4OEOA

High resolution crystal structure of the unliganded zo-1 pdz1 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
94
structure length
94
Chain Sequence
MIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tight junction protein ZO-1
publication title Structural Basis of a Key Factor Regulating the Affinity between the Zonula Occludens First PDZ Domain and Claudins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 22
structure length 94
sequence length 94
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4oeoA00
2IWOA 4Q2OA 2KG2A 3JXTA 3O5NA 2EEJA 3GDUA 1I16A 2H2BA 3DJ3A 5HFEA 3GDVA 2DJTA 4H11A 1N7FA 4Z33A 1VAEA 2H3LA 3O46A 2FE5A 5EZ0A 4KFWA 5F3XA 4YDPA 1N6DA 1UEQA 4G69A 1SOZA 2QKVA 1N7EA 2Z17A 2KOJA 3WKMA 2VZ5A 3CYYA 5E11A 2DMZA 1G9OA 5E21A 1FC6A 1GQ4A 3SHUA 4K76A 3HVQC 2L97A 1M5ZA 1V62A 2M0VA 2FNEA 3NFLA 2EHRA 2H3MA 1W9QA 4K78A 3PDZA 2QT5A 2KPKA 2YUBA 1UF1A 2G2LA 4HOPA 3OU0A 2EDVA 4Q2NA 3AXAA 2EEHA 1FC9A 2P3WA 5I7ZA 2MHOA 2JXOA 1U38A 2JINA 5H3JA 2PA1A 4E34A 1UFXA 2X7ZA 4K6YA 2Q3GA 4OEOA 5EYZA 2EGKA 1GM1A 5F67A 3DIWA 4JL7A 5HEBA 3I4WA 3CS0A 4OEPA 5HDYA 5JXBA 3EGHC 3QIKA 4KFVA 1BE9A 2OGPA 1UEZA 5E1YA 4K72A 5HFCA 1UJUA 5GNDA 4L8NA 1MFGA 2R4HA 2Z9IA 1WF7A 1WG6A 1UM1A 3TSVA 4F8KA 2H2CA 2K1ZA 2L4TA 1MFLA 1P1EA 2AINA 2M3MA 2O2TA 1P1DA 5E6PB 3TMHA 3HPKA 3SFJA 2OMJA 5HFDA 1N99A 1TP5A 4GVCA 3SUZA 1TE0A 2EEIA 2I6VA 2KJPA 1QAVA 2QG1A 2KJKA 2I0IA 5D13A 3SOEA 1D5GA 4JOFA 1UM7A 4JOGA 5HEDA 1X5QA 1RZXA 1X8SA 1X6DA 2CSSA 2DB5A 2OZFA 4JOKA 1L6OA 1OBYA 1IU2A 1UEPA 2RRMA 2IWPA 2AWWA 1ZUBA 3ID3A 2ENOA 2Q9VA 3QJNA 4NMSA 2KV8A 2D90A 1FCFA 3NFKA 3TSWA 3K50A 2EJYA 4NMRA 3GCNA 2KAWA 3VQGA 4WYTA 1T2MA 4EDJA 1WHDA 1Y7NA 2KBSA 1BFEA 1Y8TA 4JORA 1UJDA 3B76A 3QDOA 1UJVA 2LC7A 1R6JA 3R0HA 1VB7A 5HF1A 4R2ZA 1VCWA 1KWAA 3MH7A 4NMOA 4PQWA 1NTEA 3QE1A 2E7KA 1UITA 5HF4A 4FGMA 2JIKA 3DJ1A 2EGOA 3L4FD 2EDPA 3QO6A 2YTWA 3CC0A 1U37A 2KJDA 5G1DA 5HFFA 5A2PA 2V1WA 4Q3HA 2VSPA 5HFBA 4NXPA 5HJ1A 1IHJA 2M0TA 4NMQA 1Q3PA 2KPLA 3BPUA 3HPMA 2EV8A 1KY9A 2DC2A 1GQ5A 2OCSA 1N7TA 4GVDA 2VSVA 4NMTA 4P2AB 3R68A 1WI2A 1N6EA 2KRGA 2JILA 2G5MB 5FHTA 3FY5A 1V6BA 4E35A 3PDVA 4Q6HA 2KOHA 2LA8A 2L4SA 2AWUA 3STJA 1K32A 3EGGC 4Q2PA 3TSZA 1X45A 1W9EA 4AMHA 4Z8JA 1UHPA 2KQFA 3OTPA 1RGWA 4K75A 4NNMA 1V1TA 3I1EA 3ID2A 5GLJA 2DLUA 2GZVA 3PS4A 2EGNA 4NMPA 3WKLA 1YBOA 2ZPMA 2OSGA 1PDRA 2PKTA 1QAVB 2AWXA 1V5QA 1TP3A 1Z86A 3LNXA 2V90A 1IU0A 3QJMA 2UZCA 2HE2A 3DJAA 1XZ9A 1I92A 3DORA 1WFGA 4E3BA 3PV2A 2I4SA 2DAZA 1WFVA 1V5LA 4REYA 2EDZA 3PV4A 4LMMA 2CS5A 2I0LA 1WIFA 2M10A 1N6FA 1ZOKA 5HEYA 2KA9A 4UU6A 2YUYA 1X5RA 2KYLA 4UU5A 3ID1A 2VPHA 2OS6A 1UEWA 3PV5A 1U3BA 1KEFA 3K1RA 5DTHA 2JWEA 3I18A 5HETA 2IWQA 4Q6SA 2CSJA 1QLCA 4YYXA 2I1NA 1U39A 5B6LA 3SHWA 1OZIA 3NGHA 2FN5A 4HOPB 2YT8A 3ZRTA 2RCZA 2VRFA 3GJ9A 1NF3C 1RGRA 2K20A 2LOBA 3MH4A 3K82A 5E22A 2HE4A 4P0CA 2W7RA 1RY4A 1TQ3A 3GCOA 4OAJA 2IWNA 2D92A 2LC6A 3LNYA 1WI4A 4JOJA 