2OGPA

Solution structure of the second pdz domain of par-3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
KRVGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning-defective 3 homolog
publication title PDZ domains of par-3 as potential phosphoinositide signaling integrators
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2007-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2ogpA00
2YT7A 2I0LA 3ID1A 5HF4A 1R6JA 3TSWA 1W9QA 2P3WA 4Q3HA 2JXOA 2FNEA 2DLSA 1Z87A 1WIFA 4MPAA 5EYZA 5E6PB 1WG6A 4NMVA 1N7EA 1TP5A 2OZFA 4Z33A 2MHOA 4K78A 1RGRA 2AINA 3DJ1A 4JOHA 2QT5A 1BE9A 1OZIA 2OGPA 2EGOA 2W4FA 1Y7NA 1RGWA 2EHRA 1ZUBA 4K75A 1MFGA 4NMPA 3RL7A 4Z8JA 5EZ0A 3MH7A 1NTEA 5HEDA 3PV4A 4IC6A 1PDRA 3GJ9A 2I6VA 2IWNA 4E34A 1UFXA 3DJ3A 5A2PA 2REYA 4AMHA 4Q2PA 1N6DA 3QO6A 3SFJA 5HFDA 2EXGA 5F3XA 2H3MA 2PZDA 3PV2A 4Q6HA 2KA9A 2O2TA 2MX6A 1X5QA 2DJTA 3GGEA 2EDVA 4GVDA 4LMMA 2EEJA 2M0ZA 5E22A 4FGMA 5HF1A 1I16A 3TSZA 4JOFA 1P1DA 3I18A 1GM1A 1KY9A 1UJUA 2UZCA 2LOBA 2HGAA 1UITA 5F67A 3KHFA 2H3LA 1N7TA 3TMHA 4NMQA 3SUZA 2VWRA 2JILA 4OEOA 3ID4A 1I92A 4E3BA 2QG1A 3QJMA 4JOPA 1X8SA 2CSSA 2RRMA 3TSVA 3LNXA 1UM1A 5FHTA 2JOAA 2IWPA 2OCSA 2YUYA 1TP3A 1YBOA 2M3MA 1U38A 1GQ4A 4K76A 2G2LA 4G69A 1Z86A 2IWOA 5JXBA 1U39A 3AXAA 4K6YA 5GLJA 1IU0A 3O46A 1U37A 2V90A 5HFBA 2EV8A 3CYYA 3NFKA 3DIWA 4NNMA 4PQWA 3CBXA 4GHNA 2LA8A 1SOZA 2EEIA 2JINA 2F0AA 1UF1A 2FCFA 4NXPA 2KOHA 1WI2A 3GDUA 3QE1A 4KFVA 4Q2NA 5HETA 2KAWA 2E7KA 2EGKA 2QKUA 2YTWA 4NMOA 5B6LA 1UEWA 2R3YA 3EGGC 3RL8A 4XHVA 3VQFA 3HPMA 2K20A 3I4WA 4GVCA 1WHDA 2Q9VA 1UJDA 2L97A 3STJA 1X45A 1VA8A 3HVQC 2VSVA 1X5NA 3JXTA 5E1YA 2L4SA 1UEZA 4HOPA 1OBXA 5HFFA 2DC2A 4NXRA 1QAVB 2KRGA 1W9EA 5HJ1A 3VQGA 4UU5A 3SHUA 4YYXA 3ID3A 3EGHC 3PS4A 1V6BA 1B8QA 2JWEA 2M0TA 1WFGA 3LNYA 3O5NA 3CH8A 1TQ3A 1FC9A 2FE5A 2GZVA 2JREA 2OSGA 2DAZA 2I1NA 3QGLA 5I7ZA 1RY4A 3CBZA 4WYTA 1NF3C 3B76A 4N6XA 2K1ZA 4Q2OA 1UM7A 3R0HA 2KPKA 1LCYA 3GDVA 3MH4A 3R68A 5HEYA 2AWXA 2PNTA 4E35A 3PDVA 1Q7XA 2KG2A 1FC7A 3PDZA 2CS5A 3KZDA 4KFWA 3SOEA 2I4SA 3K1RA 1XZ9A 5DTHA 2LC6A 2YT8A 4NMTA 2Z9IA 2AWUA 1G9OA 1FC6A 2CSJA 1L6OA 4JOEA 1WH1A 1WF8A 2DMZA 5H3JA 1VCWA 1U3BA 4F8KA 1Y8TA 2EJYA 2R4HA 2EAQA 3I1EA 2ZPMA 5HDYA 2DLUA 3MH6A 2Z17A 1IU2A 2OS6A 1WFVA 2YUBA 2H2CA 2AWWA 1D5GA 1MC7A 2KJKA 1K32A 2IWQA 4P0CA 3PV5A 2KOJA 3CS0A 2OMJA 2W7RA 2DB5A 3WKMA 4JOJA 3RLEA 2VZ5A 5E21A 1N6FA 1X5RA 1WF7A 3OTPA 2HE4A 2I04A 3WKLA 2X7ZA 3R69A 1Q3PA 3KZEA 2LUIA 2KYLA 3K50A 2L4TA 4EDJA 3QDOA 2M0UA 3CBYA 1UJVA 4NNLA 2ZPLA 5GNDA 2VSPA 2D92A 2RCZA 1KWAA 1V5LA 2KV8A 4UU6A 1Q3OA 3BPUA 3ID2A 1OBZA 2QBWA 2JIKA 5HFCA 2I0IA 1GQ5A 2PKUA 4JOKA 4JOGA 4JORA 2OQSA 1W9OA 1TE0A 1UHPA 1RZXA 2V1WA 1MFLA 1UEPA 4H11A 2QKVA 4O06A 2D8IA 3GCOA 4WYUA 2VRFA 1P1EA 3QJNA 2VPHA 2G5MB 5G1DA 3GSLA 1WI4A 3SHWA 2QKTA 3DJAA 2EEGA 2F5YA 2DKRA 2D90A 2FN5A 2Q3GA 1N6EA 3L4FD 4REYA 2H2BA 1FCFA 3QIKA 5HEBA 3OU0A 1KEFA 1WJLA 1VJ6A 