5I7ZA

Crystal structure of a par-6 pdz-crumbs 3 c-terminal peptide complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
96
structure length
96
Chain Sequence
b'HRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LD29223p
publication title Binding of Crumbs to the Par-6 CRIB-PDZ Module Is Regulated by Cdc42.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 19
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5i7zA00
3AXAA 2D92A 2VZ5A 1XZ9A 1WFVA 4Z8JA 2K1ZA 5HETA 4JOHA 4OEPA 2PKUA 5HJ1A 3ZRTA 3ID3A 5EYZA 2RCZA 1UHPA 2Q9VA 2KJDA 2DJTA 2M0VA 5FB8C 1TP3A 1NTEA 3SHWA 1BFEA 2LC7A 4NNLA 1RGWA 1MC7A 3KZDA 1X5QA 2LC6A 2EAQA 3R69A 2DKRA 1D5GA 4NMQA 2DC2A 2OPGA 1QAVA 2V1WA 2IWPA 2PZDA 2CS5A 2HGAA 2R3YA 4PQWA 4JOFA 3LNYA 5GNDA 3NFLA 2JILA 3PV4A 1TE0A 1OZIA 2YT8A 2AWWA 2G5MB 2EGOA 4Q2PA 1UF1A 1P1EA 4E3BA 3NFKA 4RI0A 1WFGA 1WF8A 1VCWA 2JXOA 1SOZA 1V1TA 5HDYA 5I7ZA 4E35A 4K72A 2KPLA 4K6YA 2ZPLA 4UU5A 1X5RA 2D90A 1U39A 2H3LA 3O5NA 3RL8A 2IWOA 4Q3HA 4XHVA 3OU0A 2P3WA 5E6PB 4Z33A 1V5LA 3GJ9A 2FN5A 2KBSA 2H3MA 1UEPA 2UZCA 1FC9A 2KV8A 4WYUA 2D8IA 3PDZA 1Q7XA 2PKTA 2L4SA 1MFGA 3ID2A 1WHDA 2YUYA 3O46A 2EDVA 3DIWA 1X5NA 3FY5A 1UEWA 2VSVA 2KQFA 2QBWA 2VSPA 2FCFA 1VA8A 2M3MA 3R0HA 2HE4A 1UITA 5HFDA 2PA1A 3KZEA 5F3XA 1N6EA 3ID4A 3SFJA 1FC6A 1X8SA 2KYLA 2Z17A 3GGEA 1G9OA 3BPUA 5G1DA 2I0IA 2EGKA 4Q6HA 5B6LA 1UFXA 2OGPA 5HFEA 1WF7A 2EJYA 4E34A 3I4WA 1NF3C 2FNEA 1X45A 4YDPA 4MPAA 3CH8A 3HPMA 2QKVA 2ENOA 3WKLA 3DORA 2KRGA 4HOPA 1W9QA 5E21A 3ID1A 1MFLA 1UEZA 2EV8A 4JL7A 4WYTA 4LMMA 2EEJA 2PDZA 1L6OA 2KOJA 3CYYA 4OEOA 2EEHA 3CS0A 3GCNA 2DB5A 2MHOA 1TQ3A 3CBZA 5DTHA 4Q6SA 3JXTA 5E22A 1FCFA 1Y7NA 3SOEA 1RY4A 1WG6A 2KL1A 1N6DA 1WIFA 3HPKA 2V90A 5HFBA 1W9EA 4G69A 1N99A 5A2PA 3GDVA 3QIKA 5HFCA 3VQGA 2I0LA 1X6DA 5HF4A 2QKUA 1IU0A 4UU6A 1IU2A 3QJNA 4KFWA 2LUIA 2F5YA 2KG2A 1WH1A 4JOJA 2I4SA 1U38A 3LNXA 5HFFA 4NXRA 3K50A 2CSSA 4FGMA 4R2ZA 4L8NA 1VB7A 1UJUA 2KOMA 4NMSA 4F8KA 5H3JA 1ZOKA 2L97A 3CC0A 3CBXA 2L4TA 3I18A 4REYA 2REYA 3NGHA 4N6XA 3L4FD 4NMVA 3OTPA 2KA9A 2O2TA 1W9OA 2KPKA 1P1DA 3QGLA 3DJ1A 1KWAA 2RRMA 4JOPA 5D13A 1N6FA 2QG1A 4GVDA 3PV2A 3R68A 3TMHA 2EEIA 4IC6A 2YUBA 3GDSA 3DJ3A 3EGHC 1QLCA 3SHUA 3E17A 3QO6A 2GZVA 4NMPA 4EDJA 1WI2A 2M0UA 1GQ5A 1QAVB 3QDOA 1Q3OA 2JREA 3VQFA 4O06A 1OBYA 1QAUA 2W7RA 1UM7A 1T2MA 3MH7A 1RGRA 3GDUA 2VRFA 1V62A 1ZUBA 2FE5A 4K75A 3K82A 3PS4A 2MX6A 3MH4A 1BE9A 1YBOA 1PDRA 4GHNA 1UJVA 1UEQA 2F0AA 4GVCA 1IHJA 1I92A 3PV5A 4H11A 1Q3PA 1WHAA 3WKMA 2OS6A 1M5ZA 2R4HA 2VPHA 2OCSA 4Q2NA 4NMOA 4K76A 4JOEA 1OBXA 1I16A 5JXBA 1VJ6A 2HE2A 3RLEA 2KJKA 2EGNA 2QT5A 2G2LA 1KY9A 2DM8A 4NNMA 5HEDA 1Y8TA 2K20A 2QKTA 1U3BA 2KOHA 3TSWA 2DLUA 1VAEA 3MH6A 2W4FA 5E1YA 4Q2QA 3GCOA 3KHFA 3PDVA 1V5QA 2EHRA 4AMHA 4NXPA 3CBYA 2Q3GA 2YT7A 1WI4A 3SUZA 1Z87A 2ZPMA 1WJLA 4NMRA 4JOGA 2H2CA 3EGGC 1V6BA 2YTWA 1N7EA 1TP5A 2EDPA 1Z86A 3DJAA 2DMZA 1GQ4A 2KJPA 1R6JA 5F67A 4JORA 2OZFA 5HF1A 