3GGEA 3ID4A 1VA8A 2F5YA 1OBXA 2PNTA 1SOTA 3R69A 3RLEA 1QAUA 2KL1A 2OPGA 3RL7A 2EAQA 2M0UA 1WHAA 2WL7A 3RL8A 2FCFA 2QKTA 1Q3OA 3CBYA 4RI0A 1WH1A 3KHFA 1X5NA 4JOPA 3GSLA 3CBXA 4NMVA 2LUIA 4O06A 3QGLA 4JOHA 4NNLA 4JOEA 2M0ZA 3KZDA 2JREA 1LCYA 2F0AA 5FB8C 1MC7A 2REYA 1WF8A 2YT7A 2PZDA 4MPAA 2QKUA 3E17A 2DKRA 2PKUA 4NXRA 4Q2QA 2KOMA 2MX6A 2D8IA 4WYUA 1B8QA 2EEGA 1Z87A 4NXQA 2QBWA 2BYGA 2DLSA 4IC6A 2EXGA 4GHNA 2OQSA 4N6XA 3KZEA 1WJLA 5G1EA 3CH8A 3GDSA 3VQFA 2HGAA 2ZPLA 3CBZA 1VJ6A 2R3YA 4XHVA 1W9OA 3MH6A 1FC7A 1Q7XA 1OBZA 2PDZA 2VWRA 2DM8A 2W4FA 2JOAA 2I04A
chains in the Genus database with same CATH superfamily
2IWOA 4Q2OA 2KG2A 3JXTA 3O5NA 2EEJA 3GDUA 1I16A 2H2BA 3DJ3A 5HFEA 3GDVA 2DJTA 4H11A 1N7FA 3GABA 4Z33A 1VAEA 2H3LA 3O46A 2FE5A 5EZ0A 4KFWA 5F3XA 4YDPA 1N6DA 1UEQA 4G69A 1SOZA 2QKVA 1N7EA 2Z17A 2KOJA 3WKMA 2VZ5A 3CYYA 5E11A 2DMZA 1G9OA 5E21A 1FC6A 1GQ4A 3SHUA 4K76A 3HVQC 2L97A 1M5ZA 1V62A 2M0VA 2FNEA 3NFLA 2EHRA 2H3MA 1W9QA 4K78A 3PDZA 2QT5A 2KPKA 2YUBA 1UF1A 2G2LA 4HOPA 3OU0A 2EDVA 4Q2NA 3AXAA 2EEHA 1FC9A 2P3WA 5I7ZA 2MHOA 2JXOA 1U38A 2JINA 5H3JA 2PA1A 4E34A 1UFXA 2X7ZA 4K6YA 2Q3GA 4OEOA 5EYZA 2EGKA 1GM1A 5F67A 3DIWA 4JL7A 3KDKA 5HEBA 3I4WA 3CS0A 4OEPA 5HDYA 5JXBA 3EGHC 3QIKA 4KFVA 1BE9A 2OGPA 1UEZA 5E1YA 4K72A 5HFCA 1UJUA 5IL9A 5GNDA 4L8NA 1MFGA 2R4HA 2Z9IA 1WF7A 1WG6A 1UM1A 3TSVA 4F8KA 2H2CA 2K1ZA 2L4TA 1MFLA 1P1EA 2AINA 2M3MA 2O2TA 1P1DA 5E6PB 3TMHA 3HPKA 3SFJA 2OMJA 5HFDA 1N99A 1TP5A 4GVCA 3SUZA 1TE0A 2EEIA 2I6VA 2KJPA 1QAVA 2QG1A 2KJKA 2I0IA 5D13A 3SOEA 1D5GA 4JOFA 1UM7A 4JOGA 5HEDA 1X5QA 1RZXA 1X8SA 1X6DA 2CSSA 2DB5A 2OZFA 4JOKA 1L6OA 1OBYA 1IU2A 1UEPA 2RRMA 2IWPA 2AWWA 1ZUBA 2ENOA 3ID3A 2Q9VA 3QJNA 4NMSA 2KV8A 4JJ0A 2D90A 1FCFA 3NFKA 3TSWA 3K50A 2EJYA 4NMRA 3GCNA 2KAWA 3VQGA 4WYTA 1T2MA 4EDJA 1WHDA 1Y7NA 2KBSA 1BFEA 1Y8TA 4JORA 1UJDA 3B76A 2GEFA 3QDOA 1UJVA 2LC7A 1R6JA 3R0HA 1VB7A 5HF1A 4JJ3A 4R2ZA 1VCWA 1KWAA 3MH7A 4NMOA 4PQWA 1NTEA 3QE1A 2E7KA 1UITA 5HF4A 4FGMA 2JIKA 3DJ1A 2EGOA 3L4FD 2EDPA 3QO6A 2YTWA 3CC0A 1U37A 2KJDA 5G1DA 5HFFA 5A2PA 2V1WA 4Q3HA 2VSPA 5HFBA 4NXPA 5HJ1A 1IHJA 2M0TA 4NMQA 1Q3PA 2KPLA 3BPUA 3HPMA 2EV8A 1KY9A 2DC2A 1GQ5A 2OCSA 1N7TA 4GVDA 2VSVA 4NMTA 4P2AB 3R68A 1WI2A 1N6EA 2KRGA 2JILA 2G5MB 5FHTA 3FY5A 1V6BA 4E35A 3PDVA 5ILBA 4Q6HA 2KOHA 2LA8A 2L4SA 2AWUA 3STJA 1K32A 3EGGC 2JSNA 4Q2PA 3TSZA 1X45A 1W9EA 4AMHA 4Z8JA 1UHPA 2KQFA 3OTPA 1RGWA 4K75A 4NNMA 1V1TA 3I1EA 3ID2A 5GLJA 2DLUA 2GZVA 3PS4A 2EGNA 4NMPA 3WKLA 1YBOA 2ZPMA 2OSGA 1PDRA 2PKTA 1QAVB 2AWXA 1V5QA 1TP3A 1Z86A 3LNXA 2V90A 1IU0A 3QJMA 2UZCA 2HE2A 3DJAA 1XZ9A 1I92A 3DORA 1WFGA 4E3BA 3PV2A 2I4SA 2DAZA 1WFVA 1V5LA 4REYA 3NCVA 2EDZA 3PV4A 4LMMA 2CS5A 2I0LA 1WIFA 2M10A 1N6FA 1ZOKA 5HEYA 2KA9A 4UU6A 2YUYA 1X5RA 2KYLA 4UU5A 3ID1A 2VPHA 2OS6A 1UEWA 3PV5A 1U3BA 1KEFA 3K1RA 5DTHA 3KDGA 2JWEA 3I18A 5HETA 2IWQA 4Q6SA 2CSJA 1QLCA 4YYXA 2I1NA 1U39A 5B6LA 3SHWA 1OZIA 3NGHA 2FN5A 4HOPB 2YT8A 3ZRTA 