2OGPA

Solution structure of the second pdz domain of par-3
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
97
structure length
97
Chain Sequence
KRVGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTVSLLVFRQEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Partitioning-defective 3 homolog
publication title PDZ domains of par-3 as potential phosphoinositide signaling integrators
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 13
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2007-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2ogpA00
3ID4A 1X5QA 3K50A 4OAJA 3TSVA 1UEWA 1X5RA 1N6DA 4NMOA 3R68A 3DJAA 3LNXA 2Q9VA 5HEDA 2DMZA 3CBXA 2PZDA 3QJNA 2H3LA 3SOEA 4YDPA 3L4FD 4NNLA 3VQFA 1X45A 2OCSA 4UU5A 4G69A 3CH8A 3ID2A 2DKRA 2CSSA 2G2LA 3FY5A 4GHNA 3GSLA 2Z17A 2D92A 4JOFA 3ID1A 4MPAA 4XHVA 4Q2OA 1LCYA 2EDPA 3KZDA 3I1EA 2KAWA 2MHOA 4NMQA 3CC0A 4K6YA 2F0AA 3PDZA 2EDZA 4KFVA 3DIWA 2KYLA 2KA9A 4JOPA 1Q7XA 1FC7A 4NMVA 2OQSA 3E17A 3I18A 1BE9A 3QO6A 5GLJA 2R4HA 5HDYA 2QKUA 2DLUA 1QAVB 2HE4A 5HFEA 4E3BA 2I6VA 3KHFA 2VRFA 2G5MB 2HE2A 4GVCA 2ZPLA 3HPKA 2KJDA 4Q2NA 1MFLA 2PDZA 5E21A 1IHJA 1VB7A 3R0HA 2EEIA 2P3WA 4Q3HA 4JOKA 3SHWA 4H11A 2LUIA 4RI0A 1TQ3A 2DB5A 4N6XA 1P1DA 1Q3PA 2KJPA 2QBWA 2M0VA 3RL7A 2OSGA 2OPGA 3O46A 3TSWA 4Q2PA 3NFLA 1FC6A 2EGKA 2M0TA 4OEPA 3QDOA 3B76A 3K1RA 1M5ZA 4HOPA 1VA8A 4NMSA 5HFDA 4NXRA 5I7ZA 4K75A 1PDRA 1UHPA 1QAUA 2OGPA 4OEOA 5FB8C 3WKMA 3OTPA 2I0LA 1W9EA 1U37A 3PS4A 3CBZA 3O5NA 2PKTA 4K72A 5HETA 3SFJA 3GCOA 2VPHA 3MH7A 3SHUA 3HPMA 1WI4A 2KRGA 4REYA 1N7TA 3CYYA 3WKLA 2QT5A 2IWQA 1N6EA 3QJMA 2EDVA 2EAQA 2EHRA 1WJLA 4F8KA 2ENOA 2L4SA 1GQ5A 3GCNA 5F3XA 1V6BA 5JXBA 3STJA 1RZXA 1V1TA 1KEFA 2JILA 1NF3C 1OBZA 4JL7A 2I04A 4K76A 5DTHA 2AWWA 