2AINA 2H2BA 2E7KA 4P0CA 2EEGA 4Q2OA 2Z9IA 2WL7A 2X7ZA 2EDZA 5G1EA 1B8QA 2VWRA 3TSZA 2JINA 1UM1A 5GLJA 4K78A 2LA8A 1SOTA 5HEBA 1KEFA 2OSGA 2BYGA 1OBZA 2OMJA 4HOPB 5E11A 4OAJA 1LCYA 1GM1A 2EXGA 2DLSA 4JOKA 4NXQA 2PNTA 2JOAA 1K32A 2AWUA 1N7FA 5EZ0A 1UJDA 3STJA 2M10A 5HEYA 3RL7A 1U37A 3QJMA 2DAZA 2M0ZA 3B76A 4KFVA 2AWXA 4P2AB 2JWEA 2OQSA 2I1NA 3I1EA 4NMTA 2JIKA 3HVQC 5FHTA 2I04A 3GSLA 1N7TA 2I6VA 2IWNA 3K1RA 3TSVA 2LOBA 2M0TA 2IWQA 1RZXA 4YYXA 1FC7A 2KAWA 2CSJA 3QE1A
chains in the Genus database with same CATH superfamily
5B42A 3AXAA 2D92A 2VZ5A 1XZ9A 1WFVA 4Z8JA 2K1ZA 5HETA 4JOHA 4OEPA 2PKUA 5HJ1A 3ZRTA 3ID3A 5EYZA 2RCZA 1UHPA 2Q9VA 2KJDA 2DJTA 2M0VA 5FB8C 1TP3A 1NTEA 3SHWA 1BFEA 2LC7A 4NNLA 1RGWA 1MC7A 3KZDA 1X5QA 2LC6A 2EAQA 3R69A 2DKRA 1D5GA 4NMQA 2DC2A 2OPGA 1QAVA 3GABA 2V1WA 2IWPA 2PZDA 2CS5A 2HGAA 2R3YA 4PQWA 4JOFA 3LNYA 5GNDA 3NFLA 2JILA 3PV4A 4JJ3A 1TE0A 1OZIA 2YT8A 2AWWA 2G5MB 2EGOA 4Q2PA 1UF1A 1P1EA 4E3BA 3NFKA 4RI0A 1WFGA 1WF8A 1VCWA 2JXOA 1SOZA 1V1TA 5HDYA 5I7ZA 4E35A 4K72A 2JSNA 2KPLA 4K6YA 2ZPLA 4UU5A 1X5RA 2D90A 1U39A 2H3LA 3O5NA 3RL8A 2IWOA 4Q3HA 4XHVA 3OU0A 2P3WA 5E6PB 4Z33A 1V5LA 3GJ9A 2FN5A 2KBSA 2H3MA 1UEPA 2UZCA 1FC9A 2KV8A 4WYUA 2D8IA 3PDZA 1Q7XA 2PKTA 2L4SA 1MFGA 3ID2A 1WHDA 2YUYA 3O46A 2EDVA 3DIWA 1X5NA 3FY5A 1UEWA 2VSVA 2KQFA 2QBWA 2VSPA 2FCFA 1VA8A 2M3MA 3R0HA 2GEFA 2HE4A 1UITA 5HFDA 2PA1A 3KZEA 5F3XA 1N6EA 3ID4A 3SFJA 1FC6A 1X8SA 2KYLA 2Z17A 3GGEA 1G9OA 3BPUA 5G1DA 2I0IA 2EGKA 4Q6HA 5B6LA 1UFXA 2OGPA 5HFEA 1WF7A 2EJYA 4E34A 3I4WA 1NF3C 2FNEA 1X45A 4YDPA 4MPAA 3CH8A 3HPMA 2QKVA 2ENOA 3WKLA 3DORA 2KRGA 4HOPA 1W9QA 5E21A 3ID1A 1MFLA 1UEZA 2EV8A 4JL7A 4WYTA 4LMMA 2EEJA 2PDZA 1L6OA 2KOJA 3CYYA 4OEOA 5IL9A 2EEHA 3CS0A 3GCNA 2DB5A 2MHOA 1TQ3A 3CBZA 5DTHA 4Q6SA 3JXTA 5E22A 1FCFA 1Y7NA 3SOEA 1RY4A 1WG6A 2KL1A 1N6DA 1WIFA 3HPKA 2V90A 5HFBA 1W9EA 4G69A 1N99A 5A2PA 3GDVA 3QIKA 5HFCA 3VQGA 2I0LA 4JJ0A 1X6DA 5HF4A 2QKUA 1IU0A 4UU6A 1IU2A 3QJNA 4KFWA 2LUIA 2F5YA 2KG2A 1WH1A 4JOJA 2I4SA 1U38A 3LNXA 5HFFA 4NXRA 3K50A 2CSSA 4FGMA 4R2ZA 4L8NA 1VB7A 1UJUA 2KOMA 4NMSA 4F8KA 5H3JA 1ZOKA 2L97A 3CC0A 3CBXA 2L4TA 3I18A 4REYA 2REYA 3NGHA 4N6XA 3L4FD 4NMVA 3OTPA 2KA9A 2O2TA 1W9OA 2KPKA 1P1DA 3QGLA 3DJ1A 1KWAA 2RRMA 4JOPA 5D13A 1N6FA 2QG1A 4GVDA 3PV2A 3R68A 3TMHA 2EEIA 4IC6A 2YUBA 3GDSA 3DJ3A 3EGHC 1QLCA 3SHUA 3E17A 3QO6A 2GZVA 4NMPA 4EDJA 1X9ZA 1WI2A 2M0UA 1GQ5A 1QAVB 3QDOA 1Q3OA 2JREA 3VQFA 4O06A 1OBYA 1QAUA 2W7RA 1UM7A 1T2MA 3MH7A 1RGRA 3GDUA 2VRFA 1V62A 1ZUBA 2FE5A 4K75A 3K82A 3PS4A 2MX6A 3MH4A 1BE9A 1YBOA 3NCVA 1PDRA 4GHNA 1UJVA 1UEQA 2F0AA 4GVCA 1IHJA 1I92A 3PV5A 4H11A 1Q3PA 1WHAA 3WKMA 2OS6A 1M5ZA 2R4HA 2VPHA 2OCSA 4Q2NA 4NMOA 4K76A 4JOEA 1OBXA 1I16A 5JXBA 1VJ6A 2HE2A 3RLEA 2KJKA 2EGNA 2QT5A 2G2LA 1KY9A 2DM8A 4NNMA 5HEDA 1Y8TA 2K20A 2QKTA 1U3BA 2KOHA 3TSWA 2DLUA 1VAEA 3MH6A 2W4FA 5E1YA 4Q2QA 4FLNA 3GCOA 3KHFA 3PDVA 1V5QA 2EHRA 4AMHA 4NXPA 3CBYA 2Q3GA 