2RCZA 2VRFA 3GJ9A 1NF3C 1RGRA 2K20A 2LOBA 3MH4A 3K82A 5E22A 2HE4A 4P0CA 2W7RA 1RY4A 1TQ3A 3GCOA 4OAJA 2IWNA 2D92A 2LC6A 3LNYA 1WI4A 4JOJA 3GGEA 3ID4A 1VA8A 2F5YA 1OBXA 2PNTA 1SOTA 3R69A 3RLEA 1QAUA 2KL1A 2OPGA 3RL7A 2EAQA 2M0UA 1WHAA 2WL7A 3RL8A 2FCFA 2QKTA 1Q3OA 3CBYA 4RI0A 1WH1A 3KHFA 1X5NA 4JOPA 3GSLA 4FLNA 3CBXA 4NMVA 2LUIA 4O06A 3QGLA 4JOHA 4NNLA 4JOEA 2M0ZA 1X9ZA 2JREA 1LCYA 3KZDA 2F0AA 5FB8C 1MC7A 2REYA 1WF8A 2YT7A 2PZDA 4MPAA 2QKUA 3E17A 2DKRA 2PKUA 4NXRA 4Q2QA 2KOMA 2MX6A 2D8IA 4WYUA 1B8QA 2EEGA 1Z87A 4NXQA 2QBWA 2BYGA 2DLSA 4IC6A 2EXGA 4GHNA 5B42A 2OQSA 4N6XA 3KZEA 1WJLA 5G1EA 3CH8A 3GDSA 3VQFA 2HGAA 2ZPLA 3CBZA 1VJ6A 2R3YA 4XHVA 1W9OA 3MH6A 1FC7A 1Q7XA 1OBZA 2PDZA 2VWRA 2DM8A 2W4FA 2JOAA 2I04A
chains in the Genus database with same CATH topology
2IWOA 4Q2OA 2KG2A 3JXTA 3O5NA 2EEJA 3GDUA 1I16A 2H2BA 3DJ3A 5HFEA 3GDVA 2DJTA 4H11A 1N7FA 3GABA 4Z33A 1VAEA 2H3LA 3O46A 2FE5A 5EZ0A 4KFWA 5F3XA 4YDPA 1N6DA 1UEQA 4G69A 1SOZA 2QKVA 1N7EA 2Z17A 2KOJA 3WKMA 2VZ5A 3CYYA 5E11A 2DMZA 1G9OA 5E21A 1FC6A 1GQ4A 3SHUA 4K76A 3HVQC 2L97A 1M5ZA 1V62A 2M0VA 2FNEA 3NFLA 2EHRA 2H3MA 1W9QA 4K78A 3PDZA 2QT5A 2KPKA 2YUBA 1UF1A 2G2LA 4HOPA 3OU0A 2EDVA 4Q2NA 3AXAA 2EEHA 1FC9A 2P3WA 5I7ZA 2MHOA 2JXOA 1U38A 2JINA 5H3JA 2PA1A 4E34A 1UFXA 2X7ZA 4K6YA 2Q3GA 4OEOA 5EYZA 2EGKA 1GM1A 5F67A 3DIWA 4JL7A 3KDKA 5HEBA 3I4WA 3CS0A 4OEPA 5HDYA 5JXBA 3EGHC 3QIKA 4KFVA 1BE9A 2OGPA 1UEZA 5E1YA 4K72A 5HFCA 1UJUA 5IL9A 5GNDA 4L8NA 1MFGA 2R4HA 2Z9IA 1WF7A 1WG6A 1UM1A 3TSVA 4F8KA 2H2CA 2K1ZA 2L4TA 1MFLA 1P1EA 2AINA 2M3MA 2O2TA 1P1DA 5E6PB 3TMHA 3HPKA 3SFJA 2OMJA 5HFDA 1N99A 1TP5A 4GVCA 3SUZA 1TE0A 2EEIA 2I6VA 2KJPA 1QAVA 2QG1A 2KJKA 2I0IA 5D13A 3SOEA 1D5GA 4JOFA 1UM7A 4JOGA 5HEDA 1X5QA 1RZXA 1X8SA 1X6DA 2CSSA 2DB5A 2OZFA 4JOKA 1L6OA 1OBYA 1IU2A 1UEPA 2RRMA 2IWPA 2AWWA 1ZUBA 2ENOA 3ID3A 2Q9VA 3QJNA 4NMSA 2KV8A 4JJ0A 2D90A 1FCFA 3NFKA 3TSWA 3K50A 2EJYA 4NMRA 3GCNA 2KAWA 3VQGA 4WYTA 1T2MA 4EDJA 1WHDA 1Y7NA 2KBSA 1BFEA 1Y8TA 4JORA 1UJDA 3B76A 2GEFA 3QDOA 1UJVA 2LC7A 1R6JA 3R0HA 1VB7A 5HF1A 4JJ3A 4R2ZA 1VCWA 1KWAA 3MH7A 4NMOA 4PQWA 1NTEA 3QE1A 2E7KA 1UITA 5HF4A 4FGMA 2JIKA 3DJ1A 2EGOA 3L4FD 2EDPA 3QO6A 2YTWA 3CC0A 1U37A 2KJDA 5G1DA 5HFFA 5A2PA 2V1WA 4Q3HA 2VSPA 5HFBA 4NXPA 5HJ1A 1IHJA 2M0TA 4NMQA 1Q3PA 2KPLA 3BPUA 3HPMA 2EV8A 1KY9A 2DC2A 1GQ5A 2OCSA 1N7TA 4GVDA 2VSVA 4NMTA 4P2AB 3R68A 1WI2A 1N6EA 2KRGA 2JILA 2G5MB 5FHTA 3FY5A 1V6BA 4E35A 3PDVA 5ILBA 4Q6HA 2KOHA 2LA8A 2L4SA 2AWUA 3STJA 1K32A 3EGGC 2JSNA 4Q2PA 3TSZA 1X45A 1W9EA 4AMHA 4Z8JA 1UHPA 2KQFA 3OTPA 1RGWA 4K75A 4NNMA 1V1TA 3I1EA 3ID2A 5GLJA 2DLUA 2GZVA 3PS4A 2EGNA 4NMPA 3WKLA 1YBOA 2ZPMA 2OSGA 1PDRA 2PKTA 1QAVB 2AWXA 1V5QA 1TP3A 1Z86A 3LNXA 2V90A 1IU0A 3QJMA 2UZCA 2HE2A 3DJAA 1XZ9A 1I92A 3DORA 1WFGA 4E3BA 3PV2A 2I4SA 2DAZA 1WFVA 1V5LA 4REYA 3NCVA 2EDZA 3PV4A 4LMMA 2CS5A 2I0LA 1WIFA 2M10A 1N6FA 1ZOKA 5HEYA 2KA9A 4UU6A 2YUYA 1X5RA 2KYLA 4UU5A 3ID1A 2VPHA 2OS6A 