4OEOA

High resolution crystal structure of the unliganded zo-1 pdz1 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
MIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1
publication title Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 22
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4oeoA00
2L4SA 3GCOA 4NMTA 4NMOA 1OBXA 4JOHA 1UJUA 5E22A 1UITA 2M0VA 4NMRA 2PDZA 1QLCA 2ZPMA 3HPKA 1Z86A 1NTEA 4JL7A 4GVDA 1OBYA 4HOPA 1ZOKA 1UF1A 3CYYA 1N99A 5HFEA 2ZPLA 2KV8A 2KA9A 3QGLA 2VPHA 2IWOA 2WL7A 5FB8C 2EGOA 5DTHA 3QIKA 2YT7A 4OEPA 5H3JA 2EDZA 5I7ZA 3GDVA 4NMPA 3CC0A 3DJ1A 1R6JA 1WFVA 5HETA 3TMHA 2UZCA 2R4HA 1WI4A 2VZ5A 2JXOA 1U37A 3CS0A 3DJ3A 3RLEA 3QO6A 1YBOA 3RL7A 1V62A 4Z33A 1K32A 2K1ZA 2KAWA 3CBYA 2YUBA 1M5ZA 1WJLA 4REYA 3CBZA 2JIKA 2H2CA 3ZRTA 2Z17A 2O2TA 1UJDA 2DMZA 1UJVA 5HFCA 2FE5A 1LCYA 1GM1A 2KL1A 4KFWA 3OU0A 5HEYA 1RZXA 2AWWA 2H3MA 4P2AB 5GNDA 2PKUA 3SOEA 3BPUA 2OZFA 1V5LA 1IU0A 4JOPA 4XHVA 4Q2QA 3AXAA 2OMJA 2W7RA 1T2MA 2M10A 1UEQA 3TSZA 2ENOA 3ID2A 2D92A 2HE2A 2VSPA 2GZVA 2PNTA 2D90A 5HF4A 2DKRA 2EJYA 2JWEA 2AINA 1QAVB 2DJTA 1MFLA 1WF8A 2EEHA 3OTPA 1UM7A 3K82A 2EEGA 1KEFA 1BE9A 2QKTA 4NMVA 3TSWA 1V1TA 2AWXA 5E6PB 4AMHA 4Q6SA 1VA8A 5A2PA 5G1EA 2EEIA 2V90A 2QKUA 3GCNA 4Q2OA 3CBXA 4L8NA 3O46A 4NMQA 2MHOA 1WG6A 2JINA 3ID1A 2DAZA 5JXBA 2M3MA 1TE0A 5HFDA 2H3LA 4IC6A 4EDJA 2KOHA 1N7TA 5B6LA 4E35A 4Q2NA 4E3BA 4YYXA 4Q2PA 1TP5A 4NXQA 4PQWA 3L4FD 2FN5A 1MC7A 1W9QA 2EHRA 4G69A 3E17A 1UEPA 1RY4A 2FNEA 5G1DA 2MX6A 1FCFA 2L97A 2DLUA 3WKMA 2KG2A 3GJ9A 2LC7A 5HJ1A 3VQGA 5E11A 1VJ6A 5EZ0A 1U39A 2OSGA 2IWQA 5HDYA 2KRGA 1I92A 3CH8A 2OS6A 3SFJA 4Q6HA 2AWUA 3PV4A 4RI0A 2G2LA 3HPMA 2G5MB 3B76A 1WF7A 2QT5A 3NFLA 4YDPA 3GGEA 4WYUA 1GQ5A 4P0CA 3ID4A 1MFGA 1SOTA 1W9EA 2LA8A 2EDPA 2DLSA 2R3YA 2DM8A 3TSVA 2YUYA 2HE4A 2KPKA 4JOEA 2I1NA 4Z8JA 3K1RA 2M0UA 3GDSA 4NMSA 4K6YA 2QBWA 1WH1A 2HGAA 4KFVA 2KJPA 1VAEA 2I4SA 2X7ZA 1V5QA 2M0ZA 1WHDA 2DB5A 1TQ3A 1XZ9A 2OGPA 3QJMA 4OAJA 2F5YA 4NXRA 3I4WA 5GLJA 2CSSA 2LUIA 2YTWA 1X5QA 1X5NA 1L6OA 3DJAA 2I04A 2OPGA 3MH4A 4FGMA 5HFFA 2EV8A 5F67A 1X5RA 2REYA 3EGHC 4JOGA 4Q3HA 2EXGA 4N6XA 3MH7A 3VQFA 1UEWA 2F0AA 1B8QA 2RCZA 1Q7XA 1ZUBA 2OCSA 4NNLA 2EAQA 1N6FA 2KBSA 1QAUA 1FC9A 3MH6A 5FHTA 1P1DA 5D13A 2PZDA 5E21A 1Y7NA 1OBZA 2OQSA 2JILA 1Q3PA 1P1EA 3LNYA 4NXPA 2I0LA 5HEBA 5F3XA 3KZEA 1UEZA 3ID3A 4GHNA 2PKTA 2KOJA 1N7EA 3R0HA 2JOAA 1WIFA 4F8KA 2PA1A 1OZIA 2EEJA 3GDUA 2JREA 3PV2A 3DORA 2D8IA 2L4TA 3R69A 1TP3A 3DIWA 2KYLA 4K76A 3NFKA 2KOMA 3GSLA 1U38A 2QG1A 3WKLA 3PDZA 1Z87A 3SHUA 4R2ZA 1X45A 4E34A 2I0IA 3KHFA 4K75A 2M0TA 1PDRA 3I1EA 4NNMA 3SHWA 2EDVA 1KY9A 2KPLA 1GQ4A 5HFBA 1IU2A 2KJDA 2IWPA 1UM1A 2K20A 1Q3OA 1N6EA 2KJKA 2EGKA 1I16A 2YT8A 1QAVA 4JORA 1X8SA 1BFEA 2KQFA 1UFXA 2BYGA 2Q9VA 1NF3C 5HEDA 1FC6A 3K50A 4K72A 1WI2A 5HF1A 1U3BA 2Q3GA 3HVQC 3PS4A 3STJA 1N6DA 2LC6A 4UU6A 1KWAA 4LMMA 4HOPB 3QDOA 4H11A 2CSJA 3JXTA 1VB7A 2FCFA 3RL8A 1VCWA 2CS5A 2VWRA 2VRFA 3O5NA 1G9OA 4K78A 3KZDA 5EYZA 3R68A 1V6BA 4JOFA 1X6DA 4MPAA 2RRMA 1IHJA 1WHAA 3EGGC 3FY5A 4OEOA 4WYTA 3SUZA 3QE1A 3I18A 2P3WA 1FC7A 1RGWA 2H2BA 3LNXA 1RGRA 2W4FA 1D5GA 2EGNA 2E7KA 2DC2A 4JOKA 1SOZA 1UHPA 2VSVA 1Y8TA 4UU5A 1W9OA 2LOBA 4JOJA 3PV5A 5E1YA 1N7FA 3QJNA 4O06A 3NGHA 4GVCA 2Z9IA 2QKVA 2V1WA 3PDVA 2IWNA 1WFGA 2I6VA