1KWAA 2KBSA 2KV8A 2FN5A 3CS0A 2L97A 1UJVA 1UFXA 3DORA 2W7RA 4Z33A 2LOBA 1RGWA 3KZEA 4O06A 4NNMA 2H2CA 4FGMA 1X8SA 2LC6A 1U38A 1QLCA 3LNYA 3DJ3A 4P2AB 5GNDA 3AXAA 3I4WA 4IC6A 3PV5A 2YT7A 3GDUA 2VWRA 1D5GA 2KOMA 5FHTA 2ZPMA 2PA1A 1U3BA 3QE1A 1OBYA 2YUYA 2V1WA 1IU2A 5E22A 2OMJA 2VSPA 2V90A 5HF4A 1WIFA 3NGHA 2KOJA 1ZUBA 3QIKA 1VJ6A 3RLEA 5HEBA 4R2ZA 2F5YA 2KL1A 2VSVA 2YT8A 2DLSA 2YTWA 3TSZA 1SOZA 5E1YA 2WL7A 2EXGA 2I4SA 2AWXA 1I92A 1L6OA 1QAVA 5HFCA 2E7KA 2JINA 4NMRA 1GM1A 2BYGA 2I0IA 1VCWA 1V62A 1WI2A 4JOHA 2K20A 3NFKA 5EZ0A 1W9OA 1X6DA 2REYA 4E35A 1U39A 2JREA 1RGRA 1Q3OA 2LC7A 1FC9A 1R6JA 2M3MA 2DJTA 2O2TA 3MH4A 2AINA 4YYXA 1UM1A 2JXOA 3ZRTA 3OU0A 2EV8A 4JOEA 3EGHC 3QGLA 5G1EA 4KFWA 1T2MA 2EGNA 4HOPB 5HJ1A 2IWPA 4Q2QA 2EEHA 3TMHA 2Q3GA 2DC2A 2JOAA 2MX6A 5A2PA 3DJ1A 1TP5A 4Q6SA 1YBOA 1UEQA 2GZVA 2IWNA 1WF7A 2OZFA 5H3JA 3ID3A 4LMMA 2M10A 1UM7A 3PV4A 3GDSA 3GJ9A 5HFBA 3VQGA 2UZCA 2KPKA 2IWOA 2KPLA 1UJUA 1W9QA 2I1NA 4Z8JA 1UEZA 4JORA 3EGGC 1RY4A 1TE0A 1OBXA 1UF1A 5G1DA 1N99A 1OZIA 1BFEA 1WH1A 2L4TA 2D8IA 1WFVA 1Z87A 4P0CA 3K82A 1N7EA 3GGEA 3RL8A 3CBYA 1UITA 2PKUA 2W4FA 3HVQC 1WHDA 3GDVA 3BPUA 1Y8TA 2DM8A 4K78A 2FNEA 2AWUA 2JIKA 4NMTA 2FCFA 2EGOA 1WHAA 1WFGA 4AMHA 5EYZA 1UJDA 1I16A 2KQFA 1GQ4A 3SUZA 4L8NA 4WYUA 5HF1A 2R3YA 4JOGA 1B8QA 3JXTA 3PV2A 2KOHA 1WF8A 2KJKA 2JWEA 4NXQA 1UEPA 2K1ZA 5HEYA 2D90A 1NTEA 2QKTA 2RRMA 2EEGA 2HGAA 5E6PB 1N6FA 2VZ5A 2H2BA 1MC7A 1WG6A 4PQWA 1TP3A 2M0UA 4Q6HA 2YUBA 2QG1A 2DAZA 4NXPA 1X5NA 5B6LA 4WYTA 5HFFA 2LA8A 1SOTA 2PNTA 3R69A 2CS5A 2Z9IA 2M0ZA 1N7FA 2KG2A 2RCZA 4EDJA 5F67A 1P1EA 2H3MA 1Z86A 1Y7NA 4JOJA 1MFGA 4E34A 1KY9A 1IU0A 2EEJA 1VAEA 2EJYA 2OS6A 2CSJA 2X7ZA 1ZOKA 1V5QA 4GVDA 5E11A 3PDVA 5D13A 2QKVA 1FCFA 4UU6A 1V5LA 2FE5A 1K32A 3MH6A 1XZ9A 4NMPA 1G9OA