2YT7A 1WI4A 3SUZA 1Z87A 2ZPMA 1WJLA 4NMRA 4JOGA 2H2CA 3EGGC 1V6BA 2YTWA 1N7EA 1TP5A 3KDGA 2EDPA 1Z86A 3DJAA 2DMZA 1GQ4A 2KJPA 1R6JA 5F67A 4JORA 2OZFA 5HF1A 2AINA 2H2BA 2E7KA 4P0CA 2EEGA 4Q2OA 2Z9IA 2WL7A 2X7ZA 3KDKA 2EDZA 5G1EA 1B8QA 2VWRA 3TSZA 2JINA 1UM1A 5GLJA 4K78A 2LA8A 1SOTA 5HEBA 1KEFA 2OSGA 2BYGA 1OBZA 2OMJA 4HOPB 5E11A 4OAJA 1LCYA 1GM1A 2EXGA 2DLSA 4JOKA 4NXQA 2PNTA 2JOAA 1K32A 2AWUA 1N7FA 5EZ0A 1UJDA 3STJA 2M10A 5HEYA 3RL7A 1U37A 3QJMA 2DAZA 2M0ZA 3B76A 4KFVA 2AWXA 4P2AB 2JWEA 2OQSA 2I1NA 3I1EA 4NMTA 2JIKA 3HVQC 5FHTA 5ILBA 2I04A 3GSLA 1N7TA 2I6VA 2IWNA 3K1RA 3TSVA 2LOBA 2M0TA 2IWQA 1RZXA 4YYXA 1FC7A 2KAWA 2CSJA 3QE1A
chains in the Genus database with same CATH topology
5B42A 3AXAA 2D92A 2VZ5A 1XZ9A 1WFVA 4Z8JA 2K1ZA 5HETA 4JOHA 4OEPA 2PKUA 5HJ1A 3ZRTA 3ID3A 5EYZA 2RCZA 1UHPA 2Q9VA 2KJDA 2DJTA 2M0VA 5FB8C 1TP3A 1NTEA 3SHWA 1BFEA 2LC7A 4NNLA 1RGWA 1MC7A 3KZDA 1X5QA 2LC6A 2EAQA 3R69A 2DKRA 1D5GA 4NMQA 2DC2A 2OPGA 1QAVA 3GABA 2V1WA 2IWPA 2PZDA 2CS5A 2HGAA 2R3YA 4PQWA 4JOFA 3LNYA 5GNDA 3NFLA 2JILA 3PV4A 4JJ3A 1TE0A 1OZIA 2YT8A 2AWWA 2G5MB 2EGOA 4Q2PA 1UF1A 1P1EA 4E3BA 3NFKA 4RI0A 1WFGA 1WF8A 1VCWA 2JXOA 1SOZA 1V1TA 5HDYA 5I7ZA 4E35A 4K72A 2JSNA 2KPLA 4K6YA 2ZPLA 4UU5A 1X5RA 2D90A 1U39A 2H3LA 3O5NA 3RL8A 2IWOA 4Q3HA 4XHVA 3OU0A 2P3WA 5E6PB 4Z33A 1V5LA 3GJ9A 2FN5A 2KBSA 2H3MA 1UEPA 2UZCA 1FC9A 2KV8A 4WYUA 2D8IA 3PDZA 1Q7XA 2PKTA 2L4SA 1MFGA 3ID2A 1WHDA 2YUYA 3O46A 2EDVA 3DIWA 1X5NA 3FY5A 1UEWA 2VSVA 2KQFA 2QBWA 2VSPA 2FCFA 1VA8A 2M3MA 3R0HA 2GEFA 2HE4A 1UITA 5HFDA 2PA1A 3KZEA 5F3XA 1N6EA 3ID4A 3SFJA 1FC6A 1X8SA 2KYLA 2Z17A 3GGEA 1G9OA 3BPUA 5G1DA 2I0IA 2EGKA 4Q6HA 5B6LA 1UFXA 2OGPA 5HFEA 1WF7A 2EJYA 4E34A 3I4WA 1NF3C 2FNEA 1X45A 4YDPA 4MPAA 3CH8A 3HPMA 2QKVA 2ENOA 3WKLA 3DORA 2KRGA 4HOPA 1W9QA 5E21A 3ID1A 1MFLA 1UEZA 2EV8A 4JL7A 4WYTA 4LMMA 2EEJA 2PDZA 1L6OA 2KOJA 3CYYA 4OEOA 5IL9A 2EEHA 3CS0A 3GCNA 2DB5A 2MHOA 1TQ3A 3CBZA 5DTHA 4Q6SA 3JXTA 5E22A 1FCFA 1Y7NA 3SOEA 1RY4A 1WG6A 2KL1A 1N6DA 1WIFA 3HPKA 2V90A 5HFBA 1W9EA 4G69A 1N99A 5A2PA 3GDVA 3QIKA 5HFCA 3VQGA 2I0LA 4JJ0A 1X6DA 5HF4A 2QKUA 1IU0A 4UU6A 1IU2A 3QJNA 4KFWA 2LUIA 2F5YA 2KG2A 1WH1A 4JOJA 2I4SA 1U38A 3LNXA 5HFFA 4NXRA 3K50A 2CSSA 4FGMA 4R2ZA 4L8NA 1VB7A 1UJUA 2KOMA 4NMSA 4F8KA 5H3JA 1ZOKA 2L97A 3CC0A 3CBXA 2L4TA 3I18A 4REYA 2REYA 3NGHA 4N6XA 3L4FD 4NMVA 3OTPA 2KA9A 2O2TA 1W9OA 2KPKA 1P1DA 3QGLA 3DJ1A 1KWAA 2RRMA 4JOPA 5D13A 1N6FA 2QG1A 4GVDA 3PV2A 3R68A 3TMHA 2EEIA 4IC6A 2YUBA 3GDSA 3DJ3A 3EGHC 1QLCA 3SHUA 3E17A 3QO6A 2GZVA 4NMPA 4EDJA 1X9ZA 1WI2A 2M0UA 1GQ5A 1QAVB 3QDOA 1Q3OA 2JREA 3VQFA 4O06A 1OBYA 1QAUA 2W7RA 1UM7A 1T2MA 3MH7A 1RGRA 3GDUA 2VRFA 1V62A 1ZUBA 2FE5A 4K75A 3K82A 3PS4A 2MX6A 3MH4A 1BE9A 1YBOA 3NCVA 1PDRA 4GHNA 1UJVA 1UEQA 2F0AA 4GVCA 1IHJA 1I92A 3PV5A 4H11A 1Q3PA 1WHAA 3WKMA 2OS6A 1M5ZA 2R4HA 2VPHA 2OCSA 4Q2NA 4NMOA 4K76A 4JOEA 1OBXA 1I16A 5JXBA 1VJ6A 2HE2A 3RLEA 2KJKA 2EGNA 