chains in the Genus database with same CATH superfamily
2L4SA 3GCOA 4NMTA 4NMOA 4JJ3A 1OBXA 4JOHA 1UJUA 5E22A 1UITA 2M0VA 4NMRA 2PDZA 1QLCA 2ZPMA 3HPKA 1Z86A 1NTEA 4JL7A 4GVDA 1OBYA 4HOPA 1ZOKA 1UF1A 3CYYA 1N99A 5HFEA 2ZPLA 2KV8A 2KA9A 3QGLA 2VPHA 2IWOA 2WL7A 5FB8C 2EGOA 5DTHA 3QIKA 2YT7A 4OEPA 5H3JA 2EDZA 5I7ZA 3GDVA 4NMPA 3KDKA 3CC0A 3DJ1A 1R6JA 1WFVA 5HETA 3TMHA 2UZCA 2R4HA 1WI4A 2VZ5A 2JXOA 5B42A 1U37A 3CS0A 3DJ3A 3RLEA 3QO6A 1YBOA 3RL7A 1V62A 4Z33A 1K32A 2K1ZA 2KAWA 3CBYA 2YUBA 1M5ZA 1WJLA 4REYA 3CBZA 2JIKA 2H2CA 3ZRTA 2Z17A 2O2TA 1UJDA 2DMZA 1UJVA 5HFCA 2FE5A 1LCYA 1GM1A 2KL1A 4KFWA 3OU0A 5HEYA 1RZXA 2AWWA 2H3MA 4P2AB 5GNDA 2PKUA 3SOEA 3BPUA 2OZFA 1V5LA 1IU0A 4JOPA 4XHVA 4Q2QA 3AXAA 2OMJA 2W7RA 1T2MA 2M10A 1UEQA 3TSZA 2ENOA 3ID2A 3GABA 2D92A 2HE2A 2VSPA 2GZVA 2PNTA 2D90A 5HF4A 2DKRA 2EJYA 2JWEA 2AINA 1QAVB 2DJTA 1MFLA 1WF8A 2EEHA 3OTPA 1UM7A 3K82A 2EEGA 1KEFA 1BE9A 2QKTA 4NMVA 3TSWA 1V1TA 2AWXA 5E6PB 4AMHA 4Q6SA 1VA8A 5A2PA 5G1EA 2EEIA 2V90A 2QKUA 3GCNA 4Q2OA 3CBXA 4L8NA 3O46A 4NMQA 2MHOA 1WG6A 2JINA 3ID1A 2DAZA 5JXBA 2M3MA 1TE0A 5HFDA 2H3LA 4IC6A 4EDJA 2KOHA 1N7TA 5B6LA 4E35A 4Q2NA 4E3BA 4YYXA 4Q2PA 1TP5A 4NXQA 4PQWA 3L4FD 2FN5A 1MC7A 1W9QA 2EHRA 4G69A 3E17A 1UEPA 1RY4A 2FNEA 5G1DA 2MX6A 1FCFA 2L97A 2DLUA 3WKMA 2KG2A 3GJ9A 2LC7A 5HJ1A 3VQGA 5E11A 1VJ6A 4JJ0A 5EZ0A 1U39A 2OSGA 2IWQA 5HDYA 2KRGA 1I92A 3CH8A 2OS6A 3SFJA 4Q6HA 2AWUA 3PV4A 4RI0A 2G2LA 5IL9A 3HPMA 2G5MB 3B76A 5ILBA 1WF7A 2JSNA 2QT5A 3NFLA 4YDPA 3GGEA 4WYUA 1GQ5A 4P0CA 3ID4A 1MFGA 1SOTA 1W9EA 2LA8A 2EDPA 2DLSA 2R3YA 2DM8A 3TSVA 2YUYA 2HE4A 2KPKA 4JOEA 3NCVA 2I1NA 4Z8JA 3K1RA 2M0UA 3GDSA 4NMSA 4K6YA 2QBWA 1WH1A 2HGAA 4KFVA 2KJPA 1VAEA 2I4SA 2X7ZA 3KDGA 1V5QA 2M0ZA 1WHDA 2DB5A 1TQ3A 1XZ9A 2OGPA 3QJMA 4OAJA 2GEFA 2F5YA 4NXRA 3I4WA 5GLJA 2CSSA 2LUIA 2YTWA 1X5QA 1X5NA 1L6OA 3DJAA 2I04A 2OPGA 3MH4A 4FGMA 5HFFA 2EV8A 5F67A 1X5RA 2REYA 3EGHC 4FLNA 4JOGA 4Q3HA 2EXGA 4N6XA 3MH7A 3VQFA 1UEWA 2F0AA 1B8QA 2RCZA 1Q7XA 1ZUBA 2OCSA 4NNLA 2EAQA 1N6FA 2KBSA 1QAUA 1FC9A 3MH6A 5FHTA 1P1DA 5D13A 2PZDA 5E21A 1Y7NA 1OBZA 2OQSA 2JILA 1Q3PA 1P1EA 3LNYA 4NXPA 2I0LA 5HEBA 5F3XA 3KZEA 1UEZA 3ID3A 4GHNA 2PKTA 2KOJA 1N7EA 3R0HA 2JOAA 1WIFA 4F8KA 2PA1A 1OZIA 2EEJA 3GDUA 2JREA 3PV2A 3DORA 2D8IA 2L4TA 3R69A 1TP3A 3DIWA 2KYLA 4K76A 3NFKA 2KOMA 3GSLA 1U38A 2QG1A 3WKLA 3PDZA 1Z87A 3SHUA 4R2ZA 1X45A 4E34A 2I0IA 3KHFA 4K75A 2M0TA 1PDRA 3I1EA 4NNMA 3SHWA 2EDVA 1KY9A 2KPLA 1GQ4A 5HFBA 1IU2A 2KJDA 2IWPA 1UM1A 2K20A 1Q3OA 1N6EA 2KJKA 2EGKA 1I16A 2YT8A 1QAVA 