chains in the Genus database with same CATH superfamily
3ID4A 1X5QA 3K50A 4OAJA 3TSVA 1UEWA 1X5RA 1N6DA 4NMOA 3R68A 3DJAA 3LNXA 2Q9VA 5HEDA 2DMZA 3CBXA 2PZDA 3QJNA 2H3LA 3SOEA 4YDPA 3L4FD 4NNLA 3VQFA 1X45A 2OCSA 4UU5A 4G69A 3CH8A 3ID2A 2DKRA 2GEFA 2CSSA 2G2LA 4JJ0A 3FY5A 4GHNA 3GSLA 2Z17A 2D92A 4JOFA 3ID1A 4MPAA 4XHVA 4Q2OA 1LCYA 2EDPA 3KZDA 3I1EA 2KAWA 2MHOA 4NMQA 3CC0A 4K6YA 2F0AA 3PDZA 2EDZA 4KFVA 3KDGA 3DIWA 2KYLA 2KA9A 4JOPA 1Q7XA 1FC7A 4NMVA 2OQSA 3E17A 3I18A 1BE9A 3QO6A 5GLJA 2R4HA 5HDYA 2QKUA 2DLUA 1QAVB 2HE4A 5HFEA 4E3BA 2I6VA 3KHFA 5B42A 2VRFA 2G5MB 2HE2A 4GVCA 2ZPLA 3HPKA 2KJDA 4Q2NA 1MFLA 2PDZA 5E21A 1IHJA 1VB7A 3R0HA 2EEIA 2P3WA 4Q3HA 4JOKA 3SHWA 4H11A 2LUIA 4RI0A 1TQ3A 2DB5A 4N6XA 1P1DA 1Q3PA 2KJPA 2QBWA 2M0VA 3RL7A 2OSGA 2OPGA 3O46A 3TSWA 4Q2PA 3NFLA 1FC6A 2EGKA 2M0TA 4OEPA 3QDOA 3B76A 3K1RA 1M5ZA 4HOPA 1VA8A 4NMSA 5HFDA 4NXRA 5I7ZA 4K75A 1PDRA 1UHPA 1QAUA 2OGPA 4OEOA 5FB8C 3WKMA 3OTPA 2I0LA 1W9EA 1U37A 3PS4A 3CBZA 3O5NA 2PKTA 4K72A 5HETA 3SFJA 3GCOA 2VPHA 3MH7A 3SHUA 3HPMA 1WI4A 2KRGA 4REYA 1N7TA 3CYYA 3WKLA 2QT5A 2IWQA 1N6EA 3QJMA 2EDVA 2EAQA 2EHRA 1WJLA 4F8KA 2ENOA 2L4SA 1GQ5A 3GCNA 5F3XA 1V6BA 5JXBA 3STJA 1RZXA 1V1TA 1KEFA 2JILA 1NF3C 1OBZA 4JL7A 2I04A 4K76A 5DTHA 2AWWA 4FLNA 1KWAA 2KBSA 2KV8A 2FN5A 3CS0A 2L97A 1UJVA 1UFXA 3DORA 2W7RA 4Z33A 2LOBA 1RGWA 1X9ZA 3KZEA 4O06A 3GABA 4NNMA 2H2CA 4FGMA 1X8SA 2LC6A 1U38A 1QLCA 3LNYA 3DJ3A 4P2AB 5GNDA 3AXAA 3I4WA 4IC6A 3PV5A 2YT7A 3GDUA 2VWRA 1D5GA 2KOMA 5FHTA 2ZPMA 2PA1A 1U3BA 3QE1A 1OBYA 2YUYA 2V1WA 1IU2A 5E22A 2OMJA 2VSPA 2V90A 5HF4A 1WIFA 3NGHA 2KOJA 1ZUBA 3QIKA 1VJ6A 3RLEA 5HEBA 4R2ZA 2F5YA 2KL1A 2VSVA 2YT8A 2DLSA 2YTWA 3TSZA 1SOZA 5E1YA 2WL7A 2EXGA 2I4SA 2AWXA 1I92A 1L6OA 1QAVA 5HFCA 2E7KA 