1X6DA 4NXQA 2EDZA 2KJPA 3GDSA 1BFEA 1N7FA 4NMRA 1M5ZA 5FB8C 2KBSA 3CC0A 4L8NA 4Q2QA 3E17A 1VB7A 2PKTA 2KOMA 1V62A 2ENOA 2PA1A 2HE2A 2DM8A 3HPKA 1T2MA 5D13A 4NMSA 4R2ZA 1QAVA 1V5QA 2PDZA 3K82A 1SOTA 2WL7A 2KL1A 5HFEA 4OAJA 1V1TA 4P2AB 1ZOKA 1QLCA 5G1EA 2BYGA 3NFLA 2KJDA 4HOPB 1UEQA 2EDPA 4OEPA 2M0VA 3GCNA 4Q6SA 3ZRTA 5E11A 2EEHA 1VAEA 2KQFA 4YDPA 2M10A 2OPGA 4JL7A 2EGNA 1N99A 1OBYA 3NGHA 2LC7A 4K72A 3FY5A 1IHJA 3DORA 4RI0A 1QAUA 2KPLA 1WHAA
chains in the Genus database with same CATH superfamily
2YT7A 2I0LA 3ID1A 5HF4A 1R6JA 3TSWA 1W9QA 2P3WA 4Q3HA 2JXOA 2FNEA 2DLSA 1Z87A 1WIFA 4MPAA 5EYZA 5E6PB 1WG6A 4NMVA 1N7EA 1TP5A 2OZFA 4Z33A 2MHOA 4K78A 4JJ3A 1RGRA 2AINA 3DJ1A 4JOHA 2QT5A 1BE9A 1OZIA 2OGPA 2EGOA 2W4FA 1Y7NA 1RGWA 2EHRA 1ZUBA 4K75A 1MFGA 4NMPA 3RL7A 4Z8JA 5EZ0A 3MH7A 1NTEA 5HEDA 3PV4A 4IC6A 1PDRA 3GJ9A 2I6VA 2IWNA 4E34A 1UFXA 3DJ3A 5A2PA 2REYA 4AMHA 4Q2PA 1N6DA 3QO6A 3SFJA 5HFDA 2EXGA 2GEFA 5F3XA 2H3MA 2PZDA 3PV2A 4Q6HA 2KA9A 2O2TA 2MX6A 1X5QA 2DJTA 3GGEA 2EDVA 4GVDA 4LMMA 2EEJA 2M0ZA 5E22A 4FGMA 5HF1A 1I16A 3TSZA 4JOFA 1P1DA 3I18A 1GM1A 1KY9A 1UJUA 2UZCA 2LOBA 2HGAA 1UITA 5F67A 3KHFA 2H3LA 1N7TA 3TMHA 4NMQA 3SUZA 2VWRA 2JILA 4OEOA 3ID4A 1I92A 4E3BA 2QG1A 4FLNA 3QJMA 4JOPA 1X8SA 2CSSA 2RRMA 3TSVA 3LNXA 1UM1A 5FHTA 2JOAA 2IWPA 2OCSA 2YUYA 1TP3A 1YBOA 2M3MA 1U38A 1GQ4A 4K76A 2G2LA 4G69A 1Z86A 2IWOA 5JXBA 1U39A 3AXAA 4K6YA 5GLJA 1IU0A 5ILBA 3O46A 1U37A 2V90A 5HFBA 2EV8A 3CYYA 3NFKA 3DIWA 4NNMA 4PQWA 3CBXA 4GHNA 2LA8A 1SOZA 2EEIA 2JINA 2F0AA 1UF1A 2FCFA 4NXPA 2KOHA 1WI2A 3GDUA 3QE1A 4KFVA 4Q2NA 5HETA 2KAWA 2E7KA 2EGKA 2QKUA 2YTWA 4NMOA 5B6LA 1UEWA 2R3YA 3EGGC 3KDKA 4XHVA 3RL8A 3VQFA 3HPMA 2K20A 3I4WA 4GVCA 1WHDA 2Q9VA 1UJDA 2L97A 3STJA 1X45A 1VA8A 3HVQC 2VSVA 1X5NA 3JXTA 5E1YA 2L4SA 1UEZA 4HOPA 1OBXA 5HFFA 2DC2A 4NXRA 1QAVB 2KRGA 1W9EA 5HJ1A 3VQGA 4UU5A 3SHUA 4YYXA 3ID3A 3EGHC 3PS4A 1V6BA 1B8QA 1X9ZA 2JWEA 2M0TA 1WFGA 3LNYA 3O5NA 3CH8A 1TQ3A 1FC9A 2FE5A 2GZVA 2JREA 2OSGA 2DAZA 2I1NA 3QGLA 5I7ZA 1RY4A 3CBZA 4WYTA 1NF3C 3B76A 4N6XA 2K1ZA 5B42A 4Q2OA 1UM7A 3R0HA 2KPKA 1LCYA 3GDVA 3MH4A 3R68A 5HEYA 2AWXA 2PNTA 4E35A 3PDVA 1Q7XA 2KG2A 1FC7A 3PDZA 2CS5A 3KZDA 4KFWA 3SOEA 2I4SA 3K1RA 1XZ9A 5DTHA 2LC6A 2YT8A 4NMTA 2Z9IA 2AWUA 1G9OA 1FC6A 2CSJA 1L6OA 4JOEA 1WH1A 1WF8A 2DMZA 5H3JA 1VCWA 1U3BA 4F8KA 1Y8TA 2EJYA 2R4HA 2EAQA 3I1EA 2ZPMA 5HDYA 5IL9A 2DLUA 3MH6A 2Z17A 1IU2A 2OS6A 1WFVA 2YUBA 2H2CA 2AWWA 1D5GA 1MC7A 2KJKA 1K32A 2IWQA 4P0CA 3PV5A 2KOJA 3CS0A 2OMJA 2W7RA 2DB5A 3WKMA 4JOJA 3RLEA 2VZ5A 5E21A 1N6FA 1X5RA 1WF7A 3OTPA 2HE4A 2I04A 3WKLA 2X7ZA 3R69A 1Q3PA 3KZEA 2LUIA 2KYLA 3K50A 2L4TA 4EDJA 3QDOA 2M0UA 3CBYA 1UJVA 4NNLA 2ZPLA 5GNDA 2VSPA 2D92A 2RCZA 1KWAA 1V5LA 2KV8A 4UU6A 1Q3OA 3BPUA 3ID2A 1OBZA 2QBWA 2JIKA 5HFCA 2I0IA 1GQ5A 2PKUA 4JOKA 4JOGA 4JORA 2OQSA 1W9OA 1TE0A 1UHPA 1RZXA 2V1WA 1MFLA 1UEPA 4H11A 2QKVA 4O06A 2D8IA 3GCOA 4JJ0A 4WYUA 2VRFA 1P1EA 3QJNA 