1UEWA 3PV5A 1U3BA 1KEFA 3K1RA 5DTHA 3KDGA 2JWEA 3I18A 5HETA 2IWQA 4Q6SA 2CSJA 1QLCA 4YYXA 2I1NA 1U39A 5B6LA 3SHWA 1OZIA 3NGHA 2FN5A 4HOPB 2YT8A 3ZRTA 2RCZA 2VRFA 3GJ9A 1NF3C 1RGRA 2K20A 2LOBA 3MH4A 3K82A 5E22A 2HE4A 4P0CA 2W7RA 1RY4A 1TQ3A 3GCOA 4OAJA 2IWNA 2D92A 2LC6A 3LNYA 1WI4A 4JOJA 3GGEA 3ID4A 1VA8A 2F5YA 1OBXA 2PNTA 1SOTA 3R69A 3RLEA 1QAUA 2KL1A 2OPGA 3RL7A 2EAQA 2M0UA 1WHAA 2WL7A 3RL8A 2FCFA 2QKTA 1Q3OA 3CBYA 4RI0A 1WH1A 3KHFA 1X5NA 4JOPA 3GSLA 4FLNA 3CBXA 4NMVA 2LUIA 4O06A 3QGLA 4JOHA 4NNLA 4JOEA 2M0ZA 1X9ZA 2JREA 1LCYA 3KZDA 2F0AA 5FB8C 1MC7A 2REYA 1WF8A 2YT7A 2PZDA 4MPAA 2QKUA 3E17A 2DKRA 2PKUA 4NXRA 4Q2QA 2KOMA 2MX6A 2D8IA 4WYUA 1B8QA 2EEGA 1Z87A 4NXQA 2QBWA 2BYGA 2DLSA 4IC6A 2EXGA 4GHNA 5B42A 2OQSA 4N6XA 3KZEA 1WJLA 5G1EA 3CH8A 3GDSA 3VQFA 2HGAA 2ZPLA 3CBZA 1VJ6A 2R3YA 4XHVA 1W9OA 3MH6A 1FC7A 1Q7XA 1OBZA 2PDZA 2VWRA 2DM8A 2W4FA 2JOAA 2I04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IWO A;  4Q2O A;  2KG2 A;  3JXT A;  3O5N A;  2EEJ A;  3GDU A;  1I16 A;  2H2B A;  3DJ3 A;  5HFE A;  3GDV A;  2DJT A;  4H11 A;  1N7F A;  4Z33 A;  1VAE A;  2H3L A;  3O46 A;  2FE5 A;  5EZ0 A;  4KFW A;  5F3X A;  4YDP A;  1N6D A;  1UEQ A;  4G69 A;  1SOZ A;  2QKV A;  1N7E A;  2Z17 A;  2KOJ A;  3WKM A;  2VZ5 A;  3CYY A;  5E11 A;  2DMZ A;  1G9O A;  5E21 A;  1FC6 A;  1GQ4 A;  3SHU A;  4K76 A;  3HVQ C;  2L97 A;  1M5Z A;  1V62 A;  2M0V A;  2FNE A;  3NFL A;  2EHR A;  2H3M A;  1W9Q A;  4K78 A;  3PDZ A;  2QT5 A;  2KPK A;  2YUB A;  1UF1 A;  2G2L A;  4HOP A;  3OU0 A;  2EDV A;  4Q2N A;  3AXA A;  2EEH A;  1FC9 A;  2P3W A;  5I7Z A;  2MHO A;  2JXO A;  1U38 A;  2JIN A;  5H3J A;  2PA1 A;  4E34 A;  1UFX A;  2X7Z A;  4K6Y A;  2Q3G A;  4OEO A;  5EYZ A;  2EGK A;  1GM1 A;  5F67 A;  3DIW A;  4JL7 A;  5HEB A;  3I4W A;  3CS0 A;  4OEP A;  5HDY A;  5JXB A;  3EGH C;  3QIK A;  4KFV A;  1BE9 A;  2OGP A;  1UEZ A;  5E1Y A;  4K72 A;  5HFC A;  1UJU A;  5GND A;  4L8N A;  1MFG A;  2R4H A;  2Z9I A;  1WF7 A;  1WG6 A;  1UM1 A;  3TSV A;  4F8K A;  2H2C A;  2K1Z A;  2L4T A;  1MFL A;  1P1E A;  2AIN A;  2M3M A;  2O2T A;  1P1D A;  5E6P B;  3TMH A;  3HPK A;  3SFJ A;  2OMJ A;  5HFD A;  1N99 A;  1TP5 A;  4GVC A;  3SUZ A;  1TE0 A;  2EEI A;  2I6V A;  2KJP A;  1QAV A;  2QG1 A;  2KJK A;  2I0I A;  5D13 A;  3SOE A;  1D5G A;  4JOF A;  1UM7 A;  4JOG A;  5HED A;  1X5Q A;  1RZX A;  1X8S A;  1X6D A;  2CSS A;  2DB5 A;  2OZF A;  4JOK A;  1L6O A;  1OBY A;  1IU2 A;  1UEP A;  2RRM A;  2IWP A;  2AWW A;  1ZUB A;  3ID3 A;  2ENO A;  2Q9V A;  3QJN A;  4NMS A;  2KV8 A;  2D90 A;  1FCF A;  3NFK A;  3TSW A;  3K50 A;  2EJY A;  4NMR A;  3GCN A;  2KAW A;  3VQG A;  4WYT A;  1T2M A;  4EDJ A;  1WHD A;  1Y7N A;  2KBS A;  1BFE A;  1Y8T A;  4JOR A;  1UJD A;  3B76 A;  3QDO A;  1UJV A;  2LC7 A;  1R6J A;  3R0H A;  1VB7 A;  5HF1 A;  4R2Z A;  1VCW A;  1KWA A;  3MH7 A;  4NMO A;  4PQW A;  1NTE A;  3QE1 A;  2E7K A;  1UIT A;  5HF4 A;  4FGM A;  2JIK A;  3DJ1 A;  