2QT5A 2G2LA 1KY9A 2DM8A 4NNMA 5HEDA 1Y8TA 2K20A 2QKTA 1U3BA 2KOHA 3TSWA 2DLUA 1VAEA 3MH6A 2W4FA 5E1YA 4Q2QA 4FLNA 3GCOA 3KHFA 3PDVA 1V5QA 2EHRA 4AMHA 4NXPA 3CBYA 2Q3GA 2YT7A 1WI4A 3SUZA 1Z87A 2ZPMA 1WJLA 4NMRA 4JOGA 2H2CA 3EGGC 1V6BA 2YTWA 1N7EA 1TP5A 3KDGA 2EDPA 1Z86A 3DJAA 2DMZA 1GQ4A 2KJPA 1R6JA 5F67A 4JORA 2OZFA 5HF1A 2AINA 2H2BA 2E7KA 4P0CA 2EEGA 4Q2OA 2Z9IA 2WL7A 2X7ZA 3KDKA 2EDZA 5G1EA 1B8QA 2VWRA 3TSZA 2JINA 1UM1A 5GLJA 4K78A 2LA8A 1SOTA 5HEBA 1KEFA 2OSGA 2BYGA 1OBZA 2OMJA 4HOPB 5E11A 4OAJA 1LCYA 1GM1A 2EXGA 2DLSA 4JOKA 4NXQA 2PNTA 2JOAA 1K32A 2AWUA 1N7FA 5EZ0A 1UJDA 3STJA 2M10A 5HEYA 3RL7A 1U37A 3QJMA 2DAZA 2M0ZA 3B76A 4KFVA 2AWXA 4P2AB 2JWEA 2OQSA 2I1NA 3I1EA 4NMTA 2JIKA 3HVQC 5FHTA 5ILBA 2I04A 3GSLA 1N7TA 2I6VA 2IWNA 3K1RA 3TSVA 2LOBA 2M0TA 2IWQA 1RZXA 4YYXA 1FC7A 2KAWA 2CSJA 3QE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AXA A;  2D92 A;  2VZ5 A;  1XZ9 A;  1WFV A;  4Z8J A;  2K1Z A;  5HET A;  4JOH A;  4OEP A;  2PKU A;  5HJ1 A;  3ZRT A;  3ID3 A;  5EYZ A;  2RCZ A;  1UHP A;  2Q9V A;  2KJD A;  2DJT A;  2M0V A;  5FB8 C;  1TP3 A;  1NTE A;  3SHW A;  1BFE A;  2LC7 A;  4NNL A;  1RGW A;  1MC7 A;  3KZD A;  1X5Q A;  2LC6 A;  2EAQ A;  3R69 A;  2DKR A;  1D5G A;  4NMQ A;  2DC2 A;  2OPG A;  1QAV A;  2V1W A;  2IWP A;  2PZD A;  2CS5 A;  2HGA A;  2R3Y A;  4PQW A;  4JOF A;  3LNY A;  5GND A;  3NFL A;  2JIL A;  3PV4 A;  1TE0 A;  1OZI A;  2YT8 A;  2AWW A;  2G5M B;  2EGO A;  4Q2P A;  1UF1 A;  1P1E A;  4E3B A;  3NFK A;  4RI0 A;  1WFG A;  1WF8 A;  1VCW A;  2JXO A;  1SOZ A;  1V1T A;  5HDY A;  5I7Z A;  4E35 A;  4K72 A;  2KPL A;  4K6Y A;  2ZPL A;  4UU5 A;  1X5R A;  2D90 A;  1U39 A;  2H3L A;  3O5N A;  3RL8 A;  2IWO A;  4Q3H A;  4XHV A;  3OU0 A;  2P3W A;  5E6P B;  4Z33 A;  1V5L A;  3GJ9 A;  2FN5 A;  2KBS A;  2H3M A;  1UEP A;  2UZC A;  1FC9 A;  2KV8 A;  4WYU A;  2D8I A;  3PDZ A;  1Q7X A;  2PKT A;  2L4S A;  1MFG A;  3ID2 A;  1WHD A;  2YUY A;  3O46 A;  2EDV A;  3DIW A;  1X5N A;  3FY5 A;  1UEW A;  2VSV A;  2KQF A;  2QBW A;  2VSP A;  2FCF A;  1VA8 A;  2M3M A;  3R0H A;  2HE4 A;  1UIT A;  5HFD A;  2PA1 A;  3KZE A;  5F3X A;  1N6E A;  3ID4 A;  3SFJ A;  1FC6 A;  1X8S A;  2KYL A;  2Z17 A;  3GGE A;  1G9O A;  3BPU A;  5G1D A;  2I0I A;  2EGK A;  4Q6H A;  5B6L A;  1UFX A;  2OGP A;  5HFE A;  1WF7 A;  2EJY A;  4E34 A;  3I4W A;  1NF3 C;  2FNE A;  1X45 A;  4YDP A;  4MPA A;  3CH8 A;  3HPM A;  2QKV A;  2ENO A;  3WKL A;  3DOR A;  2KRG A;  4HOP A;  1W9Q A;  5E21 A;  3ID1 A;  1MFL A;  1UEZ A;  2EV8 A;  4JL7 A;  4WYT A;  4LMM A;  2EEJ A;  2PDZ A;  1L6O A;  2KOJ A;  3CYY A;  4OEO A;  2EEH A;  3CS0 A;  3GCN A;  2DB5 A;  2MHO A;  1TQ3 A;  3CBZ A;  5DTH A;  4Q6S A;  3JXT A;  5E22 A;  1FCF A;  1Y7N A;  3SOE A;  1RY4 A;  1WG6 A;  2KL1 A;  1N6D A;  1WIF A;  3HPK A;  2V90 A;  5HFB A;  1W9E A;  4G69 A;  1N99 A;  5A2P A;  3GDV A;  3QIK A;  5HFC A;  3VQG A;  2I0L A;  1X6D A;  5HF4 A;  2QKU A;  1IU0 