2JINA 4NMRA 1GM1A 2BYGA 2I0IA 1VCWA 1V62A 1WI2A 4JOHA 2K20A 3NFKA 5EZ0A 1W9OA 1X6DA 2REYA 4E35A 1U39A 2JREA 1RGRA 1Q3OA 2LC7A 1FC9A 1R6JA 2M3MA 2DJTA 2O2TA 3MH4A 2AINA 4YYXA 1UM1A 2JXOA 3ZRTA 3OU0A 2EV8A 4JOEA 3EGHC 3QGLA 5G1EA 4KFWA 1T2MA 2EGNA 4HOPB 5HJ1A 2IWPA 4Q2QA 2EEHA 3TMHA 2Q3GA 2DC2A 2JOAA 2MX6A 5A2PA 3DJ1A 1TP5A 4Q6SA 1YBOA 1UEQA 2GZVA 2IWNA 1WF7A 2OZFA 5H3JA 3ID3A 4LMMA 3KDKA 2M10A 1UM7A 3PV4A 3GDSA 5IL9A 3GJ9A 5HFBA 3VQGA 2UZCA 2KPKA 2IWOA 2KPLA 1UJUA 1W9QA 2I1NA 4Z8JA 1UEZA 2JSNA 4JORA 3EGGC 1RY4A 1TE0A 3NCVA 1OBXA 1UF1A 5G1DA 1N99A 1OZIA 1BFEA 1WH1A 2L4TA 2D8IA 1WFVA 1Z87A 4P0CA 3K82A 1N7EA 3GGEA 3RL8A 3CBYA 1UITA 2PKUA 2W4FA 3HVQC 1WHDA 3GDVA 3BPUA 1Y8TA 2DM8A 4K78A 2FNEA 2AWUA 2JIKA 4NMTA 2FCFA 2EGOA 1WHAA 1WFGA 4AMHA 4JJ3A 5EYZA 1UJDA 1I16A 2KQFA 1GQ4A 3SUZA 4L8NA 4WYUA 5HF1A 2R3YA 4JOGA 1B8QA 3JXTA 3PV2A 2KOHA 1WF8A 2KJKA 2JWEA 4NXQA 1UEPA 2K1ZA 5HEYA 2D90A 1NTEA 2QKTA 2RRMA 2EEGA 2HGAA 5E6PB 1N6FA 2VZ5A 2H2BA 1MC7A 1WG6A 4PQWA 1TP3A 2M0UA 4Q6HA 2YUBA 2QG1A 2DAZA 4NXPA 1X5NA 5B6LA 4WYTA 5HFFA 2LA8A 1SOTA 2PNTA 3R69A 2CS5A 2Z9IA 2M0ZA 1N7FA 2KG2A 2RCZA 4EDJA 5F67A 1P1EA 2H3MA 1Z86A 1Y7NA 4JOJA 1MFGA 4E34A 1KY9A 1IU0A 2EEJA 5ILBA 1VAEA 2EJYA 2OS6A 2CSJA 2X7ZA 1ZOKA 1V5QA 4GVDA 5E11A 3PDVA 5D13A 2QKVA 1FCFA 4UU6A 1V5LA 2FE5A 1K32A 3MH6A 1XZ9A 4NMPA 1G9OA
chains in the Genus database with same CATH topology
3ID4A 1X5QA 3K50A 4OAJA 3TSVA 1UEWA 1X5RA 1N6DA 4NMOA 3R68A 3DJAA 3LNXA 2Q9VA 5HEDA 2DMZA 3CBXA 2PZDA 3QJNA 2H3LA 3SOEA 4YDPA 3L4FD 4NNLA 3VQFA 1X45A 2OCSA 4UU5A 4G69A 3CH8A 3ID2A 2DKRA 2GEFA 2CSSA 2G2LA 4JJ0A 3FY5A 4GHNA 3GSLA 2Z17A 2D92A 4JOFA 3ID1A 4MPAA 4XHVA 4Q2OA 1LCYA 2EDPA 3KZDA 3I1EA 2KAWA 2MHOA 4NMQA 3CC0A 4K6YA 2F0AA 3PDZA 2EDZA 4KFVA 3KDGA 