4JORA 1X8SA 1BFEA 2KQFA 1UFXA 2BYGA 2Q9VA 1NF3C 5HEDA 1FC6A 3K50A 4K72A 1WI2A 5HF1A 1U3BA 2Q3GA 3HVQC 3PS4A 3STJA 1N6DA 2LC6A 4UU6A 1KWAA 4LMMA 4HOPB 3QDOA 4H11A 2CSJA 3JXTA 1VB7A 2FCFA 3RL8A 1VCWA 2CS5A 2VWRA 2VRFA 3O5NA 1G9OA 4K78A 3KZDA 5EYZA 3R68A 1V6BA 4JOFA 1X6DA 4MPAA 2RRMA 1IHJA 1WHAA 3EGGC 3FY5A 4OEOA 4WYTA 3SUZA 3QE1A 3I18A 2P3WA 1FC7A 1RGWA 2H2BA 3LNXA 1RGRA 2W4FA 1D5GA 2EGNA 2E7KA 2DC2A 4JOKA 1X9ZA 1SOZA 1UHPA 2VSVA 1Y8TA 4UU5A 1W9OA 2LOBA 4JOJA 3PV5A 5E1YA 1N7FA 3QJNA 4O06A 3NGHA 4GVCA 2Z9IA 2QKVA 2V1WA 3PDVA 2IWNA 1WFGA 2I6VA
chains in the Genus database with same CATH topology
2L4SA 3GCOA 4NMTA 4NMOA 4JJ3A 1OBXA 4JOHA 1UJUA 5E22A 1UITA 2M0VA 4NMRA 2PDZA 1QLCA 2ZPMA 3HPKA 1Z86A 1NTEA 4JL7A 4GVDA 1OBYA 4HOPA 1ZOKA 1UF1A 3CYYA 1N99A 5HFEA 2ZPLA 2KV8A 2KA9A 3QGLA 2VPHA 2IWOA 2WL7A 5FB8C 2EGOA 5DTHA 3QIKA 2YT7A 4OEPA 5H3JA 2EDZA 5I7ZA 3GDVA 4NMPA 3KDKA 3CC0A 3DJ1A 1R6JA 1WFVA 5HETA 3TMHA 2UZCA 2R4HA 1WI4A 2VZ5A 2JXOA 5B42A 1U37A 3CS0A 3DJ3A 3RLEA 3QO6A 1YBOA 3RL7A 1V62A 4Z33A 1K32A 2K1ZA 2KAWA 3CBYA 2YUBA 1M5ZA 1WJLA 4REYA 3CBZA 2JIKA 2H2CA 3ZRTA 2Z17A 2O2TA 1UJDA 2DMZA 1UJVA 5HFCA 2FE5A 1LCYA 1GM1A 2KL1A 4KFWA 3OU0A 5HEYA 1RZXA 2AWWA 2H3MA 4P2AB 5GNDA 2PKUA 3SOEA 3BPUA 2OZFA 1V5LA 1IU0A 4JOPA 4XHVA 4Q2QA 3AXAA 2OMJA 2W7RA 1T2MA 2M10A 1UEQA 3TSZA 2ENOA 3ID2A 3GABA 2D92A 2HE2A 2VSPA 2GZVA 2PNTA 2D90A 5HF4A 2DKRA 2EJYA 2JWEA 2AINA 1QAVB 2DJTA 1MFLA 1WF8A 2EEHA 3OTPA 1UM7A 3K82A 2EEGA 1KEFA 1BE9A 2QKTA 4NMVA 3TSWA 1V1TA 2AWXA 5E6PB 4AMHA 4Q6SA 1VA8A 5A2PA 5G1EA 2EEIA 2V90A 2QKUA 3GCNA 4Q2OA 3CBXA 4L8NA 3O46A 4NMQA 2MHOA 1WG6A 2JINA 3ID1A 2DAZA 5JXBA 2M3MA 1TE0A 5HFDA 2H3LA 4IC6A 4EDJA 2KOHA 1N7TA 5B6LA 4E35A 4Q2NA 4E3BA 4YYXA 4Q2PA 1TP5A 4NXQA 4PQWA 3L4FD 2FN5A 1MC7A 1W9QA 2EHRA 4G69A 3E17A 1UEPA 1RY4A 2FNEA 5G1DA 2MX6A 1FCFA 2L97A 2DLUA 3WKMA 2KG2A 3GJ9A 2LC7A 5HJ1A 3VQGA 5E11A 1VJ6A 4JJ0A 5EZ0A 1U39A 2OSGA 2IWQA 5HDYA 2KRGA 1I92A 3CH8A 2OS6A 3SFJA 4Q6HA 2AWUA 3PV4A 4RI0A 2G2LA 5IL9A 3HPMA 2G5MB 3B76A 5ILBA 1WF7A 2JSNA 2QT5A 3NFLA 4YDPA 3GGEA 4WYUA 1GQ5A 4P0CA 3ID4A 1MFGA 1SOTA 1W9EA 2LA8A 2EDPA 2DLSA 2R3YA 2DM8A 3TSVA 2YUYA 2HE4A 2KPKA 4JOEA 3NCVA 2I1NA 4Z8JA 3K1RA 2M0UA 3GDSA 4NMSA 4K6YA 2QBWA 1WH1A 2HGAA 4KFVA 2KJPA 1VAEA 2I4SA 2X7ZA 3KDGA 1V5QA 2M0ZA 1WHDA 2DB5A 1TQ3A 1XZ9A 2OGPA 3QJMA 4OAJA 2GEFA 2F5YA 4NXRA 3I4WA 5GLJA 2CSSA 2LUIA 2YTWA 1X5QA 1X5NA 1L6OA 3DJAA 2I04A 2OPGA 3MH4A 4FGMA 5HFFA 2EV8A 5F67A 1X5RA 2REYA 3EGHC 4FLNA 4JOGA 4Q3HA 2EXGA 4N6XA 3MH7A 3VQFA 1UEWA 2F0AA 1B8QA 2RCZA 1Q7XA 1ZUBA 2OCSA 4NNLA 2EAQA 1N6FA 2KBSA 1QAUA 1FC9A 3MH6A 5FHTA 1P1DA 5D13A 2PZDA 5E21A 1Y7NA 1OBZA 2OQSA 2JILA 1Q3PA 1P1EA 3LNYA 4NXPA 2I0LA 5HEBA 5F3XA 3KZEA 1UEZA 3ID3A 4GHNA 2PKTA 2KOJA 1N7EA 3R0HA 2JOAA 1WIFA 4F8KA 2PA1A 1OZIA 2EEJA 3GDUA 2JREA 3PV2A 3DORA 2D8IA 2L4TA 3R69A 1TP3A 3DIWA 2KYLA 4K76A 3NFKA 2KOMA 3GSLA 1U38A 2QG1A 3WKLA 3PDZA 