A;  4UU6 A;  1IU2 A;  3QJN A;  4KFW A;  2LUI A;  2F5Y A;  2KG2 A;  1WH1 A;  4JOJ A;  2I4S A;  1U38 A;  3LNX A;  5HFF A;  4NXR A;  3K50 A;  2CSS A;  4FGM A;  4R2Z A;  4L8N A;  1VB7 A;  1UJU A;  2KOM A;  4NMS A;  4F8K A;  5H3J A;  1ZOK A;  2L97 A;  3CC0 A;  3CBX A;  2L4T A;  3I18 A;  4REY A;  2REY A;  3NGH A;  4N6X A;  3L4F D;  4NMV A;  3OTP A;  2KA9 A;  2O2T A;  1W9O A;  2KPK A;  1P1D A;  3QGL A;  3DJ1 A;  1KWA A;  2RRM A;  4JOP A;  5D13 A;  1N6F A;  2QG1 A;  4GVD A;  3PV2 A;  3R68 A;  3TMH A;  2EEI A;  4IC6 A;  2YUB A;  3GDS A;  3DJ3 A;  3EGH C;  1QLC A;  3SHU A;  3E17 A;  3QO6 A;  2GZV A;  4NMP A;  4EDJ A;  1WI2 A;  2M0U A;  1GQ5 A;  1QAV B;  3QDO A;  1Q3O A;  2JRE A;  3VQF A;  4O06 A;  1OBY A;  1QAU A;  2W7R A;  1UM7 A;  1T2M A;  3MH7 A;  1RGR A;  3GDU A;  2VRF A;  1V62 A;  1ZUB A;  2FE5 A;  4K75 A;  3K82 A;  3PS4 A;  2MX6 A;  3MH4 A;  1BE9 A;  1YBO A;  1PDR A;  4GHN A;  1UJV A;  1UEQ A;  2F0A A;  4GVC A;  1IHJ A;  1I92 A;  3PV5 A;  4H11 A;  1Q3P A;  1WHA A;  3WKM A;  2OS6 A;  1M5Z A;  2R4H A;  2VPH A;  2OCS A;  4Q2N A;  4NMO A;  4K76 A;  4JOE A;  1OBX A;  1I16 A;  5JXB A;  1VJ6 A;  2HE2 A;  3RLE A;  2KJK A;  2EGN A;  2QT5 A;  2G2L A;  1KY9 A;  2DM8 A;  4NNM A;  5HED A;  1Y8T A;  2K20 A;  2QKT A;  1U3B A;  2KOH A;  3TSW A;  2DLU A;  1VAE A;  3MH6 A;  2W4F A;  5E1Y A;  4Q2Q A;  3GCO A;  3KHF A;  3PDV A;  1V5Q A;  2EHR A;  4AMH A;  4NXP A;  3CBY A;  2Q3G A;  2YT7 A;  1WI4 A;  3SUZ A;  1Z87 A;  2ZPM A;  1WJL A;  4NMR A;  4JOG A;  2H2C A;  3EGG C;  1V6B A;  2YTW A;  1N7E A;  1TP5 A;  2EDP A;  1Z86 A;  3DJA A;  2DMZ A;  1GQ4 A;  2KJP A;  1R6J A;  5F67 A;  4JOR A;  2OZF A;  5HF1 A;  2AIN A;  2H2B A;  2E7K A;  4P0C A;  2EEG A;  4Q2O A;  2Z9I A;  2WL7 A;  2X7Z A;  2EDZ A;  5G1E A;  1B8Q A;  2VWR A;  3TSZ A;  2JIN A;  1UM1 A;  5GLJ A;  4K78 A;  2LA8 A;  1SOT A;  5HEB A;  1KEF A;  2OSG A;  2BYG A;  1OBZ A;  2OMJ A;  4HOP B;  5E11 A;  4OAJ A;  1LCY A;  1GM1 A;  2EXG A;  2DLS A;  4JOK A;  4NXQ A;  2PNT A;  2JOA A;  1K32 A;  2AWU A;  1N7F A;  5EZ0 A;  1UJD A;  3STJ A;  2M10 A;  5HEY A;  3RL7 A;  1U37 A;  3QJM A;  2DAZ A;  2M0Z A;  3B76 A;  4KFV A;  2AWX A;  4P2A B;  2JWE A;  2OQS A;  2I1N A;  3I1E A;  4NMT A;  2JIK A;  3HVQ C;  5FHT A;  2I04 A;  3GSL A;  1N7T A;  2I6V A;  2IWN A;  3K1R A;  3TSV A;  2LOB A;  2M0T A;  2IWQ A;  1RZX A;  4YYX A;  1FC7 A;  2KAW A;  2CSJ A;  3QE1 A; 
#chains in the Genus database with same CATH topology
 5B42 A;  3AXA A;  2D92 A;  2VZ5 A;  1XZ9 A;  1WFV A;  4Z8J A;  2K1Z A;  5HET A;  4JOH A;  4OEP A;  2PKU A;  5HJ1 A;  3ZRT A;  3ID3 A;  5EYZ A;  2RCZ A;  1UHP A;  2Q9V A;  2KJD A;  2DJT A;  2M0V A;  5FB8 C;  1TP3 A;  1NTE A;  3SHW A;  1BFE A;  2LC7 A;  4NNL A;  1RGW A;  1MC7 A;  3KZD A;  1X5Q A;  2LC6 A;  2EAQ A;  3R69 A;  2DKR A;  1D5G A;  4NMQ A;  2DC2 A;  2OPG A;  1QAV A;  3GAB A;  2V1W A;  2IWP A;  2PZD A;  2CS5 A;  2HGA A;  2R3Y A;  