2VPHA 2G5MB 5G1DA 3GSLA 1WI4A 3SHWA 2QKTA 3DJAA 2EEGA 2F5YA 2DKRA 2D90A 2FN5A 2Q3GA 1N6EA 2JSNA 3L4FD 4REYA 2H2BA 1FCFA 3QIKA 5HEBA 3OU0A 1KEFA 1WJLA 1VJ6A 1X6DA 4NXQA 3KDGA 2EDZA 2KJPA 3GDSA 1BFEA 1N7FA 4NMRA 1M5ZA 5FB8C 2KBSA 3CC0A 4L8NA 4Q2QA 3E17A 3GABA 1VB7A 2PKTA 3NCVA 2KOMA 1V62A 2ENOA 2PA1A 2HE2A 2DM8A 3HPKA 1T2MA 5D13A 4NMSA 4R2ZA 1QAVA 1V5QA 2PDZA 3K82A 1SOTA 2WL7A 2KL1A 5HFEA 4OAJA 1V1TA 4P2AB 1ZOKA 1QLCA 5G1EA 2BYGA 3NFLA 2KJDA 4HOPB 1UEQA 2EDPA 4OEPA 2M0VA 3GCNA 4Q6SA 3ZRTA 5E11A 2EEHA 1VAEA 2KQFA 4YDPA 2M10A 2OPGA 4JL7A 2EGNA 1N99A 1OBYA 3NGHA 2LC7A 4K72A 3FY5A 1IHJA 3DORA 4RI0A 1QAUA 2KPLA 1WHAA
chains in the Genus database with same CATH topology
2YT7A 2I0LA 3ID1A 5HF4A 1R6JA 3TSWA 1W9QA 2P3WA 4Q3HA 2JXOA 2FNEA 2DLSA 1Z87A 1WIFA 4MPAA 5EYZA 5E6PB 1WG6A 4NMVA 1N7EA 1TP5A 2OZFA 4Z33A 2MHOA 4K78A 4JJ3A 1RGRA 2AINA 3DJ1A 4JOHA 2QT5A 1BE9A 1OZIA 2OGPA 2EGOA 2W4FA 1Y7NA 1RGWA 2EHRA 1ZUBA 4K75A 1MFGA 4NMPA 3RL7A 4Z8JA 5EZ0A 3MH7A 1NTEA 5HEDA 3PV4A 4IC6A 1PDRA 3GJ9A 2I6VA 2IWNA 4E34A 1UFXA 3DJ3A 5A2PA 2REYA 4AMHA 4Q2PA 1N6DA 3QO6A 3SFJA 5HFDA 2EXGA 2GEFA 5F3XA 2H3MA 2PZDA 3PV2A 4Q6HA 2KA9A 2O2TA 2MX6A 1X5QA 2DJTA 3GGEA 2EDVA 4GVDA 4LMMA 2EEJA 2M0ZA 5E22A 4FGMA 5HF1A 1I16A 3TSZA 4JOFA 1P1DA 3I18A 1GM1A 1KY9A 1UJUA 2UZCA 2LOBA 2HGAA 1UITA 5F67A 3KHFA 2H3LA 1N7TA 3TMHA 4NMQA 3SUZA 2VWRA 2JILA 4OEOA 3ID4A 1I92A 4E3BA 2QG1A 4FLNA 3QJMA 4JOPA 1X8SA 2CSSA 2RRMA 3TSVA 3LNXA 1UM1A 5FHTA 2JOAA 2IWPA 2OCSA 2YUYA 1TP3A 1YBOA 2M3MA 1U38A 1GQ4A 4K76A 2G2LA 4G69A 1Z86A 2IWOA 5JXBA 1U39A 3AXAA 4K6YA 5GLJA 1IU0A 5ILBA 3O46A 1U37A 2V90A 5HFBA 2EV8A 3CYYA 3NFKA 3DIWA 4NNMA 4PQWA 3CBXA 4GHNA 2LA8A 1SOZA 2EEIA 2JINA 2F0AA 1UF1A 2FCFA 4NXPA 2KOHA 1WI2A 3GDUA 3QE1A 4KFVA 4Q2NA 5HETA 2KAWA 2E7KA 2EGKA 2QKUA 2YTWA 4NMOA 5B6LA 1UEWA 2R3YA 3EGGC 3KDKA 4XHVA 3RL8A 3VQFA 3HPMA 2K20A 3I4WA 4GVCA 1WHDA 2Q9VA 1UJDA 2L97A 3STJA 1X45A 1VA8A 3HVQC 2VSVA 1X5NA 3JXTA 5E1YA 2L4SA 1UEZA 4HOPA 1OBXA 5HFFA 2DC2A 4NXRA 1QAVB 2KRGA 1W9EA 5HJ1A 3VQGA 4UU5A 3SHUA 4YYXA 3ID3A 3EGHC 3PS4A 1V6BA 1B8QA 1X9ZA 2JWEA 2M0TA 1WFGA 3LNYA 3O5NA 3CH8A 1TQ3A 1FC9A 2FE5A 2GZVA 2JREA 2OSGA 2DAZA 2I1NA 3QGLA 5I7ZA 1RY4A 3CBZA 4WYTA 1NF3C 3B76A 4N6XA 2K1ZA 5B42A 4Q2OA 1UM7A 3R0HA 2KPKA 1LCYA 3GDVA 3MH4A 3R68A 5HEYA 2AWXA 2PNTA 4E35A 3PDVA 1Q7XA 2KG2A 1FC7A 3PDZA 2CS5A 3KZDA 4KFWA 3SOEA 2I4SA 3K1RA 1XZ9A 5DTHA 2LC6A 2YT8A 4NMTA 2Z9IA 2AWUA 1G9OA 1FC6A 2CSJA 1L6OA 4JOEA 1WH1A 1WF8A 2DMZA 5H3JA 1VCWA 1U3BA 4F8KA 1Y8TA 2EJYA 2R4HA 2EAQA 3I1EA 2ZPMA 5HDYA 5IL9A 2DLUA 3MH6A 2Z17A 1IU2A 2OS6A 1WFVA 2YUBA 2H2CA 2AWWA 1D5GA 1MC7A 2KJKA 1K32A 2IWQA 4P0CA 3PV5A 2KOJA 3CS0A 2OMJA 2W7RA 2DB5A 3WKMA 4JOJA 3RLEA 2VZ5A 5E21A 1N6FA 1X5RA 1WF7A 3OTPA 2HE4A 2I04A 3WKLA 2X7ZA 3R69A 1Q3PA 3KZEA 2LUIA 2KYLA 3K50A 2L4TA 4EDJA 3QDOA 2M0UA 3CBYA 1UJVA 4NNLA 2ZPLA 5GNDA 2VSPA 2D92A 2RCZA 1KWAA 1V5LA 2KV8A 4UU6A 1Q3OA 3BPUA 3ID2A 