3DIWA 2KYLA 2KA9A 4JOPA 1Q7XA 1FC7A 4NMVA 2OQSA 3E17A 3I18A 1BE9A 3QO6A 5GLJA 2R4HA 5HDYA 2QKUA 2DLUA 1QAVB 2HE4A 5HFEA 4E3BA 2I6VA 3KHFA 5B42A 2VRFA 2G5MB 2HE2A 4GVCA 2ZPLA 3HPKA 2KJDA 4Q2NA 1MFLA 2PDZA 5E21A 1IHJA 1VB7A 3R0HA 2EEIA 2P3WA 4Q3HA 4JOKA 3SHWA 4H11A 2LUIA 4RI0A 1TQ3A 2DB5A 4N6XA 1P1DA 1Q3PA 2KJPA 2QBWA 2M0VA 3RL7A 2OSGA 2OPGA 3O46A 3TSWA 4Q2PA 3NFLA 1FC6A 2EGKA 2M0TA 4OEPA 3QDOA 3B76A 3K1RA 1M5ZA 4HOPA 1VA8A 4NMSA 5HFDA 4NXRA 5I7ZA 4K75A 1PDRA 1UHPA 1QAUA 2OGPA 4OEOA 5FB8C 3WKMA 3OTPA 2I0LA 1W9EA 1U37A 3PS4A 3CBZA 3O5NA 2PKTA 4K72A 5HETA 3SFJA 3GCOA 2VPHA 3MH7A 3SHUA 3HPMA 1WI4A 2KRGA 4REYA 1N7TA 3CYYA 3WKLA 2QT5A 2IWQA 1N6EA 3QJMA 2EDVA 2EAQA 2EHRA 1WJLA 4F8KA 2ENOA 2L4SA 1GQ5A 3GCNA 5F3XA 1V6BA 5JXBA 3STJA 1RZXA 1V1TA 1KEFA 2JILA 1NF3C 1OBZA 4JL7A 2I04A 4K76A 5DTHA 2AWWA 4FLNA 1KWAA 2KBSA 2KV8A 2FN5A 3CS0A 2L97A 1UJVA 1UFXA 3DORA 2W7RA 4Z33A 2LOBA 1RGWA 1X9ZA 3KZEA 4O06A 3GABA 4NNMA 2H2CA 4FGMA 1X8SA 2LC6A 1U38A 1QLCA 3LNYA 3DJ3A 4P2AB 5GNDA 3AXAA 3I4WA 4IC6A 3PV5A 2YT7A 3GDUA 2VWRA 1D5GA 2KOMA 5FHTA 2ZPMA 2PA1A 1U3BA 3QE1A 1OBYA 2YUYA 2V1WA 1IU2A 5E22A 2OMJA 2VSPA 2V90A 5HF4A 1WIFA 3NGHA 2KOJA 1ZUBA 3QIKA 1VJ6A 3RLEA 5HEBA 4R2ZA 2F5YA 2KL1A 2VSVA 2YT8A 2DLSA 2YTWA 3TSZA 1SOZA 5E1YA 2WL7A 2EXGA 2I4SA 2AWXA 1I92A 1L6OA 1QAVA 5HFCA 2E7KA 2JINA 4NMRA 1GM1A 2BYGA 2I0IA 1VCWA 1V62A 1WI2A 4JOHA 2K20A 3NFKA 5EZ0A 1W9OA 1X6DA 2REYA 4E35A 1U39A 2JREA 1RGRA 1Q3OA 2LC7A 1FC9A 1R6JA 2M3MA 2DJTA 2O2TA 3MH4A 2AINA 4YYXA 1UM1A 2JXOA 3ZRTA 3OU0A 2EV8A 4JOEA 3EGHC 3QGLA 5G1EA 4KFWA 1T2MA 2EGNA 4HOPB 5HJ1A 2IWPA 4Q2QA 2EEHA 3TMHA 2Q3GA 2DC2A 2JOAA 2MX6A 5A2PA 3DJ1A 1TP5A 4Q6SA 1YBOA 1UEQA 2GZVA 2IWNA 1WF7A 2OZFA 5H3JA 3ID3A 4LMMA 3KDKA 2M10A 1UM7A 3PV4A 3GDSA 5IL9A 3GJ9A 