4PQW A;  4JOF A;  3LNY A;  5GND A;  3NFL A;  2JIL A;  3PV4 A;  4JJ3 A;  1TE0 A;  1OZI A;  2YT8 A;  2AWW A;  2G5M B;  2EGO A;  4Q2P A;  1UF1 A;  1P1E A;  4E3B A;  3NFK A;  4RI0 A;  1WFG A;  1WF8 A;  1VCW A;  2JXO A;  1SOZ A;  1V1T A;  5HDY A;  5I7Z A;  4E35 A;  4K72 A;  2JSN A;  2KPL A;  4K6Y A;  2ZPL A;  4UU5 A;  1X5R A;  2D90 A;  1U39 A;  2H3L A;  3O5N A;  3RL8 A;  2IWO A;  4Q3H A;  4XHV A;  3OU0 A;  2P3W A;  5E6P B;  4Z33 A;  1V5L A;  3GJ9 A;  2FN5 A;  2KBS A;  2H3M A;  1UEP A;  2UZC A;  1FC9 A;  2KV8 A;  4WYU A;  2D8I A;  3PDZ A;  1Q7X A;  2PKT A;  2L4S A;  1MFG A;  3ID2 A;  1WHD A;  2YUY A;  3O46 A;  2EDV A;  3DIW A;  1X5N A;  3FY5 A;  1UEW A;  2VSV A;  2KQF A;  2QBW A;  2VSP A;  2FCF A;  1VA8 A;  2M3M A;  3R0H A;  2GEF A;  2HE4 A;  1UIT A;  5HFD A;  2PA1 A;  3KZE A;  5F3X A;  1N6E A;  3ID4 A;  3SFJ A;  1FC6 A;  1X8S A;  2KYL A;  2Z17 A;  3GGE A;  1G9O A;  3BPU A;  5G1D A;  2I0I A;  2EGK A;  4Q6H A;  5B6L A;  1UFX A;  2OGP A;  5HFE A;  1WF7 A;  2EJY A;  4E34 A;  3I4W A;  1NF3 C;  2FNE A;  1X45 A;  4YDP A;  4MPA A;  3CH8 A;  3HPM A;  2QKV A;  2ENO A;  3WKL A;  3DOR A;  2KRG A;  4HOP A;  1W9Q A;  5E21 A;  3ID1 A;  1MFL A;  1UEZ A;  2EV8 A;  4JL7 A;  4WYT A;  4LMM A;  2EEJ A;  2PDZ A;  1L6O A;  2KOJ A;  3CYY A;  4OEO A;  5IL9 A;  2EEH A;  3CS0 A;  3GCN A;  2DB5 A;  2MHO A;  1TQ3 A;  3CBZ A;  5DTH A;  4Q6S A;  3JXT A;  5E22 A;  1FCF A;  1Y7N A;  3SOE A;  1RY4 A;  1WG6 A;  2KL1 A;  1N6D A;  1WIF A;  3HPK A;  2V90 A;  5HFB A;  1W9E A;  4G69 A;  1N99 A;  5A2P A;  3GDV A;  3QIK A;  5HFC A;  3VQG A;  2I0L A;  4JJ0 A;  1X6D A;  5HF4 A;  2QKU A;  1IU0 A;  4UU6 A;  1IU2 A;  3QJN A;  4KFW A;  2LUI A;  2F5Y A;  2KG2 A;  1WH1 A;  4JOJ A;  2I4S A;  1U38 A;  3LNX A;  5HFF A;  4NXR A;  3K50 A;  2CSS A;  4FGM A;  4R2Z A;  4L8N A;  1VB7 A;  1UJU A;  2KOM A;  4NMS A;  4F8K A;  5H3J A;  1ZOK A;  2L97 A;  3CC0 A;  3CBX A;  2L4T A;  3I18 A;  4REY A;  2REY A;  3NGH A;  4N6X A;  3L4F D;  4NMV A;  3OTP A;  2KA9 A;  2O2T A;  1W9O A;  2KPK A;  1P1D A;  3QGL A;  3DJ1 A;  1KWA A;  2RRM A;  4JOP A;  5D13 A;  1N6F A;  2QG1 A;  4GVD A;  3PV2 A;  3R68 A;  3TMH A;  2EEI A;  4IC6 A;  2YUB A;  3GDS A;  3DJ3 A;  3EGH C;  1QLC A;  3SHU A;  3E17 A;  3QO6 A;  2GZV A;  4NMP A;  4EDJ A;  1X9Z A;  1WI2 A;  2M0U A;  1GQ5 A;  1QAV B;  3QDO A;  1Q3O A;  2JRE A;  3VQF A;  4O06 A;  1OBY A;  1QAU A;  2W7R A;  1UM7 A;  1T2M A;  3MH7 A;  1RGR A;  3GDU A;  2VRF A;  1V62 A;  1ZUB A;  2FE5 A;  4K75 A;  3K82 A;  3PS4 A;  2MX6 A;  3MH4 A;  1BE9 A;  1YBO A;  3NCV A;  1PDR A;  4GHN A;  1UJV A;  1UEQ A;  2F0A A;  4GVC A;  1IHJ A;  1I92 A;  3PV5 A;  4H11 A;  1Q3P A;  1WHA A;  3WKM A;  2OS6 A;  1M5Z A;  2R4H A;  2VPH A;  2OCS A;  4Q2N A;  4NMO A;  4K76 A;  4JOE A;  1OBX A;  1I16 A;  5JXB A;  1VJ6 A;  2HE2 A;  3RLE A;  2KJK A;  2EGN A;  2QT5 A;  2G2L A;  1KY9 A;  2DM8 A;  4NNM A;  5HED A;  1Y8T A;  2K20 A;  2QKT