1OBZA 2QBWA 2JIKA 5HFCA 2I0IA 1GQ5A 2PKUA 4JOKA 4JOGA 4JORA 2OQSA 1W9OA 1TE0A 1UHPA 1RZXA 2V1WA 1MFLA 1UEPA 4H11A 2QKVA 4O06A 2D8IA 3GCOA 4JJ0A 4WYUA 2VRFA 1P1EA 3QJNA 2VPHA 2G5MB 5G1DA 3GSLA 1WI4A 3SHWA 2QKTA 3DJAA 2EEGA 2F5YA 2DKRA 2D90A 2FN5A 2Q3GA 1N6EA 2JSNA 3L4FD 4REYA 2H2BA 1FCFA 3QIKA 5HEBA 3OU0A 1KEFA 1WJLA 1VJ6A 1X6DA 4NXQA 3KDGA 2EDZA 2KJPA 3GDSA 1BFEA 1N7FA 4NMRA 1M5ZA 5FB8C 2KBSA 3CC0A 4L8NA 4Q2QA 3E17A 3GABA 1VB7A 2PKTA 3NCVA 2KOMA 1V62A 2ENOA 2PA1A 2HE2A 2DM8A 3HPKA 1T2MA 5D13A 4NMSA 4R2ZA 1QAVA 1V5QA 2PDZA 3K82A 1SOTA 2WL7A 2KL1A 5HFEA 4OAJA 1V1TA 4P2AB 1ZOKA 1QLCA 5G1EA 2BYGA 3NFLA 2KJDA 4HOPB 1UEQA 2EDPA 4OEPA 2M0VA 3GCNA 4Q6SA 3ZRTA 5E11A 2EEHA 1VAEA 2KQFA 4YDPA 2M10A 2OPGA 4JL7A 2EGNA 1N99A 1OBYA 3NGHA 2LC7A 4K72A 3FY5A 1IHJA 3DORA 4RI0A 1QAUA 2KPLA 1WHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YT7 A;  2I0L A;  3ID1 A;  5HF4 A;  1R6J A;  3TSW A;  1W9Q A;  2P3W A;  4Q3H A;  2JXO A;  2FNE A;  2DLS A;  1Z87 A;  1WIF A;  4MPA A;  5EYZ A;  5E6P B;  1WG6 A;  4NMV A;  1N7E A;  1TP5 A;  2OZF A;  4Z33 A;  2MHO A;  4K78 A;  1RGR A;  2AIN A;  3DJ1 A;  4JOH A;  2QT5 A;  1BE9 A;  1OZI A;  2OGP A;  2EGO A;  2W4F A;  1Y7N A;  1RGW A;  2EHR A;  1ZUB A;  4K75 A;  1MFG A;  4NMP A;  3RL7 A;  4Z8J A;  5EZ0 A;  3MH7 A;  1NTE A;  5HED A;  3PV4 A;  4IC6 A;  1PDR A;  3GJ9 A;  2I6V A;  2IWN A;  4E34 A;  1UFX A;  3DJ3 A;  5A2P A;  2REY A;  4AMH A;  4Q2P A;  1N6D A;  3QO6 A;  3SFJ A;  5HFD A;  2EXG A;  5F3X A;  2H3M A;  2PZD A;  3PV2 A;  4Q6H A;  2KA9 A;  2O2T A;  2MX6 A;  1X5Q A;  2DJT A;  3GGE A;  2EDV A;  4GVD A;  4LMM A;  2EEJ A;  2M0Z A;  5E22 A;  4FGM A;  5HF1 A;  1I16 A;  3TSZ A;  4JOF A;  1P1D A;  3I18 A;  1GM1 A;  1KY9 A;  1UJU A;  2UZC A;  2LOB A;  2HGA A;  1UIT A;  5F67 A;  3KHF A;  2H3L A;  1N7T A;  3TMH A;  4NMQ A;  3SUZ A;  2VWR A;  2JIL A;  4OEO A;  3ID4 A;  1I92 A;  4E3B A;  2QG1 A;  3QJM A;  4JOP A;  1X8S A;  2CSS A;  2RRM A;  3TSV A;  3LNX A;  1UM1 A;  5FHT A;  2JOA A;  2IWP A;  2OCS A;  2YUY A;  1TP3 A;  1YBO A;  2M3M A;  1U38 A;  1GQ4 A;  4K76 A;  2G2L A;  4G69 A;  1Z86 A;  2IWO A;  5JXB A;  1U39 A;  3AXA A;  4K6Y A;  5GLJ A;  1IU0 A;  3O46 A;  1U37 A;  2V90 A;  5HFB A;  2EV8 A;  3CYY A;  3NFK A;  3DIW A;  4NNM A;  4PQW A;  3CBX A;  4GHN A;  2LA8 A;  1SOZ A;  2EEI A;  2JIN A;  2F0A A;  1UF1 A;  2FCF A;  4NXP A;  2KOH A;  1WI2 A;  3GDU A;  3QE1 A;  4KFV A;  4Q2N A;  5HET A;  2KAW A;  2E7K A;  2EGK A;  2QKU A;  2YTW A;  4NMO A;  5B6L A;  1UEW A;  2R3Y A;  3EGG C;  3RL8 A;  4XHV A;  3VQF A;  3HPM A;  2K20 A;  3I4W A;  4GVC A;  1WHD A;  2Q9V A;  1UJD A;  2L97 A;  3STJ A;  1X45 A;  1VA8 A;  3HVQ C;  2VSV A;  1X5N A;  3JXT A;  5E1Y A;  2L4S A;  1UEZ A;  4HOP A;  1OBX A;  5HFF A;  2DC2 A;  4NXR A;  1QAV B;  2KRG A;  1W9E A;  5HJ1 A;  3VQG A;  4UU5 A;  3SHU A;  4YYX A;  3ID3 A;  3EGH C;  3PS4 A;  1V6B A;  1B8Q A;  2JWE A;  2M0T A;  1WFG