2EGO A;  3L4F D;  2EDP A;  3QO6 A;  2YTW A;  3CC0 A;  1U37 A;  2KJD A;  5G1D A;  5HFF A;  5A2P A;  2V1W A;  4Q3H A;  2VSP A;  5HFB A;  4NXP A;  5HJ1 A;  1IHJ A;  2M0T A;  4NMQ A;  1Q3P A;  2KPL A;  3BPU A;  3HPM A;  2EV8 A;  1KY9 A;  2DC2 A;  1GQ5 A;  2OCS A;  1N7T A;  4GVD A;  2VSV A;  4NMT A;  4P2A B;  3R68 A;  1WI2 A;  1N6E A;  2KRG A;  2JIL A;  2G5M B;  5FHT A;  3FY5 A;  1V6B A;  4E35 A;  3PDV A;  4Q6H A;  2KOH A;  2LA8 A;  2L4S A;  2AWU A;  3STJ A;  1K32 A;  3EGG C;  4Q2P A;  3TSZ A;  1X45 A;  1W9E A;  4AMH A;  4Z8J A;  1UHP A;  2KQF A;  3OTP A;  1RGW A;  4K75 A;  4NNM A;  1V1T A;  3I1E A;  3ID2 A;  5GLJ A;  2DLU A;  2GZV A;  3PS4 A;  2EGN A;  4NMP A;  3WKL A;  1YBO A;  2ZPM A;  2OSG A;  1PDR A;  2PKT A;  1QAV B;  2AWX A;  1V5Q A;  1TP3 A;  1Z86 A;  3LNX A;  2V90 A;  1IU0 A;  3QJM A;  2UZC A;  2HE2 A;  3DJA A;  1XZ9 A;  1I92 A;  3DOR A;  1WFG A;  4E3B A;  3PV2 A;  2I4S A;  2DAZ A;  1WFV A;  1V5L A;  4REY A;  2EDZ A;  3PV4 A;  4LMM A;  2CS5 A;  2I0L A;  1WIF A;  2M10 A;  1N6F A;  1ZOK A;  5HEY A;  2KA9 A;  4UU6 A;  2YUY A;  1X5R A;  2KYL A;  4UU5 A;  3ID1 A;  2VPH A;  2OS6 A;  1UEW A;  3PV5 A;  1U3B A;  1KEF A;  3K1R A;  5DTH A;  2JWE A;  3I18 A;  5HET A;  2IWQ A;  4Q6S A;  2CSJ A;  1QLC A;  4YYX A;  2I1N A;  1U39 A;  5B6L A;  3SHW A;  1OZI A;  3NGH A;  2FN5 A;  4HOP B;  2YT8 A;  3ZRT A;  2RCZ A;  2VRF A;  3GJ9 A;  1NF3 C;  1RGR A;  2K20 A;  2LOB A;  3MH4 A;  3K82 A;  5E22 A;  2HE4 A;  4P0C A;  2W7R A;  1RY4 A;  1TQ3 A;  3GCO A;  4OAJ A;  2IWN A;  2D92 A;  2LC6 A;  3LNY A;  1WI4 A;  4JOJ A;  3GGE A;  3ID4 A;  1VA8 A;  2F5Y A;  1OBX A;  2PNT A;  1SOT A;  3R69 A;  3RLE A;  1QAU A;  2KL1 A;  2OPG A;  3RL7 A;  2EAQ A;  2M0U A;  1WHA A;  2WL7 A;  3RL8 A;  2FCF A;  2QKT A;  1Q3O A;  3CBY A;  4RI0 A;  1WH1 A;  3KHF A;  1X5N A;  4JOP A;  3GSL A;  3CBX A;  4NMV A;  2LUI A;  4O06 A;  3QGL A;  4JOH A;  4NNL A;  4JOE A;  2M0Z A;  3KZD A;  2JRE A;  1LCY A;  2F0A A;  5FB8 C;  1MC7 A;  2REY A;  1WF8 A;  2YT7 A;  2PZD A;  4MPA A;  2QKU A;  3E17 A;  2DKR A;  2PKU A;  4NXR A;  4Q2Q A;  2KOM A;  2MX6 A;  2D8I A;  4WYU A;  1B8Q A;  2EEG A;  1Z87 A;  4NXQ A;  2QBW A;  2BYG A;  2DLS A;  4IC6 A;  2EXG A;  4GHN A;  2OQS A;  4N6X A;  3KZE A;  1WJL A;  5G1E A;  3CH8 A;  3GDS A;  3VQF A;  2HGA A;  2ZPL A;  3CBZ A;  1VJ6 A;  2R3Y A;  4XHV A;  1W9O A;  3MH6 A;  1FC7 A;  1Q7X A;  1OBZ A;  2PDZ A;  2VWR A;  2DM8 A;  2W4F A;  2JOA A;  2I04 A; 
#chains in the Genus database with same CATH topology