A;  1U3B A;  2KOH A;  3TSW A;  2DLU A;  1VAE A;  3MH6 A;  2W4F A;  5E1Y A;  4Q2Q A;  4FLN A;  3GCO A;  3KHF A;  3PDV A;  1V5Q A;  2EHR A;  4AMH A;  4NXP A;  3CBY A;  2Q3G A;  2YT7 A;  1WI4 A;  3SUZ A;  1Z87 A;  2ZPM A;  1WJL A;  4NMR A;  4JOG A;  2H2C A;  3EGG C;  1V6B A;  2YTW A;  1N7E A;  1TP5 A;  3KDG A;  2EDP A;  1Z86 A;  3DJA A;  2DMZ A;  1GQ4 A;  2KJP A;  1R6J A;  5F67 A;  4JOR A;  2OZF A;  5HF1 A;  2AIN A;  2H2B A;  2E7K A;  4P0C A;  2EEG A;  4Q2O A;  2Z9I A;  2WL7 A;  2X7Z A;  3KDK A;  2EDZ A;  5G1E A;  1B8Q A;  2VWR A;  3TSZ A;  2JIN A;  1UM1 A;  5GLJ A;  4K78 A;  2LA8 A;  1SOT A;  5HEB A;  1KEF A;  2OSG A;  2BYG A;  1OBZ A;  2OMJ A;  4HOP B;  5E11 A;  4OAJ A;  1LCY A;  1GM1 A;  2EXG A;  2DLS A;  4JOK A;  4NXQ A;  2PNT A;  2JOA A;  1K32 A;  2AWU A;  1N7F A;  5EZ0 A;  1UJD A;  3STJ A;  2M10 A;  5HEY A;  3RL7 A;  1U37 A;  3QJM A;  2DAZ A;  2M0Z A;  3B76 A;  4KFV A;  2AWX A;  4P2A B;  2JWE A;  2OQS A;  2I1N A;  3I1E A;  4NMT A;  2JIK A;  3HVQ C;  5FHT A;  5ILB A;  2I04 A;  3GSL A;  1N7T A;  2I6V A;  2IWN A;  3K1R A;  3TSV A;  2LOB A;  2M0T A;  2IWQ A;  1RZX A;  4YYX A;  1FC7 A;  2KAW A;  2CSJ A;  3QE1 A; 
#chains in the Genus database with same CATH homology
 5B42 A;  3AXA A;  2D92 A;  2VZ5 A;  1XZ9 A;  1WFV A;  4Z8J A;  2K1Z A;  5HET A;  4JOH A;  4OEP A;  2PKU A;  5HJ1 A;  3ZRT A;  3ID3 A;  5EYZ A;  2RCZ A;  1UHP A;  2Q9V A;  2KJD A;  2DJT A;  2M0V A;  5FB8 C;  1TP3 A;  1NTE A;  3SHW A;  1BFE A;  2LC7 A;  4NNL A;  1RGW A;  1MC7 A;  3KZD A;  1X5Q A;  2LC6 A;  2EAQ A;  3R69 A;  2DKR A;  1D5G A;  4NMQ A;  2DC2 A;  2OPG A;  1QAV A;  3GAB A;  2V1W A;  2IWP A;  2PZD A;  2CS5 A;  2HGA A;  2R3Y A;  4PQW A;  4JOF A;  3LNY A;  5GND A;  3NFL A;  2JIL A;  3PV4 A;  4JJ3 A;  1TE0 A;  1OZI A;  2YT8 A;  2AWW A;  2G5M B;  2EGO A;  4Q2P A;  1UF1 A;  1P1E A;  4E3B A;  3NFK A;  4RI0 A;  1WFG A;  1WF8 A;  1VCW A;  2JXO A;  1SOZ A;  1V1T A;  5HDY A;  5I7Z A;  4E35 A;  4K72 A;  2JSN A;  2KPL A;  4K6Y A;  2ZPL A;  4UU5 A;  1X5R A;  2D90 A;  1U39 A;  2H3L A;  3O5N A;  3RL8 A;  2IWO A;  4Q3H A;  4XHV A;  3OU0 A;  2P3W A;  5E6P B;  4Z33 A;  1V5L A;  3GJ9 A;  2FN5 A;  2KBS A;  2H3M A;  1UEP A;  2UZC A;  1FC9 A;  2KV8 A;  4WYU A;  2D8I A;  3PDZ A;  1Q7X A;  2PKT A;  2L4S A;  1MFG A;  3ID2 A;  1WHD A;  2YUY A;  3O46 A;  2EDV A;  3DIW A;  1X5N A;  3FY5 A;  1UEW A;  2VSV A;  2KQF A;  2QBW A;  2VSP A;  2FCF A;  1VA8 A;  2M3M A;  3R0H A;  2GEF A;  2HE4 A;  1UIT A;  5HFD A;  2PA1 A;  3KZE A;  5F3X A;  1N6E A;  3ID4 A;  3SFJ A;  1FC6 A;  1X8S A;  2KYL A;  2Z17 A;  3GGE A;  1G9O A;  3BPU A;  5G1D A;  2I0I A;  2EGK A;  4Q6H A;  5B6L A;  1UFX A;  2OGP A;  5HFE A;  1WF7 A;  2EJY A;  4E34 A;  3I4W A;  1NF3 C;  2FNE A;  1X45 A;  4YDP A;  4MPA A;  3CH8 A;  3HPM A;  2QKV A;  2ENO A;  3WKL A;  3DOR A;  2KRG A;  4HOP A;  1W9Q A;  5E21 A;  3ID1 A;  1MFL A;  1UEZ A;  2EV8 A;  4JL7 A;  4WYT A;  