A;  3LNY A;  3O5N A;  3CH8 A;  1TQ3 A;  1FC9 A;  2FE5 A;  2GZV A;  2JRE A;  2OSG A;  2DAZ A;  2I1N A;  3QGL A;  5I7Z A;  1RY4 A;  3CBZ A;  4WYT A;  1NF3 C;  3B76 A;  4N6X A;  2K1Z A;  4Q2O A;  1UM7 A;  3R0H A;  2KPK A;  1LCY A;  3GDV A;  3MH4 A;  3R68 A;  5HEY A;  2AWX A;  2PNT A;  4E35 A;  3PDV A;  1Q7X A;  2KG2 A;  1FC7 A;  3PDZ A;  2CS5 A;  3KZD A;  4KFW A;  3SOE A;  2I4S A;  3K1R A;  1XZ9 A;  5DTH A;  2LC6 A;  2YT8 A;  4NMT A;  2Z9I A;  2AWU A;  1G9O A;  1FC6 A;  2CSJ A;  1L6O A;  4JOE A;  1WH1 A;  1WF8 A;  2DMZ A;  5H3J A;  1VCW A;  1U3B A;  4F8K A;  1Y8T A;  2EJY A;  2R4H A;  2EAQ A;  3I1E A;  2ZPM A;  5HDY A;  2DLU A;  3MH6 A;  2Z17 A;  1IU2 A;  2OS6 A;  1WFV A;  2YUB A;  2H2C A;  2AWW A;  1D5G A;  1MC7 A;  2KJK A;  1K32 A;  2IWQ A;  4P0C A;  3PV5 A;  2KOJ A;  3CS0 A;  2OMJ A;  2W7R A;  2DB5 A;  3WKM A;  4JOJ A;  3RLE A;  2VZ5 A;  5E21 A;  1N6F A;  1X5R A;  1WF7 A;  3OTP A;  2HE4 A;  2I04 A;  3WKL A;  2X7Z A;  3R69 A;  1Q3P A;  3KZE A;  2LUI A;  2KYL A;  3K50 A;  2L4T A;  4EDJ A;  3QDO A;  2M0U A;  3CBY A;  1UJV A;  4NNL A;  2ZPL A;  5GND A;  2VSP A;  2D92 A;  2RCZ A;  1KWA A;  1V5L A;  2KV8 A;  4UU6 A;  1Q3O A;  3BPU A;  3ID2 A;  1OBZ A;  2QBW A;  2JIK A;  5HFC A;  2I0I A;  1GQ5 A;  2PKU A;  4JOK A;  4JOG A;  4JOR A;  2OQS A;  1W9O A;  1TE0 A;  1UHP A;  1RZX A;  2V1W A;  1MFL A;  1UEP A;  4H11 A;  2QKV A;  4O06 A;  2D8I A;  3GCO A;  4WYU A;  2VRF A;  1P1E A;  3QJN A;  2VPH A;  2G5M B;  5G1D A;  3GSL A;  1WI4 A;  3SHW A;  2QKT A;  3DJA A;  2EEG A;  2F5Y A;  2DKR A;  2D90 A;  2FN5 A;  2Q3G A;  1N6E A;  3L4F D;  4REY A;  2H2B A;  1FCF A;  3QIK A;  5HEB A;  3OU0 A;  1KEF A;  1WJL A;  1VJ6 A;  1X6D A;  4NXQ A;  2EDZ A;  2KJP A;  3GDS A;  1BFE A;  1N7F A;  4NMR A;  1M5Z A;  5FB8 C;  2KBS A;  3CC0 A;  4L8N A;  4Q2Q A;  3E17 A;  1VB7 A;  2PKT A;  2KOM A;  1V62 A;  2ENO A;  2PA1 A;  2HE2 A;  2DM8 A;  3HPK A;  1T2M A;  5D13 A;  4NMS A;  4R2Z A;  1QAV A;  1V5Q A;  2PDZ A;  3K82 A;  1SOT A;  2WL7 A;  2KL1 A;  5HFE A;  4OAJ A;  1V1T A;  4P2A B;  1ZOK A;  1QLC A;  5G1E A;  2BYG A;  3NFL A;  2KJD A;  4HOP B;  1UEQ A;  2EDP A;  4OEP A;  2M0V A;  3GCN A;  4Q6S A;  3ZRT A;  5E11 A;  2EEH A;  1VAE A;  2KQF A;  4YDP A;  2M10 A;  2OPG A;  4JL7 A;  2EGN A;  1N99 A;  1OBY A;  3NGH A;  2LC7 A;  4K72 A;  3FY5 A;  1IHJ A;  3DOR A;  4RI0 A;  1QAU A;  2KPL A;  1WHA A; 
#chains in the Genus database with same CATH topology
 2YT7 A;  2I0L A;  3ID1 A;  5HF4 A;  1R6J A;  3TSW A;  1W9Q A;  2P3W A;  4Q3H A;  2JXO A;  2FNE A;  2DLS A;  1Z87 A;  1WIF A;  4MPA A;  5EYZ A;  5E6P B;  1WG6 A;  4NMV A;  1N7E A;  1TP5 A;  2OZF A;  4Z33 A;  2MHO A;  4K78 A;  4JJ3 A;  1RGR A;  2AIN A;  3DJ1 A;  4JOH A;  2QT5 A;  1BE9 A;  1OZI A;  2OGP A;  2EGO A;  2W4F A;  1Y7N A;  1RGW A;  2EHR A;  1ZUB A;  4K75 A;  1MFG A;  4NMP A;  3RL7 A;  4Z8J A;  5EZ0 A;  3MH7 A;  1NTE A;  5HED A;  3PV4 A;  4IC6 