 2IWO A;  4Q2O A;  2KG2 A;  3JXT A;  3O5N A;  2EEJ A;  3GDU A;  1I16 A;  2H2B A;  3DJ3 A;  5HFE A;  3GDV A;  2DJT A;  4H11 A;  1N7F A;  3GAB A;  4Z33 A;  1VAE A;  2H3L A;  3O46 A;  2FE5 A;  5EZ0 A;  4KFW A;  5F3X A;  4YDP A;  1N6D A;  1UEQ A;  4G69 A;  1SOZ A;  2QKV A;  1N7E A;  2Z17 A;  2KOJ A;  3WKM A;  2VZ5 A;  3CYY A;  5E11 A;  2DMZ A;  1G9O A;  5E21 A;  1FC6 A;  1GQ4 A;  3SHU A;  4K76 A;  3HVQ C;  2L97 A;  1M5Z A;  1V62 A;  2M0V A;  2FNE A;  3NFL A;  2EHR A;  2H3M A;  1W9Q A;  4K78 A;  3PDZ A;  2QT5 A;  2KPK A;  2YUB A;  1UF1 A;  2G2L A;  4HOP A;  3OU0 A;  2EDV A;  4Q2N A;  3AXA A;  2EEH A;  1FC9 A;  2P3W A;  5I7Z A;  2MHO A;  2JXO A;  1U38 A;  2JIN A;  5H3J A;  2PA1 A;  4E34 A;  1UFX A;  2X7Z A;  4K6Y A;  2Q3G A;  4OEO A;  5EYZ A;  2EGK A;  1GM1 A;  5F67 A;  3DIW A;  4JL7 A;  3KDK A;  5HEB A;  3I4W A;  3CS0 A;  4OEP A;  5HDY A;  5JXB A;  3EGH C;  3QIK A;  4KFV A;  1BE9 A;  2OGP A;  1UEZ A;  5E1Y A;  4K72 A;  5HFC A;  1UJU A;  5IL9 A;  5GND A;  4L8N A;  1MFG A;  2R4H A;  2Z9I A;  1WF7 A;  1WG6 A;  1UM1 A;  3TSV A;  4F8K A;  2H2C A;  2K1Z A;  2L4T A;  1MFL A;  1P1E A;  2AIN A;  2M3M A;  2O2T A;  1P1D A;  5E6P B;  3TMH A;  3HPK A;  3SFJ A;  2OMJ A;  5HFD A;  1N99 A;  1TP5 A;  4GVC A;  3SUZ A;  1TE0 A;  2EEI A;  2I6V A;  2KJP A;  1QAV A;  2QG1 A;  2KJK A;  2I0I A;  5D13 A;  3SOE A;  1D5G A;  4JOF A;  1UM7 A;  4JOG A;  5HED A;  1X5Q A;  1RZX A;  1X8S A;  1X6D A;  2CSS A;  2DB5 A;  2OZF A;  4JOK A;  1L6O A;  1OBY A;  1IU2 A;  1UEP A;  2RRM A;  2IWP A;  2AWW A;  1ZUB A;  2ENO A;  3ID3 A;  2Q9V A;  3QJN A;  4NMS A;  2KV8 A;  4JJ0 A;  2D90 A;  1FCF A;  3NFK A;  3TSW A;  3K50 A;  2EJY A;  4NMR A;  3GCN A;  2KAW A;  3VQG A;  4WYT A;  1T2M A;  4EDJ A;  1WHD A;  1Y7N A;  2KBS A;  1BFE A;  1Y8T A;  4JOR A;  1UJD A;  3B76 A;  2GEF A;  3QDO A;  1UJV A;  2LC7 A;  1R6J A;  3R0H A;  1VB7 A;  5HF1 A;  4JJ3 A;  4R2Z A;  1VCW A;  1KWA A;  3MH7 A;  4NMO A;  4PQW A;  1NTE A;  3QE1 A;  2E7K A;  1UIT A;  5HF4 A;  4FGM A;  2JIK A;  3DJ1 A;  2EGO A;  3L4F D;  2EDP A;  3QO6 A;  2YTW A;  3CC0 A;  1U37 A;  2KJD A;  5G1D A;  5HFF A;  5A2P A;  2V1W A;  4Q3H A;  2VSP A;  5HFB A;  4NXP A;  5HJ1 A;  1IHJ A;  2M0T A;  4NMQ A;  1Q3P A;  2KPL A;  3BPU A;  3HPM A;  2EV8 A;  1KY9 A;  2DC2 A;  1GQ5 A;  2OCS A;  1N7T A;  4GVD A;  2VSV A;  4NMT A;  4P2A B;  3R68 A;  1WI2 A;  1N6E A;  2KRG A;  2JIL A;  2G5M B;  5FHT A;  3FY5 A;  1V6B A;  4E35 A;  3PDV A;  5ILB A;  4Q6H A;  2KOH A;  2LA8 A;  2L4S A;  2AWU A;  3STJ A;  1K32 A;  3EGG C;  2JSN A;  4Q2P A;  3TSZ A;  1X45 A;  1W9E A;  4AMH A;  4Z8J A;  1UHP A;  2KQF A;  3OTP A;  1RGW A;  4K75 A;  4NNM A;  1V1T A;  3I1E A;  3ID2 A;  5GLJ A;  2DLU A;  2GZV A;  3PS4 A;  2EGN A;  4NMP A;  3WKL A;  1YBO A;  2ZPM A;  2OSG A;  1PDR A;  2PKT A;  1QAV B;  2AWX A;  1V5Q A;  1TP3 A;  1Z86 A;  3LNX A;  2V90 A;  1IU0 A;  3QJM A;  2UZC A;  2HE2 A;  3DJA A;  1XZ9 A;  1I92 A;  3DOR A;  1WFG A;  4E3B A;  3PV2 A;  2I4S A;  2DAZ A;  1WFV A;  1V5L A;  4REY A;  3NCV A;  2EDZ A;  3PV4 A;  4LMM A;  2CS5 A;  2I0L A;  1WIF A;  2M10 A;  1N6F A;  1ZOK A;  5HEY A;  2KA9 A;  4UU6 A;  2YUY A;  1X5R A;  2KYL A;  4UU5 A;  3ID1 A;  2VPH A;  2OS6 A;  1UEW A;  3PV5 A;  1U3B A;  1KEF A;  3K1R A;  5DTH A;  3KDG A;  2JWE A;  3I18 A;  5HET A;  2IWQ A;  4Q6S A;  2CSJ A;  1QLC A;  4YYX A;  2I1N A;  