1Z87A 3SHUA 4R2ZA 1X45A 4E34A 2I0IA 3KHFA 4K75A 2M0TA 1PDRA 3I1EA 4NNMA 3SHWA 2EDVA 1KY9A 2KPLA 1GQ4A 5HFBA 1IU2A 2KJDA 2IWPA 1UM1A 2K20A 1Q3OA 1N6EA 2KJKA 2EGKA 1I16A 2YT8A 1QAVA 4JORA 1X8SA 1BFEA 2KQFA 1UFXA 2BYGA 2Q9VA 1NF3C 5HEDA 1FC6A 3K50A 4K72A 1WI2A 5HF1A 1U3BA 2Q3GA 3HVQC 3PS4A 3STJA 1N6DA 2LC6A 4UU6A 1KWAA 4LMMA 4HOPB 3QDOA 4H11A 2CSJA 3JXTA 1VB7A 2FCFA 3RL8A 1VCWA 2CS5A 2VWRA 2VRFA 3O5NA 1G9OA 4K78A 3KZDA 5EYZA 3R68A 1V6BA 4JOFA 1X6DA 4MPAA 2RRMA 1IHJA 1WHAA 3EGGC 3FY5A 4OEOA 4WYTA 3SUZA 3QE1A 3I18A 2P3WA 1FC7A 1RGWA 2H2BA 3LNXA 1RGRA 2W4FA 1D5GA 2EGNA 2E7KA 2DC2A 4JOKA 1X9ZA 1SOZA 1UHPA 2VSVA 1Y8TA 4UU5A 1W9OA 2LOBA 4JOJA 3PV5A 5E1YA 1N7FA 3QJNA 4O06A 3NGHA 4GVCA 2Z9IA 2QKVA 2V1WA 3PDVA 2IWNA 1WFGA 2I6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4S A;  3GCO A;  4NMT A;  4NMO A;  1OBX A;  4JOH A;  1UJU A;  5E22 A;  1UIT A;  2M0V A;  4NMR A;  2PDZ A;  1QLC A;  2ZPM A;  3HPK A;  1Z86 A;  1NTE A;  4JL7 A;  4GVD A;  1OBY A;  4HOP A;  1ZOK A;  1UF1 A;  3CYY A;  1N99 A;  5HFE A;  2ZPL A;  2KV8 A;  2KA9 A;  3QGL A;  2VPH A;  2IWO A;  2WL7 A;  5FB8 C;  2EGO A;  5DTH A;  3QIK A;  2YT7 A;  4OEP A;  5H3J A;  2EDZ A;  5I7Z A;  3GDV A;  4NMP A;  3CC0 A;  3DJ1 A;  1R6J A;  1WFV A;  5HET A;  3TMH A;  2UZC A;  2R4H A;  1WI4 A;  2VZ5 A;  2JXO A;  1U37 A;  3CS0 A;  3DJ3 A;  3RLE A;  3QO6 A;  1YBO A;  3RL7 A;  1V62 A;  4Z33 A;  1K32 A;  2K1Z A;  2KAW A;  3CBY A;  2YUB A;  1M5Z A;  1WJL A;  4REY A;  3CBZ A;  2JIK A;  2H2C A;  3ZRT A;  2Z17 A;  2O2T A;  1UJD A;  2DMZ A;  1UJV A;  5HFC A;  2FE5 A;  1LCY A;  1GM1 A;  2KL1 A;  4KFW A;  3OU0 A;  5HEY A;  1RZX A;  2AWW A;  2H3M A;  4P2A B;  5GND A;  2PKU A;  3SOE A;  3BPU A;  2OZF A;  1V5L A;  1IU0 A;  4JOP A;  4XHV A;  4Q2Q A;  3AXA A;  2OMJ A;  2W7R A;  1T2M A;  2M10 A;  1UEQ A;  3TSZ A;  2ENO A;  3ID2 A;  2D92 A;  2HE2 A;  2VSP A;  2GZV A;  2PNT A;  2D90 A;  5HF4 A;  2DKR A;  2EJY A;  2JWE A;  2AIN A;  1QAV B;  2DJT A;  1MFL A;  1WF8 A;  2EEH A;  3OTP A;  1UM7 A;  3K82 A;  2EEG A;  1KEF A;  1BE9 A;  2QKT A;  4NMV A;  3TSW A;  1V1T A;  2AWX A;  5E6P B;  4AMH A;  4Q6S A;  1VA8 A;  5A2P A;  5G1E A;  2EEI A;  2V90 A;  2QKU A;  3GCN A;  4Q2O A;  3CBX A;  4L8N A;  3O46 A;  4NMQ A;  2MHO A;  1WG6 A;  2JIN A;  3ID1 A;  2DAZ A;  5JXB A;  2M3M A;  1TE0 A;  5HFD A;  2H3L A;  4IC6 A;  4EDJ A;  2KOH A;  1N7T A;  5B6L A;  4E35 A;  4Q2N A;  4E3B A;  4YYX A;  4Q2P A;  1TP5 A;  4NXQ A;  4PQW A;  3L4F D;  2FN5 A;  1MC7 A;  1W9Q A;  2EHR A;  4G69 A;  3E17 A;  1UEP A;  1RY4 A;  2FNE A;  5G1D A;  2MX6 A;  1FCF A;  2L97 A;  2DLU A;  3WKM A;  2KG2 A;  3GJ9 A;  2LC7 A;  5HJ1 A;  3VQG A;  5E11 A;  1VJ6 A;  5EZ0 A;  1U39 A;  2OSG A;  2IWQ A;  5HDY A;  2KRG A;  1I92 A;  3CH8 A;  2OS6 A;  3SFJ A;  4Q6H A;  2AWU A;  3PV4 A;  4RI0 A;  2G2L A;  3HPM A;  2G5M B;  3B76 A;  1WF7 A;  2QT5 A;  3NFL A;  4YDP A;  3GGE A;  4WYU