A;  1PDR A;  3GJ9 A;  2I6V A;  2IWN A;  4E34 A;  1UFX A;  3DJ3 A;  5A2P A;  2REY A;  4AMH A;  4Q2P A;  1N6D A;  3QO6 A;  3SFJ A;  5HFD A;  2EXG A;  2GEF A;  5F3X A;  2H3M A;  2PZD A;  3PV2 A;  4Q6H A;  2KA9 A;  2O2T A;  2MX6 A;  1X5Q A;  2DJT A;  3GGE A;  2EDV A;  4GVD A;  4LMM A;  2EEJ A;  2M0Z A;  5E22 A;  4FGM A;  5HF1 A;  1I16 A;  3TSZ A;  4JOF A;  1P1D A;  3I18 A;  1GM1 A;  1KY9 A;  1UJU A;  2UZC A;  2LOB A;  2HGA A;  1UIT A;  5F67 A;  3KHF A;  2H3L A;  1N7T A;  3TMH A;  4NMQ A;  3SUZ A;  2VWR A;  2JIL A;  4OEO A;  3ID4 A;  1I92 A;  4E3B A;  2QG1 A;  4FLN A;  3QJM A;  4JOP A;  1X8S A;  2CSS A;  2RRM A;  3TSV A;  3LNX A;  1UM1 A;  5FHT A;  2JOA A;  2IWP A;  2OCS A;  2YUY A;  1TP3 A;  1YBO A;  2M3M A;  1U38 A;  1GQ4 A;  4K76 A;  2G2L A;  4G69 A;  1Z86 A;  2IWO A;  5JXB A;  1U39 A;  3AXA A;  4K6Y A;  5GLJ A;  1IU0 A;  5ILB A;  3O46 A;  1U37 A;  2V90 A;  5HFB A;  2EV8 A;  3CYY A;  3NFK A;  3DIW A;  4NNM A;  4PQW A;  3CBX A;  4GHN A;  2LA8 A;  1SOZ A;  2EEI A;  2JIN A;  2F0A A;  1UF1 A;  2FCF A;  4NXP A;  2KOH A;  1WI2 A;  3GDU A;  3QE1 A;  4KFV A;  4Q2N A;  5HET A;  2KAW A;  2E7K A;  2EGK A;  2QKU A;  2YTW A;  4NMO A;  5B6L A;  1UEW A;  2R3Y A;  3EGG C;  3KDK A;  4XHV A;  3RL8 A;  3VQF A;  3HPM A;  2K20 A;  3I4W A;  4GVC A;  1WHD A;  2Q9V A;  1UJD A;  2L97 A;  3STJ A;  1X45 A;  1VA8 A;  3HVQ C;  2VSV A;  1X5N A;  3JXT A;  5E1Y A;  2L4S A;  1UEZ A;  4HOP A;  1OBX A;  5HFF A;  2DC2 A;  4NXR A;  1QAV B;  2KRG A;  1W9E A;  5HJ1 A;  3VQG A;  4UU5 A;  3SHU A;  4YYX A;  3ID3 A;  3EGH C;  3PS4 A;  1V6B A;  1B8Q A;  1X9Z A;  2JWE A;  2M0T A;  1WFG A;  3LNY A;  3O5N A;  3CH8 A;  1TQ3 A;  1FC9 A;  2FE5 A;  2GZV A;  2JRE A;  2OSG A;  2DAZ A;  2I1N A;  3QGL A;  5I7Z A;  1RY4 A;  3CBZ A;  4WYT A;  1NF3 C;  3B76 A;  4N6X A;  2K1Z A;  5B42 A;  4Q2O A;  1UM7 A;  3R0H A;  2KPK A;  1LCY A;  3GDV A;  3MH4 A;  3R68 A;  5HEY A;  2AWX A;  2PNT A;  4E35 A;  3PDV A;  1Q7X A;  2KG2 A;  1FC7 A;  3PDZ A;  2CS5 A;  3KZD A;  4KFW A;  3SOE A;  2I4S A;  3K1R A;  1XZ9 A;  5DTH A;  2LC6 A;  2YT8 A;  4NMT A;  2Z9I A;  2AWU A;  1G9O A;  1FC6 A;  2CSJ A;  1L6O A;  4JOE A;  1WH1 A;  1WF8 A;  2DMZ A;  5H3J A;  1VCW A;  1U3B A;  4F8K A;  1Y8T A;  2EJY A;  2R4H A;  2EAQ A;  3I1E A;  2ZPM A;  5HDY A;  5IL9 A;  2DLU A;  3MH6 A;  2Z17 A;  1IU2 A;  2OS6 A;  1WFV A;  2YUB A;  2H2C A;  2AWW A;  1D5G A;  1MC7 A;  2KJK A;  1K32 A;  2IWQ A;  4P0C A;  3PV5 A;  2KOJ A;  3CS0 A;  2OMJ A;  2W7R A;  2DB5 A;  3WKM A;  4JOJ A;  3RLE A;  2VZ5 A;  5E21 A;  1N6F A;  1X5R A;  1WF7 A;  3OTP A;  2HE4 A;  2I04 A;  3WKL A;  2X7Z A;  3R69 A;  1Q3P A;  3KZE A;  2LUI A;  2KYL A;  3K50 A;  2L4T A;  4EDJ A;  3QDO A;  2M0U A;  3CBY A;  1UJV A;  4NNL A;  2ZPL A;  5GND A;  2VSP A;  2D92 A;  2RCZ A;  1KWA A;  1V5L A;  2KV8 A;  4UU6 A;  1Q3O A;  3BPU A;  3ID2 A;  1OBZ A;  2QBW A;  2JIK A;  5HFC A;  2I0I A;  1GQ5 A;  2PKU