5HFBA 3VQGA 2UZCA 2KPKA 2IWOA 2KPLA 1UJUA 1W9QA 2I1NA 4Z8JA 1UEZA 2JSNA 4JORA 3EGGC 1RY4A 1TE0A 3NCVA 1OBXA 1UF1A 5G1DA 1N99A 1OZIA 1BFEA 1WH1A 2L4TA 2D8IA 1WFVA 1Z87A 4P0CA 3K82A 1N7EA 3GGEA 3RL8A 3CBYA 1UITA 2PKUA 2W4FA 3HVQC 1WHDA 3GDVA 3BPUA 1Y8TA 2DM8A 4K78A 2FNEA 2AWUA 2JIKA 4NMTA 2FCFA 2EGOA 1WHAA 1WFGA 4AMHA 4JJ3A 5EYZA 1UJDA 1I16A 2KQFA 1GQ4A 3SUZA 4L8NA 4WYUA 5HF1A 2R3YA 4JOGA 1B8QA 3JXTA 3PV2A 2KOHA 1WF8A 2KJKA 2JWEA 4NXQA 1UEPA 2K1ZA 5HEYA 2D90A 1NTEA 2QKTA 2RRMA 2EEGA 2HGAA 5E6PB 1N6FA 2VZ5A 2H2BA 1MC7A 1WG6A 4PQWA 1TP3A 2M0UA 4Q6HA 2YUBA 2QG1A 2DAZA 4NXPA 1X5NA 5B6LA 4WYTA 5HFFA 2LA8A 1SOTA 2PNTA 3R69A 2CS5A 2Z9IA 2M0ZA 1N7FA 2KG2A 2RCZA 4EDJA 5F67A 1P1EA 2H3MA 1Z86A 1Y7NA 4JOJA 1MFGA 4E34A 1KY9A 1IU0A 2EEJA 5ILBA 1VAEA 2EJYA 2OS6A 2CSJA 2X7ZA 1ZOKA 1V5QA 4GVDA 5E11A 3PDVA 5D13A 2QKVA 1FCFA 4UU6A 1V5LA 2FE5A 1K32A 3MH6A 1XZ9A 4NMPA 1G9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ID4 A;  1X5Q A;  3K50 A;  4OAJ A;  3TSV A;  1UEW A;  1X5R A;  1N6D A;  4NMO A;  3R68 A;  3DJA A;  3LNX A;  2Q9V A;  5HED A;  2DMZ A;  3CBX A;  2PZD A;  3QJN A;  2H3L A;  3SOE A;  4YDP A;  3L4F D;  4NNL A;  3VQF A;  1X45 A;  2OCS A;  4UU5 A;  4G69 A;  3CH8 A;  3ID2 A;  2DKR A;  2CSS A;  2G2L A;  3FY5 A;  4GHN A;  3GSL A;  2Z17 A;  2D92 A;  4JOF A;  3ID1 A;  4MPA A;  4XHV A;  4Q2O A;  1LCY A;  2EDP A;  3KZD A;  3I1E A;  2KAW A;  2MHO A;  4NMQ A;  3CC0 A;  4K6Y A;  2F0A A;  3PDZ A;  2EDZ A;  4KFV A;  3DIW A;  2KYL A;  2KA9 A;  4JOP A;  1Q7X A;  1FC7 A;  4NMV A;  2OQS A;  3E17 A;  3I18 A;  1BE9 A;  3QO6 A;  5GLJ A;  2R4H A;  5HDY A;  2QKU A;  2DLU A;  1QAV B;  2HE4 A;  5HFE A;  4E3B A;  2I6V A;  3KHF A;  2VRF A;  2G5M B;  2HE2 A;  4GVC A;  2ZPL A;  3HPK A;  2KJD A;  4Q2N A;  