4LMM A;  2EEJ A;  2PDZ A;  1L6O A;  2KOJ A;  3CYY A;  4OEO A;  5IL9 A;  2EEH A;  3CS0 A;  3GCN A;  2DB5 A;  2MHO A;  1TQ3 A;  3CBZ A;  5DTH A;  4Q6S A;  3JXT A;  5E22 A;  1FCF A;  1Y7N A;  3SOE A;  1RY4 A;  1WG6 A;  2KL1 A;  1N6D A;  1WIF A;  3HPK A;  2V90 A;  5HFB A;  1W9E A;  4G69 A;  1N99 A;  5A2P A;  3GDV A;  3QIK A;  5HFC A;  3VQG A;  2I0L A;  4JJ0 A;  1X6D A;  5HF4 A;  2QKU A;  1IU0 A;  4UU6 A;  1IU2 A;  3QJN A;  4KFW A;  2LUI A;  2F5Y A;  2KG2 A;  1WH1 A;  4JOJ A;  2I4S A;  1U38 A;  3LNX A;  5HFF A;  4NXR A;  3K50 A;  2CSS A;  4FGM A;  4R2Z A;  4L8N A;  1VB7 A;  1UJU A;  2KOM A;  4NMS A;  4F8K A;  5H3J A;  1ZOK A;  2L97 A;  3CC0 A;  3CBX A;  2L4T A;  3I18 A;  4REY A;  2REY A;  3NGH A;  4N6X A;  3L4F D;  4NMV A;  3OTP A;  2KA9 A;  2O2T A;  1W9O A;  2KPK A;  1P1D A;  3QGL A;  3DJ1 A;  1KWA A;  2RRM A;  4JOP A;  5D13 A;  1N6F A;  2QG1 A;  4GVD A;  3PV2 A;  3R68 A;  3TMH A;  2EEI A;  4IC6 A;  2YUB A;  3GDS A;  3DJ3 A;  3EGH C;  1QLC A;  3SHU A;  3E17 A;  3QO6 A;  2GZV A;  4NMP A;  4EDJ A;  1X9Z A;  1WI2 A;  2M0U A;  1GQ5 A;  1QAV B;  3QDO A;  1Q3O A;  2JRE A;  3VQF A;  4O06 A;  1OBY A;  1QAU A;  2W7R A;  1UM7 A;  1T2M A;  3MH7 A;  1RGR A;  3GDU A;  2VRF A;  1V62 A;  1ZUB A;  2FE5 A;  4K75 A;  3K82 A;  3PS4 A;  2MX6 A;  3MH4 A;  1BE9 A;  1YBO A;  3NCV A;  1PDR A;  4GHN A;  1UJV A;  1UEQ A;  2F0A A;  4GVC A;  1IHJ A;  1I92 A;  3PV5 A;  4H11 A;  1Q3P A;  1WHA A;  3WKM A;  2OS6 A;  1M5Z A;  2R4H A;  2VPH A;  2OCS A;  4Q2N A;  4NMO A;  4K76 A;  4JOE A;  1OBX A;  1I16 A;  5JXB A;  1VJ6 A;  2HE2 A;  3RLE A;  2KJK A;  2EGN A;  2QT5 A;  2G2L A;  1KY9 A;  2DM8 A;  4NNM A;  5HED A;  1Y8T A;  2K20 A;  2QKT A;  1U3B A;  2KOH A;  3TSW A;  2DLU A;  1VAE A;  3MH6 A;  2W4F A;  5E1Y A;  4Q2Q A;  4FLN A;  3GCO A;  3KHF A;  3PDV A;  1V5Q A;  2EHR A;  4AMH A;  4NXP A;  3CBY A;  2Q3G A;  2YT7 A;  1WI4 A;  3SUZ A;  1Z87 A;  2ZPM A;  1WJL A;  4NMR A;  4JOG A;  2H2C A;  3EGG C;  1V6B A;  2YTW A;  1N7E A;  1TP5 A;  3KDG A;  2EDP A;  1Z86 A;  3DJA A;  2DMZ A;  1GQ4 A;  2KJP A;  1R6J A;  5F67 A;  4JOR A;  2OZF A;  5HF1 A;  2AIN A;  2H2B A;  2E7K A;  4P0C A;  2EEG A;  4Q2O A;  2Z9I A;  2WL7 A;  2X7Z A;  3KDK A;  2EDZ A;  5G1E A;  1B8Q A;  2VWR A;  3TSZ A;  2JIN A;  1UM1 A;  5GLJ A;  4K78 A;  2LA8 A;  1SOT A;  5HEB A;  1KEF A;  2OSG A;  2BYG A;  1OBZ A;  2OMJ A;  4HOP B;  5E11 A;  4OAJ A;  1LCY A;  1GM1 A;  2EXG A;  2DLS A;  4JOK A;  4NXQ A;  2PNT A;  2JOA A;  1K32 A;  2AWU A;  1N7F A;  5EZ0 A;  1UJD A;  3STJ A;  2M10 A;  5HEY A;  3RL7 A;  1U37 A;  3QJM A;  2DAZ A;  2M0Z A;  3B76 A;  4KFV A;  2AWX A;  4P2A B;  2JWE A;  2OQS A;  2I1N A;  3I1E A;  4NMT A;  2JIK A;  3HVQ C;  5FHT A;  5ILB A;  2I04 A;  3GSL A;  1N7T A;  2I6V A;  2IWN A;  3K1R A;  3TSV A;  2LOB A;  2M0T A;  2IWQ A;  1RZX A;  4YYX A;  1FC7 A;  2KAW A;  2CSJ A;  3QE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...