A;  4JOK A;  4JOG A;  4JOR A;  2OQS A;  1W9O A;  1TE0 A;  1UHP A;  1RZX A;  2V1W A;  1MFL A;  1UEP A;  4H11 A;  2QKV A;  4O06 A;  2D8I A;  3GCO A;  4JJ0 A;  4WYU A;  2VRF A;  1P1E A;  3QJN A;  2VPH A;  2G5M B;  5G1D A;  3GSL A;  1WI4 A;  3SHW A;  2QKT A;  3DJA A;  2EEG A;  2F5Y A;  2DKR A;  2D90 A;  2FN5 A;  2Q3G A;  1N6E A;  2JSN A;  3L4F D;  4REY A;  2H2B A;  1FCF A;  3QIK A;  5HEB A;  3OU0 A;  1KEF A;  1WJL A;  1VJ6 A;  1X6D A;  4NXQ A;  3KDG A;  2EDZ A;  2KJP A;  3GDS A;  1BFE A;  1N7F A;  4NMR A;  1M5Z A;  5FB8 C;  2KBS A;  3CC0 A;  4L8N A;  4Q2Q A;  3E17 A;  3GAB A;  1VB7 A;  2PKT A;  3NCV A;  2KOM A;  1V62 A;  2ENO A;  2PA1 A;  2HE2 A;  2DM8 A;  3HPK A;  1T2M A;  5D13 A;  4NMS A;  4R2Z A;  1QAV A;  1V5Q A;  2PDZ A;  3K82 A;  1SOT A;  2WL7 A;  2KL1 A;  5HFE A;  4OAJ A;  1V1T A;  4P2A B;  1ZOK A;  1QLC A;  5G1E A;  2BYG A;  3NFL A;  2KJD A;  4HOP B;  1UEQ A;  2EDP A;  4OEP A;  2M0V A;  3GCN A;  4Q6S A;  3ZRT A;  5E11 A;  2EEH A;  1VAE A;  2KQF A;  4YDP A;  2M10 A;  2OPG A;  4JL7 A;  2EGN A;  1N99 A;  1OBY A;  3NGH A;  2LC7 A;  4K72 A;  3FY5 A;  1IHJ A;  3DOR A;  4RI0 A;  1QAU A;  2KPL A;  1WHA A; 
#chains in the Genus database with same CATH homology
 2YT7 A;  2I0L A;  3ID1 A;  5HF4 A;  1R6J A;  3TSW A;  1W9Q A;  2P3W A;  4Q3H A;  2JXO A;  2FNE A;  2DLS A;  1Z87 A;  1WIF A;  4MPA A;  5EYZ A;  5E6P B;  1WG6 A;  4NMV A;  1N7E A;  1TP5 A;  2OZF A;  4Z33 A;  2MHO A;  4K78 A;  4JJ3 A;  1RGR A;  2AIN A;  3DJ1 A;  4JOH A;  2QT5 A;  1BE9 A;  1OZI A;  2OGP A;  2EGO A;  2W4F A;  1Y7N A;  1RGW A;  2EHR A;  1ZUB A;  4K75 A;  1MFG A;  4NMP A;  3RL7 A;  4Z8J A;  5EZ0 A;  3MH7 A;  1NTE A;  5HED A;  3PV4 A;  4IC6 A;  1PDR A;  3GJ9 A;  2I6V A;  2IWN A;  4E34 A;  1UFX A;  3DJ3 A;  5A2P A;  2REY A;  4AMH A;  4Q2P A;  1N6D A;  3QO6 A;  3SFJ A;  5HFD A;  2EXG A;  2GEF A;  5F3X A;  2H3M A;  2PZD A;  3PV2 A;  4Q6H A;  2KA9 A;  2O2T A;  2MX6 A;  1X5Q A;  2DJT A;  3GGE A;  2EDV A;  4GVD A;  4LMM A;  2EEJ A;  2M0Z A;  5E22 A;  4FGM A;  5HF1 A;  1I16 A;  3TSZ A;  4JOF A;  1P1D A;  3I18 A;  1GM1 A;  1KY9 A;  1UJU A;  2UZC A;  2LOB A;  2HGA A;  1UIT A;  5F67 A;  3KHF A;  2H3L A;  1N7T A;  3TMH A;  4NMQ A;  3SUZ A;  2VWR A;  2JIL A;  4OEO A;  3ID4 A;  1I92 A;  4E3B A;  2QG1 A;  4FLN A;  3QJM A;  4JOP A;  1X8S A;  2CSS A;  2RRM A;  3TSV A;  3LNX A;  1UM1 A;  5FHT A;  2JOA A;  2IWP A;  2OCS A;  2YUY A;  1TP3 A;  1YBO A;  2M3M A;  1U38 A;  1GQ4 A;  4K76 A;  2G2L A;  4G69 A;  1Z86 A;  2IWO A;  5JXB A;  1U39 A;  3AXA A;  4K6Y A;  5GLJ A;  1IU0 A;  5ILB A;  3O46 A;  1U37 A;  2V90 A;  5HFB A;  2EV8 A;  3CYY A;  3NFK A;  3DIW A;  4NNM A;  4PQW A;  3CBX A;  4GHN A;  2LA8 A;  1SOZ A;  2EEI A;  2JIN A;  2F0A A;  1UF1 A;  2FCF A;  4NXP A;  2KOH A;  1WI2 A;  3GDU A;  3QE1 A;  4KFV A;  4Q2N A;  5HET A;  2KAW A;  2E7K A;  2EGK A;  2QKU A;  2YTW A;  4NMO A;  5B6L A;  1UEW A;  2R3Y A;  3EGG