A;  1GQ5 A;  4P0C A;  3ID4 A;  1MFG A;  1SOT A;  1W9E A;  2LA8 A;  2EDP A;  2DLS A;  2R3Y A;  2DM8 A;  3TSV A;  2YUY A;  2HE4 A;  2KPK A;  4JOE A;  2I1N A;  4Z8J A;  3K1R A;  2M0U A;  3GDS A;  4NMS A;  4K6Y A;  2QBW A;  1WH1 A;  2HGA A;  4KFV A;  2KJP A;  1VAE A;  2I4S A;  2X7Z A;  1V5Q A;  2M0Z A;  1WHD A;  2DB5 A;  1TQ3 A;  1XZ9 A;  2OGP A;  3QJM A;  4OAJ A;  2F5Y A;  4NXR A;  3I4W A;  5GLJ A;  2CSS A;  2LUI A;  2YTW A;  1X5Q A;  1X5N A;  1L6O A;  3DJA A;  2I04 A;  2OPG A;  3MH4 A;  4FGM A;  5HFF A;  2EV8 A;  5F67 A;  1X5R A;  2REY A;  3EGH C;  4JOG A;  4Q3H A;  2EXG A;  4N6X A;  3MH7 A;  3VQF A;  1UEW A;  2F0A A;  1B8Q A;  2RCZ A;  1Q7X A;  1ZUB A;  2OCS A;  4NNL A;  2EAQ A;  1N6F A;  2KBS A;  1QAU A;  1FC9 A;  3MH6 A;  5FHT A;  1P1D A;  5D13 A;  2PZD A;  5E21 A;  1Y7N A;  1OBZ A;  2OQS A;  2JIL A;  1Q3P A;  1P1E A;  3LNY A;  4NXP A;  2I0L A;  5HEB A;  5F3X A;  3KZE A;  1UEZ A;  3ID3 A;  4GHN A;  2PKT A;  2KOJ A;  1N7E A;  3R0H A;  2JOA A;  1WIF A;  4F8K A;  2PA1 A;  1OZI A;  2EEJ A;  3GDU A;  2JRE A;  3PV2 A;  3DOR A;  2D8I A;  2L4T A;  3R69 A;  1TP3 A;  3DIW A;  2KYL A;  4K76 A;  3NFK A;  2KOM A;  3GSL A;  1U38 A;  2QG1 A;  3WKL A;  3PDZ A;  1Z87 A;  3SHU A;  4R2Z A;  1X45 A;  4E34 A;  2I0I A;  3KHF A;  4K75 A;  2M0T A;  1PDR A;  3I1E A;  4NNM A;  3SHW A;  2EDV A;  1KY9 A;  2KPL A;  1GQ4 A;  5HFB A;  1IU2 A;  2KJD A;  2IWP A;  1UM1 A;  2K20 A;  1Q3O A;  1N6E A;  2KJK A;  2EGK A;  1I16 A;  2YT8 A;  1QAV A;  4JOR A;  1X8S A;  1BFE A;  2KQF A;  1UFX A;  2BYG A;  2Q9V A;  1NF3 C;  5HED A;  1FC6 A;  3K50 A;  4K72 A;  1WI2 A;  5HF1 A;  1U3B A;  2Q3G A;  3HVQ C;  3PS4 A;  3STJ A;  1N6D A;  2LC6 A;  4UU6 A;  1KWA A;  4LMM A;  4HOP B;  3QDO A;  4H11 A;  2CSJ A;  3JXT A;  1VB7 A;  2FCF A;  3RL8 A;  1VCW A;  2CS5 A;  2VWR A;  2VRF A;  3O5N A;  1G9O A;  4K78 A;  3KZD A;  5EYZ A;  3R68 A;  1V6B A;  4JOF A;  1X6D A;  4MPA A;  2RRM A;  1IHJ A;  1WHA A;  3EGG C;  3FY5 A;  4OEO A;  4WYT A;  3SUZ A;  3QE1 A;  3I18 A;  2P3W A;  1FC7 A;  1RGW A;  2H2B A;  3LNX A;  1RGR A;  2W4F A;  1D5G A;  2EGN A;  2E7K A;  2DC2 A;  4JOK A;  1SOZ A;  1UHP A;  2VSV A;  1Y8T A;  4UU5 A;  1W9O A;  2LOB A;  4JOJ A;  3PV5 A;  5E1Y A;  1N7F A;  3QJN A;  4O06 A;  3NGH A;  4GVC A;  2Z9I A;  2QKV A;  2V1W A;  3PDV A;  2IWN A;  1WFG A;  2I6V A; 
#chains in the Genus database with same CATH topology
 2L4S A;  3GCO A;  4NMT A;  4NMO A;  4JJ3 A;  1OBX A;  4JOH A;  1UJU A;  5E22 A;  1UIT A;  2M0V A;  4NMR A;  2PDZ A;  1QLC A;  2ZPM A;  3HPK A;  1Z86 A;  1NTE A;  4JL7 A;  4GVD A;  1OBY A;  4HOP A;  1ZOK A;  1UF1 A;  3CYY A;  1N99 A;  5HFE A;  2ZPL A;  2KV8 A;  2KA9 A;  3QGL A;  2VPH A;  2IWO A;  2WL7 A;  5FB8 C;  2EGO A;  5DTH A;  3QIK A;  2YT7 A;  4OEP A;  5H3J A;  2EDZ A;  5I7Z A;  3GDV A;  4NMP A;  3KDK A;  3CC0 A;  3DJ1 A;  1R6J A;  1WFV A;  5HET A;  3TMH A;  2UZC A;  2R4H A;  