1U39 A;  5B6L A;  3SHW A;  1OZI A;  3NGH A;  2FN5 A;  4HOP B;  2YT8 A;  3ZRT A;  2RCZ A;  2VRF A;  3GJ9 A;  1NF3 C;  1RGR A;  2K20 A;  2LOB A;  3MH4 A;  3K82 A;  5E22 A;  2HE4 A;  4P0C A;  2W7R A;  1RY4 A;  1TQ3 A;  3GCO A;  4OAJ A;  2IWN A;  2D92 A;  2LC6 A;  3LNY A;  1WI4 A;  4JOJ A;  3GGE A;  3ID4 A;  1VA8 A;  2F5Y A;  1OBX A;  2PNT A;  1SOT A;  3R69 A;  3RLE A;  1QAU A;  2KL1 A;  2OPG A;  3RL7 A;  2EAQ A;  2M0U A;  1WHA A;  2WL7 A;  3RL8 A;  2FCF A;  2QKT A;  1Q3O A;  3CBY A;  4RI0 A;  1WH1 A;  3KHF A;  1X5N A;  4JOP A;  3GSL A;  4FLN A;  3CBX A;  4NMV A;  2LUI A;  4O06 A;  3QGL A;  4JOH A;  4NNL A;  4JOE A;  2M0Z A;  1X9Z A;  2JRE A;  1LCY A;  3KZD A;  2F0A A;  5FB8 C;  1MC7 A;  2REY A;  1WF8 A;  2YT7 A;  2PZD A;  4MPA A;  2QKU A;  3E17 A;  2DKR A;  2PKU A;  4NXR A;  4Q2Q A;  2KOM A;  2MX6 A;  2D8I A;  4WYU A;  1B8Q A;  2EEG A;  1Z87 A;  4NXQ A;  2QBW A;  2BYG A;  2DLS A;  4IC6 A;  2EXG A;  4GHN A;  5B42 A;  2OQS A;  4N6X A;  3KZE A;  1WJL A;  5G1E A;  3CH8 A;  3GDS A;  3VQF A;  2HGA A;  2ZPL A;  3CBZ A;  1VJ6 A;  2R3Y A;  4XHV A;  1W9O A;  3MH6 A;  1FC7 A;  1Q7X A;  1OBZ A;  2PDZ A;  2VWR A;  2DM8 A;  2W4F A;  2JOA A;  2I04 A; 
#chains in the Genus database with same CATH homology
 2IWO A;  4Q2O A;  2KG2 A;  3JXT A;  3O5N A;  2EEJ A;  3GDU A;  1I16 A;  2H2B A;  3DJ3 A;  5HFE A;  3GDV A;  2DJT A;  4H11 A;  1N7F A;  3GAB A;  4Z33 A;  1VAE A;  2H3L A;  3O46 A;  2FE5 A;  5EZ0 A;  4KFW A;  5F3X A;  4YDP A;  1N6D A;  1UEQ A;  4G69 A;  1SOZ A;  2QKV A;  1N7E A;  2Z17 A;  2KOJ A;  3WKM A;  2VZ5 A;  3CYY A;  5E11 A;  2DMZ A;  1G9O A;  5E21 A;  1FC6 A;  1GQ4 A;  3SHU A;  4K76 A;  3HVQ C;  2L97 A;  1M5Z A;  1V62 A;  2M0V A;  2FNE A;  3NFL A;  2EHR A;  2H3M A;  1W9Q A;  4K78 A;  3PDZ A;  2QT5 A;  2KPK A;  2YUB A;  1UF1 A;  2G2L A;  4HOP A;  3OU0 A;  2EDV A;  4Q2N A;  3AXA A;  2EEH A;  1FC9 A;  2P3W A;  5I7Z A;  2MHO A;  2JXO A;  1U38 A;  2JIN A;  5H3J A;  2PA1 A;  4E34 A;  1UFX A;  2X7Z A;  4K6Y A;  2Q3G A;  4OEO A;  5EYZ A;  2EGK A;  1GM1 A;  5F67 A;  3DIW A;  4JL7 A;  3KDK A;  5HEB A;  3I4W A;  3CS0 A;  4OEP A;  5HDY A;  5JXB A;  3EGH C;  3QIK A;  4KFV A;  1BE9 A;  2OGP A;  1UEZ A;  5E1Y A;  4K72 A;  5HFC A;  1UJU A;  5IL9 A;  5GND A;  4L8N A;  1MFG A;  2R4H A;  2Z9I A;  1WF7 A;  1WG6 A;  1UM1 A;  3TSV A;  4F8K A;  2H2C A;  2K1Z A;  2L4T A;  1MFL A;  1P1E A;  2AIN A;  2M3M A;  2O2T A;  1P1D A;  5E6P B;  3TMH A;  3HPK A;  3SFJ A;  2OMJ A;  5HFD A;  1N99 A;  1TP5 A;  4GVC A;  3SUZ A;  1TE0 A;  2EEI A;  2I6V A;  2KJP A;  1QAV A;  2QG1 A;  2KJK A;  2I0I A;  5D13 A;  3SOE A;  1D5G A;  4JOF A;  1UM7 A;  4JOG A;  5HED A;  1X5Q A;  1RZX A;  1X8S A;  1X6D A;  2CSS A;  2DB5 A;  2OZF A;  4JOK A;  1L6O A;  1OBY A;  1IU2 A;  1UEP A;  2RRM A;  2IWP A;  2AWW A;  1ZUB A;  2ENO A;  3ID3 A;  2Q9V A;  3QJN A;  4NMS A;  2KV8 A;  4JJ0 A;  2D90 A;  1FCF A;  3NFK A;  3TSW A;  3K50 A;  2EJY