C;  3KDK A;  4XHV A;  3RL8 A;  3VQF A;  3HPM A;  2K20 A;  3I4W A;  4GVC A;  1WHD A;  2Q9V A;  1UJD A;  2L97 A;  3STJ A;  1X45 A;  1VA8 A;  3HVQ C;  2VSV A;  1X5N A;  3JXT A;  5E1Y A;  2L4S A;  1UEZ A;  4HOP A;  1OBX A;  5HFF A;  2DC2 A;  4NXR A;  1QAV B;  2KRG A;  1W9E A;  5HJ1 A;  3VQG A;  4UU5 A;  3SHU A;  4YYX A;  3ID3 A;  3EGH C;  3PS4 A;  1V6B A;  1B8Q A;  1X9Z A;  2JWE A;  2M0T A;  1WFG A;  3LNY A;  3O5N A;  3CH8 A;  1TQ3 A;  1FC9 A;  2FE5 A;  2GZV A;  2JRE A;  2OSG A;  2DAZ A;  2I1N A;  3QGL A;  5I7Z A;  1RY4 A;  3CBZ A;  4WYT A;  1NF3 C;  3B76 A;  4N6X A;  2K1Z A;  5B42 A;  4Q2O A;  1UM7 A;  3R0H A;  2KPK A;  1LCY A;  3GDV A;  3MH4 A;  3R68 A;  5HEY A;  2AWX A;  2PNT A;  4E35 A;  3PDV A;  1Q7X A;  2KG2 A;  1FC7 A;  3PDZ A;  2CS5 A;  3KZD A;  4KFW A;  3SOE A;  2I4S A;  3K1R A;  1XZ9 A;  5DTH A;  2LC6 A;  2YT8 A;  4NMT A;  2Z9I A;  2AWU A;  1G9O A;  1FC6 A;  2CSJ A;  1L6O A;  4JOE A;  1WH1 A;  1WF8 A;  2DMZ A;  5H3J A;  1VCW A;  1U3B A;  4F8K A;  1Y8T A;  2EJY A;  2R4H A;  2EAQ A;  3I1E A;  2ZPM A;  5HDY A;  5IL9 A;  2DLU A;  3MH6 A;  2Z17 A;  1IU2 A;  2OS6 A;  1WFV A;  2YUB A;  2H2C A;  2AWW A;  1D5G A;  1MC7 A;  2KJK A;  1K32 A;  2IWQ A;  4P0C A;  3PV5 A;  2KOJ A;  3CS0 A;  2OMJ A;  2W7R A;  2DB5 A;  3WKM A;  4JOJ A;  3RLE A;  2VZ5 A;  5E21 A;  1N6F A;  1X5R A;  1WF7 A;  3OTP A;  2HE4 A;  2I04 A;  3WKL A;  2X7Z A;  3R69 A;  1Q3P A;  3KZE A;  2LUI A;  2KYL A;  3K50 A;  2L4T A;  4EDJ A;  3QDO A;  2M0U A;  3CBY A;  1UJV A;  4NNL A;  2ZPL A;  5GND A;  2VSP A;  2D92 A;  2RCZ A;  1KWA A;  1V5L A;  2KV8 A;  4UU6 A;  1Q3O A;  3BPU A;  3ID2 A;  1OBZ A;  2QBW A;  2JIK A;  5HFC A;  2I0I A;  1GQ5 A;  2PKU A;  4JOK A;  4JOG A;  4JOR A;  2OQS A;  1W9O A;  1TE0 A;  1UHP A;  1RZX A;  2V1W A;  1MFL A;  1UEP A;  4H11 A;  2QKV A;  4O06 A;  2D8I A;  3GCO A;  4JJ0 A;  4WYU A;  2VRF A;  1P1E A;  3QJN A;  2VPH A;  2G5M B;  5G1D A;  3GSL A;  1WI4 A;  3SHW A;  2QKT A;  3DJA A;  2EEG A;  2F5Y A;  2DKR A;  2D90 A;  2FN5 A;  2Q3G A;  1N6E A;  2JSN A;  3L4F D;  4REY A;  2H2B A;  1FCF A;  3QIK A;  5HEB A;  3OU0 A;  1KEF A;  1WJL A;  1VJ6 A;  1X6D A;  4NXQ A;  3KDG A;  2EDZ A;  2KJP A;  3GDS A;  1BFE A;  1N7F A;  4NMR A;  1M5Z A;  5FB8 C;  2KBS A;  3CC0 A;  4L8N A;  4Q2Q A;  3E17 A;  3GAB A;  1VB7 A;  2PKT A;  3NCV A;  2KOM A;  1V62 A;  2ENO A;  2PA1 A;  2HE2 A;  2DM8 A;  3HPK A;  1T2M A;  5D13 A;  4NMS A;  4R2Z A;  1QAV A;  1V5Q A;  2PDZ A;  3K82 A;  1SOT A;  2WL7 A;  2KL1 A;  5HFE A;  4OAJ A;  1V1T A;  4P2A B;  1ZOK A;  1QLC A;  5G1E A;  2BYG A;  3NFL A;  2KJD A;  4HOP B;  1UEQ A;  2EDP A;  4OEP A;  2M0V A;  3GCN A;  4Q6S A;  3ZRT A;  5E11 A;  2EEH A;  1VAE A;  2KQF A;  4YDP A;  2M10 A;  2OPG A;  4JL7 A;  2EGN A;  1N99 A;  1OBY A;  3NGH A;  2LC7 A;  4K72 A;  3FY5 A;  1IHJ A;  3DOR A;  4RI0 A;  1QAU A;  2KPL A;  1WHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...