1WI4 A;  2VZ5 A;  2JXO A;  5B42 A;  1U37 A;  3CS0 A;  3DJ3 A;  3RLE A;  3QO6 A;  1YBO A;  3RL7 A;  1V62 A;  4Z33 A;  1K32 A;  2K1Z A;  2KAW A;  3CBY A;  2YUB A;  1M5Z A;  1WJL A;  4REY A;  3CBZ A;  2JIK A;  2H2C A;  3ZRT A;  2Z17 A;  2O2T A;  1UJD A;  2DMZ A;  1UJV A;  5HFC A;  2FE5 A;  1LCY A;  1GM1 A;  2KL1 A;  4KFW A;  3OU0 A;  5HEY A;  1RZX A;  2AWW A;  2H3M A;  4P2A B;  5GND A;  2PKU A;  3SOE A;  3BPU A;  2OZF A;  1V5L A;  1IU0 A;  4JOP A;  4XHV A;  4Q2Q A;  3AXA A;  2OMJ A;  2W7R A;  1T2M A;  2M10 A;  1UEQ A;  3TSZ A;  2ENO A;  3ID2 A;  3GAB A;  2D92 A;  2HE2 A;  2VSP A;  2GZV A;  2PNT A;  2D90 A;  5HF4 A;  2DKR A;  2EJY A;  2JWE A;  2AIN A;  1QAV B;  2DJT A;  1MFL A;  1WF8 A;  2EEH A;  3OTP A;  1UM7 A;  3K82 A;  2EEG A;  1KEF A;  1BE9 A;  2QKT A;  4NMV A;  3TSW A;  1V1T A;  2AWX A;  5E6P B;  4AMH A;  4Q6S A;  1VA8 A;  5A2P A;  5G1E A;  2EEI A;  2V90 A;  2QKU A;  3GCN A;  4Q2O A;  3CBX A;  4L8N A;  3O46 A;  4NMQ A;  2MHO A;  1WG6 A;  2JIN A;  3ID1 A;  2DAZ A;  5JXB A;  2M3M A;  1TE0 A;  5HFD A;  2H3L A;  4IC6 A;  4EDJ A;  2KOH A;  1N7T A;  5B6L A;  4E35 A;  4Q2N A;  4E3B A;  4YYX A;  4Q2P A;  1TP5 A;  4NXQ A;  4PQW A;  3L4F D;  2FN5 A;  1MC7 A;  1W9Q A;  2EHR A;  4G69 A;  3E17 A;  1UEP A;  1RY4 A;  2FNE A;  5G1D A;  2MX6 A;  1FCF A;  2L97 A;  2DLU A;  3WKM A;  2KG2 A;  3GJ9 A;  2LC7 A;  5HJ1 A;  3VQG A;  5E11 A;  1VJ6 A;  4JJ0 A;  5EZ0 A;  1U39 A;  2OSG A;  2IWQ A;  5HDY A;  2KRG A;  1I92 A;  3CH8 A;  2OS6 A;  3SFJ A;  4Q6H A;  2AWU A;  3PV4 A;  4RI0 A;  2G2L A;  5IL9 A;  3HPM A;  2G5M B;  3B76 A;  5ILB A;  1WF7 A;  2JSN A;  2QT5 A;  3NFL A;  4YDP A;  3GGE A;  4WYU A;  1GQ5 A;  4P0C A;  3ID4 A;  1MFG A;  1SOT A;  1W9E A;  2LA8 A;  2EDP A;  2DLS A;  2R3Y A;  2DM8 A;  3TSV A;  2YUY A;  2HE4 A;  2KPK A;  4JOE A;  3NCV A;  2I1N A;  4Z8J A;  3K1R A;  2M0U A;  3GDS A;  4NMS A;  4K6Y A;  2QBW A;  1WH1 A;  2HGA A;  4KFV A;  2KJP A;  1VAE A;  2I4S A;  2X7Z A;  3KDG A;  1V5Q A;  2M0Z A;  1WHD A;  2DB5 A;  1TQ3 A;  1XZ9 A;  2OGP A;  3QJM A;  4OAJ A;  2GEF A;  2F5Y A;  4NXR A;  3I4W A;  5GLJ A;  2CSS A;  2LUI A;  2YTW A;  1X5Q A;  1X5N A;  1L6O A;  3DJA A;  2I04 A;  2OPG A;  3MH4 A;  4FGM A;  5HFF A;  2EV8 A;  5F67 A;  1X5R A;  2REY A;  3EGH C;  4FLN A;  4JOG A;  4Q3H A;  2EXG A;  4N6X A;  3MH7 A;  3VQF A;  1UEW A;  2F0A A;  1B8Q A;  2RCZ A;  1Q7X A;  1ZUB A;  2OCS A;  4NNL A;  2EAQ A;  1N6F A;  2KBS A;  1QAU A;  1FC9 A;  3MH6 A;  5FHT A;  1P1D A;  5D13 A;  2PZD A;  5E21 A;  1Y7N A;  1OBZ A;  2OQS A;  2JIL A;  1Q3P A;  1P1E A;  3LNY A;  4NXP A;  2I0L A;  5HEB A;  5F3X A;  3KZE A;  1UEZ A;  3ID3 A;  4GHN A;  2PKT A;  2KOJ A;  1N7E A;  3R0H A;  2JOA A;  1WIF A;  4F8K A;  2PA1 A;  1OZI A;  2EEJ A;  3GDU A;  2JRE A;  3PV2 A;  3DOR A;  2D8I A;  2L4T A;  3R69 A;  1TP3 A;  3DIW A;  2KYL A;  4K76 A;  3NFK A;  2KOM A;  3GSL A;  1U38 A;  2QG1 A;  3WKL A;  