CBX A;  3SHW A;  2D8I A;  3AXA A;  3RLE A;  2KAW A;  2LC6 A;  4LMM A;  3MH6 A;  1WHA A;  1GQ5 A;  3HVQ C;  4XHV A;  3LNY A;  1WF8 A;  5F67 A;  1UEQ A;  4HOP B;  1RGW A;  2K20 A;  2O2T A;  1X8S A;  1L6O A;  5G1E A;  2QKV A;  4R2Z A;  2CSS A;  4JOK A;  2FCF A;  1QAU A;  5B42 A;  5E21 A;  3SFJ A;  1FCF A;  2F5Y A;  3I1E A;  1ZOK A;  5ILB A;  1GQ4 A;  2H3L A;  1TE0 A;  3PV2 A;  3TSW A;  2EEG A;  3NGH A;  2H2B A;  1WHD A;  5GND A;  4NMT A;  5DTH A;  5F3X A;  1V5Q A;  2I4S A;  1VA8 A;  3HPM A;  1U37 A;  5HED A;  2M0T A;  2QG1 A;  2WL7 A;  5HEB A;  3ZRT A;  1WIF A;  1KWA A;  1NF3 C;  2LOB A;  2Q9V A;  1ZUB A;  1P1D A;  2OCS A;  5E22 A;  2F0A A;  2UZC A;  2REY A;  2DM8 A;  2KBS A;  1UJV A;  2YTW A;  3O5N A;  5D13 A;  3PDV A;  2G2L A;  4E3B A;  2KJK A;  1QAV A;  4JOP A;  4JOJ A;  2QT5 A;  2AWX A;  2QKU A;  4GHN A;  1T2M A;  1VJ6 A;  3I4W A;  2DMZ A;  3DOR A;  4EDJ A;  2P3W A;  2X7Z A;  2LA8 A;  5HFC A;  3GAB A;  3BPU A;  1OBY A;  3SUZ A;  2DKR A;  2JRE A;  4YYX A;  2BYG A;  3CBY A;  4NNM A;  3NFK A;  2KQF A;  4E34 A;  1UFX A;  1UF1 A;  2RCZ A;  2IWP A;  3QO6 A;  3QJN A;  4H11 A;  2PZD A;  1UIT A;  2JWE A;  4Q6S A;  3QE1 A;  1X5N A;  2GZV A;  3QGL A;  4Q2P A;  2EAQ A;  2OPG A;  1N7E A;  3SOE A;  4RI0 A;  1W9E A;  2RRM A;  1PDR A;  3HPK A;  2PKT A;  5A2P A;  1Y7N A;  1P1E A;  4JJ3 A;  3VQG A;  4PQW A;  2DAZ A;  2VZ5 A;  4IC6 A;  3PS4 A;  2I6V A;  5HDY A;  2L97 A;  3TSZ A;  1Y8T A;  4MPA A;  2AIN A;  1FC7 A;  4YDP A;  1FC9 A;  2EJY A;  1N6F A;  2EHR A;  4NMO A;  1UEZ A;  1D5G A;  1LCY A;  2PA1 A;  2OSG A;  3TSV A;  2JIK A;  4OEP A;  2EGO A;  1N7T A;  2QKT A;  3R0H A;  4WYU A;  1N6E A;  4FGM A;  4F8K A;  2I04 A;  4KFW A;  5EYZ A;  2KOH A;  2LC7 A;  1OBZ A;  2JIN A;  3OU0 A;  5HET A;  2KPL A;  2L4S A;  3GJ9 A;  2HGA A;  4GVC A;  4NMQ A;  1OBX A;  2KOJ A;  3RL7 A;  3DIW A;  2KJD A;  2YUY A;  1BFE A;  1X5R A;  1V6B A;  2JSN A;  4Z8J A;  2JIL A;  1TP5 A;  4KFV A;  5EZ0 A;  1TQ3 A;  4Q2Q A;  1WI2 A;  3E17 A;  2YT7 A;  1Z86 A;  3GGE A;  3I18 A;  2M10 A;  5HF1 A;  5JXB A;  1MFL A;  3K1R A;  1WG6 A;  1I92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...