A;  4NMR A;  3GCN A;  2KAW A;  3VQG A;  4WYT A;  1T2M A;  4EDJ A;  1WHD A;  1Y7N A;  2KBS A;  1BFE A;  1Y8T A;  4JOR A;  1UJD A;  3B76 A;  2GEF A;  3QDO A;  1UJV A;  2LC7 A;  1R6J A;  3R0H A;  1VB7 A;  5HF1 A;  4JJ3 A;  4R2Z A;  1VCW A;  1KWA A;  3MH7 A;  4NMO A;  4PQW A;  1NTE A;  3QE1 A;  2E7K A;  1UIT A;  5HF4 A;  4FGM A;  2JIK A;  3DJ1 A;  2EGO A;  3L4F D;  2EDP A;  3QO6 A;  2YTW A;  3CC0 A;  1U37 A;  2KJD A;  5G1D A;  5HFF A;  5A2P A;  2V1W A;  4Q3H A;  2VSP A;  5HFB A;  4NXP A;  5HJ1 A;  1IHJ A;  2M0T A;  4NMQ A;  1Q3P A;  2KPL A;  3BPU A;  3HPM A;  2EV8 A;  1KY9 A;  2DC2 A;  1GQ5 A;  2OCS A;  1N7T A;  4GVD A;  2VSV A;  4NMT A;  4P2A B;  3R68 A;  1WI2 A;  1N6E A;  2KRG A;  2JIL A;  2G5M B;  5FHT A;  3FY5 A;  1V6B A;  4E35 A;  3PDV A;  5ILB A;  4Q6H A;  2KOH A;  2LA8 A;  2L4S A;  2AWU A;  3STJ A;  1K32 A;  3EGG C;  2JSN A;  4Q2P A;  3TSZ A;  1X45 A;  1W9E A;  4AMH A;  4Z8J A;  1UHP A;  2KQF A;  3OTP A;  1RGW A;  4K75 A;  4NNM A;  1V1T A;  3I1E A;  3ID2 A;  5GLJ A;  2DLU A;  2GZV A;  3PS4 A;  2EGN A;  4NMP A;  3WKL A;  1YBO A;  2ZPM A;  2OSG A;  1PDR A;  2PKT A;  1QAV B;  2AWX A;  1V5Q A;  1TP3 A;  1Z86 A;  3LNX A;  2V90 A;  1IU0 A;  3QJM A;  2UZC A;  2HE2 A;  3DJA A;  1XZ9 A;  1I92 A;  3DOR A;  1WFG A;  4E3B A;  3PV2 A;  2I4S A;  2DAZ A;  1WFV A;  1V5L A;  4REY A;  3NCV A;  2EDZ A;  3PV4 A;  4LMM A;  2CS5 A;  2I0L A;  1WIF A;  2M10 A;  1N6F A;  1ZOK A;  5HEY A;  2KA9 A;  4UU6 A;  2YUY A;  1X5R A;  2KYL A;  4UU5 A;  3ID1 A;  2VPH A;  2OS6 A;  1UEW A;  3PV5 A;  1U3B A;  1KEF A;  3K1R A;  5DTH A;  3KDG A;  2JWE A;  3I18 A;  5HET A;  2IWQ A;  4Q6S A;  2CSJ A;  1QLC A;  4YYX A;  2I1N A;  1U39 A;  5B6L A;  3SHW A;  1OZI A;  3NGH A;  2FN5 A;  4HOP B;  2YT8 A;  3ZRT A;  2RCZ A;  2VRF A;  3GJ9 A;  1NF3 C;  1RGR A;  2K20 A;  2LOB A;  3MH4 A;  3K82 A;  5E22 A;  2HE4 A;  4P0C A;  2W7R A;  1RY4 A;  1TQ3 A;  3GCO A;  4OAJ A;  2IWN A;  2D92 A;  2LC6 A;  3LNY A;  1WI4 A;  4JOJ A;  3GGE A;  3ID4 A;  1VA8 A;  2F5Y A;  1OBX A;  2PNT A;  1SOT A;  3R69 A;  3RLE A;  1QAU A;  2KL1 A;  2OPG A;  3RL7 A;  2EAQ A;  2M0U A;  1WHA A;  2WL7 A;  3RL8 A;  2FCF A;  2QKT A;  1Q3O A;  3CBY A;  4RI0 A;  1WH1 A;  3KHF A;  1X5N A;  4JOP A;  3GSL A;  4FLN A;  3CBX A;  4NMV A;  2LUI A;  4O06 A;  3QGL A;  4JOH A;  4NNL A;  4JOE A;  2M0Z A;  1X9Z A;  2JRE A;  1LCY A;  3KZD A;  2F0A A;  5FB8 C;  1MC7 A;  2REY A;  1WF8 A;  2YT7 A;  2PZD A;  4MPA A;  2QKU A;  3E17 A;  2DKR A;  2PKU A;  4NXR A;  4Q2Q A;  2KOM A;  2MX6 A;  2D8I A;  4WYU A;  1B8Q A;  2EEG A;  1Z87 A;  4NXQ A;  2QBW A;  2BYG A;  2DLS A;  4IC6 A;  2EXG A;  4GHN A;  5B42 A;  2OQS A;  4N6X A;  3KZE A;  1WJL A;  5G1E A;  3CH8 A;  3GDS A;  3VQF A;  2HGA A;  2ZPL A;  3CBZ A;  1VJ6 A;  2R3Y A;  4XHV A;  1W9O A;  3MH6 A;  1FC7 A;  1Q7X A;  1OBZ A;  2PDZ A;  2VWR A;  2DM8 A;  2W4F A;  2JOA A;  2I04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...