3PDZ A;  1Z87 A;  3SHU A;  4R2Z A;  1X45 A;  4E34 A;  2I0I A;  3KHF A;  4K75 A;  2M0T A;  1PDR A;  3I1E A;  4NNM A;  3SHW A;  2EDV A;  1KY9 A;  2KPL A;  1GQ4 A;  5HFB A;  1IU2 A;  2KJD A;  2IWP A;  1UM1 A;  2K20 A;  1Q3O A;  1N6E A;  2KJK A;  2EGK A;  1I16 A;  2YT8 A;  1QAV A;  4JOR A;  1X8S A;  1BFE A;  2KQF A;  1UFX A;  2BYG A;  2Q9V A;  1NF3 C;  5HED A;  1FC6 A;  3K50 A;  4K72 A;  1WI2 A;  5HF1 A;  1U3B A;  2Q3G A;  3HVQ C;  3PS4 A;  3STJ A;  1N6D A;  2LC6 A;  4UU6 A;  1KWA A;  4LMM A;  4HOP B;  3QDO A;  4H11 A;  2CSJ A;  3JXT A;  1VB7 A;  2FCF A;  3RL8 A;  1VCW A;  2CS5 A;  2VWR A;  2VRF A;  3O5N A;  1G9O A;  4K78 A;  3KZD A;  5EYZ A;  3R68 A;  1V6B A;  4JOF A;  1X6D A;  4MPA A;  2RRM A;  1IHJ A;  1WHA A;  3EGG C;  3FY5 A;  4OEO A;  4WYT A;  3SUZ A;  3QE1 A;  3I18 A;  2P3W A;  1FC7 A;  1RGW A;  2H2B A;  3LNX A;  1RGR A;  2W4F A;  1D5G A;  2EGN A;  2E7K A;  2DC2 A;  4JOK A;  1X9Z A;  1SOZ A;  1UHP A;  2VSV A;  1Y8T A;  4UU5 A;  1W9O A;  2LOB A;  4JOJ A;  3PV5 A;  5E1Y A;  1N7F A;  3QJN A;  4O06 A;  3NGH A;  4GVC A;  2Z9I A;  2QKV A;  2V1W A;  3PDV A;  2IWN A;  1WFG A;  2I6V A; 
#chains in the Genus database with same CATH homology
 2L4S A;  3GCO A;  4NMT A;  4NMO A;  4JJ3 A;  1OBX A;  4JOH A;  1UJU A;  5E22 A;  1UIT A;  2M0V A;  4NMR A;  2PDZ A;  1QLC A;  2ZPM A;  3HPK A;  1Z86 A;  1NTE A;  4JL7 A;  4GVD A;  1OBY A;  4HOP A;  1ZOK A;  1UF1 A;  3CYY A;  1N99 A;  5HFE A;  2ZPL A;  2KV8 A;  2KA9 A;  3QGL A;  2VPH A;  2IWO A;  2WL7 A;  5FB8 C;  2EGO A;  5DTH A;  3QIK A;  2YT7 A;  4OEP A;  5H3J A;  2EDZ A;  5I7Z A;  3GDV A;  4NMP A;  3KDK A;  3CC0 A;  3DJ1 A;  1R6J A;  1WFV A;  5HET A;  3TMH A;  2UZC A;  2R4H A;  1WI4 A;  2VZ5 A;  2JXO A;  5B42 A;  1U37 A;  3CS0 A;  3DJ3 A;  3RLE A;  3QO6 A;  1YBO A;  3RL7 A;  1V62 A;  4Z33 A;  1K32 A;  2K1Z A;  2KAW A;  3CBY A;  2YUB A;  1M5Z A;  1WJL A;  4REY A;  3CBZ A;  2JIK A;  2H2C A;  3ZRT A;  2Z17 A;  2O2T A;  1UJD A;  2DMZ A;  1UJV A;  5HFC A;  2FE5 A;  1LCY A;  1GM1 A;  2KL1 A;  4KFW A;  3OU0 A;  5HEY A;  1RZX A;  2AWW A;  2H3M A;  4P2A B;  5GND A;  2PKU A;  3SOE A;  3BPU A;  2OZF A;  1V5L A;  1IU0 A;  4JOP A;  4XHV A;  4Q2Q A;  3AXA A;  2OMJ A;  2W7R A;  1T2M A;  2M10 A;  1UEQ A;  3TSZ A;  2ENO A;  3ID2 A;  3GAB A;  2D92 A;  2HE2 A;  2VSP A;  2GZV A;  2PNT A;  2D90 A;  5HF4 A;  2DKR A;  2EJY A;  2JWE A;  2AIN A;  1QAV B;  2DJT A;  1MFL A;  1WF8 A;  2EEH A;  3OTP A;  1UM7 A;  3K82 A;  2EEG A;  1KEF A;  1BE9 A;  2QKT A;  4NMV A;  3TSW A;  1V1T A;  2AWX A;  5E6P B;  4AMH A;  4Q6S A;  1VA8 A;  5A2P A;  5G1E A;  2EEI A;  2V90 A;  2QKU A;  3GCN A;  4Q2O A;  3CBX A;  4L8N A;  3O46 A;  4NMQ A;  2MHO A;  1WG6 A;  2JIN A;  3ID1 A;  2DAZ A;  5JXB A;  2M3M A;  1TE0 A;  5HFD A;  2H3L A;  4IC6 A;  4EDJ A;  2KOH A;  1N7T A;  5B6L A;  4E35 A;  4Q2N A;  4E3B A;  4YYX A;  4Q2P A;  1TP5 A;  4NXQ A;  4PQW A;  3L4F D;  2FN5 A;  1MC7 A;  1W9Q A;  2EHR A;  4G69 A;  3E17 A;  1UEP A;  1RY4 A;  2FNE A;  5G1D A;  2MX6 A;  1FCF A;  2L97 A;  2DLU A;  3WKM A;  2KG2 A;  3GJ9 A;  2LC7 A;  5HJ1 A;  3VQG A;  5E11 A;  1VJ6 A;  4JJ0 A;  5EZ0 A;  1U39 A;  2OSG A;  2IWQ A;  5HDY A;  2KRG A;  1I92 A;  3CH8 A;  2OS6 A;  3SFJ A;  4Q6H A;  2AWU A;  3PV4 A;  4RI0 A;  2G2L A;  5IL9 A;  3HPM A;  2G5M B;  3B76 A;  5ILB A;  1WF7 A;  2JSN A;  2QT5 A;  3NFL A;  4YDP A;  3GGE A;  4WYU A;  1GQ5 A;  4P0C A;  3ID4 A;  1MFG A;  1SOT A;  1W9E A;  2LA8 A;  2EDP A;  2DLS A;  2R3Y A;  2DM8 A;  3TSV A;  2YUY A;  2HE4 A;  2KPK A;  4JOE A;  3NCV A;  2I1N A;  4Z8J A;  3K1R A;  2M0U A;  3GDS A;  4NMS A;  4K6Y A;  2QBW A;  1WH1 A;  2HGA A;  4KFV A;  2KJP A;  1VAE A;  2I4S A;  2X7Z A;  3KDG A;  1V5Q A;  2M0Z A;  1WHD A;  2DB5 A;  1TQ3 A;  1XZ9 A;  2OGP A;  3QJM A;  4OAJ A;  2GEF A;  2F5Y A;  4NXR A;  3I4W A;  5GLJ A;  2CSS A;  2LUI A;  2YTW A;  1X5Q A;  1X5N A;  1L6O A;  3DJA A;  2I04 A;  2OPG A;  3MH4 A;  4FGM A;  5HFF A;  2EV8 A;  5F67 A;  1X5R A;  2REY A;  3EGH C;  4FLN A;  4JOG A;  4Q3H A;  2EXG A;  4N6X A;  3MH7 A;  3VQF A;  1UEW A;  2F0A A;  1B8Q A;  2RCZ A;  1Q7X A;  1ZUB A;  2OCS A;  4NNL A;  2EAQ A;  1N6F A;  2KBS A;  1QAU A;  1FC9 A;  3MH6 A;  5FHT A;  1P1D A;  5D13 A;  2PZD A;  5E21 A;  1Y7N A;  1OBZ A;  2OQS A;  2JIL A;  1Q3P A;  1P1E A;  3LNY A;  4NXP A;  2I0L A;  5HEB A;  5F3X A;  3KZE A;  1UEZ A;  3ID3 A;  4GHN A;  2PKT A;  2KOJ A;  1N7E A;  3R0H A;  2JOA A;  1WIF A;  4F8K A;  2PA1 A;  1OZI A;  2EEJ A;  3GDU A;  2JRE A;  3PV2 A;  3DOR A;  2D8I A;  2L4T A;  3R69 A;  1TP3 A;  3DIW A;  2KYL A;  4K76 A;  3NFK A;  2KOM A;  3GSL A;  1U38 A;  2QG1 A;  3WKL A;  3PDZ A;  1Z87 A;  3SHU A;  4R2Z A;  1X45 A;  4E34 A;  2I0I A;  3KHF A;  4K75 A;  2M0T A;  1PDR A;  3I1E A;  4NNM A;  3SHW A;  2EDV A;  1KY9 A;  2KPL A;  1GQ4 A;  5HFB A;  1IU2 A;  2KJD A;  2IWP A;  1UM1 A;  2K20 A;  1Q3O A;  1N6E A;  2KJK A;  2EGK A;  1I16 A;  2YT8 A;  1QAV A;  4JOR A;  1X8S A;  1BFE A;  2KQF A;  1UFX A;  2BYG A;  2Q9V A;  1NF3 C;  5HED A;  1FC6 A;  3K50 A;  4K72 A;  1WI2 A;  5HF1 A;  1U3B A;  2Q3G A;  3HVQ C;  3PS4 A;  3STJ A;  1N6D A;  2LC6 A;  4UU6 A;  1KWA A;  4LMM A;  4HOP B;  3QDO A;  4H11 A;  2CSJ A;  3JXT A;  1VB7 A;  2FCF A;  3RL8 A;  1VCW A;  2CS5 A;  2VWR A;  2VRF A;  3O5N A;  1G9O A;  4K78 A;  3KZD A;  5EYZ A;  3R68 A;  1V6B A;  4JOF A;  1X6D A;  4MPA A;  2RRM A;  1IHJ A;  1WHA A;  3EGG C;  3FY5 A;  4OEO A;  4WYT A;  3SUZ A;  3QE1 A;  3I18 A;  2P3W A;  1FC7 A;  1RGW A;  2H2B A;  3LNX A;  1RGR A;  2W4F A;  1D5G A;  2EGN A;  2E7K A;  2DC2 A;  4JOK A;  1X9Z A;  1SOZ A;  1UHP A;  2VSV A;  1Y8T A;  4UU5 A;  1W9O A;  2LOB A;  4JOJ A;  3PV5 A;  5E1Y A;  1N7F A;  3QJN A;  4O06 A;  3NGH A;  4GVC A;  2Z9I A;  2QKV A;  2V1W A;  3PDV A;  2IWN A;  1WFG A;  2I6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...