1MFL A;  2PDZ A;  5E21 A;  1IHJ A;  1VB7 A;  3R0H A;  2EEI A;  2P3W A;  4Q3H A;  4JOK A;  3SHW A;  4H11 A;  2LUI A;  4RI0 A;  1TQ3 A;  2DB5 A;  4N6X A;  1P1D A;  1Q3P A;  2KJP A;  2QBW A;  2M0V A;  3RL7 A;  2OSG A;  2OPG A;  3O46 A;  3TSW A;  4Q2P A;  3NFL A;  1FC6 A;  2EGK A;  2M0T A;  4OEP A;  3QDO A;  3B76 A;  3K1R A;  1M5Z A;  4HOP A;  1VA8 A;  4NMS A;  5HFD A;  4NXR A;  5I7Z A;  4K75 A;  1PDR A;  1UHP A;  1QAU A;  2OGP A;  4OEO A;  5FB8 C;  3WKM A;  3OTP A;  2I0L A;  1W9E A;  1U37 A;  3PS4 A;  3CBZ A;  3O5N A;  2PKT A;  4K72 A;  5HET A;  3SFJ A;  3GCO A;  2VPH A;  3MH7 A;  3SHU A;  3HPM A;  1WI4 A;  2KRG A;  4REY A;  1N7T A;  3CYY A;  3WKL A;  2QT5 A;  2IWQ A;  1N6E A;  3QJM A;  2EDV A;  2EAQ A;  2EHR A;  1WJL A;  4F8K A;  2ENO A;  2L4S A;  1GQ5 A;  3GCN A;  5F3X A;  1V6B A;  5JXB A;  3STJ A;  1RZX A;  1V1T A;  1KEF A;  2JIL A;  1NF3 C;  1OBZ A;  4JL7 A;  2I04 A;  4K76 A;  5DTH A;  2AWW A;  1KWA A;  2KBS A;  2KV8 A;  2FN5 A;  3CS0 A;  2L97 A;  1UJV A;  1UFX A;  3DOR A;  2W7R A;  4Z33 A;  2LOB A;  1RGW A;  3KZE A;  4O06 A;  4NNM A;  2H2C A;  4FGM A;  1X8S A;  2LC6 A;  1U38 A;  1QLC A;  3LNY A;  3DJ3 A;  4P2A B;  5GND A;  3AXA A;  3I4W A;  4IC6 A;  3PV5 A;  2YT7 A;  3GDU A;  2VWR A;  1D5G A;  2KOM A;  5FHT A;  2ZPM A;  2PA1 A;  1U3B A;  3QE1 A;  1OBY A;  2YUY A;  2V1W A;  1IU2 A;  5E22 A;  2OMJ A;  2VSP A;  2V90 A;  5HF4 A;  1WIF A;  3NGH A;  2KOJ A;  1ZUB A;  3QIK A;  1VJ6 A;  3RLE A;  5HEB A;  4R2Z A;  2F5Y A;  2KL1 A;  2VSV A;  2YT8 A;  2DLS A;  2YTW A;  3TSZ A;  1SOZ A;  5E1Y A;  2WL7 A;  2EXG A;  2I4S A;  2AWX A;  1I92 A;  1L6O A;  1QAV A;  5HFC A;  2E7K A;  2JIN A;  4NMR A;  1GM1 A;  2BYG A;  2I0I A;  1VCW A;  1V62 A;  1WI2 A;  4JOH A;  2K20 A;  3NFK A;  5EZ0 A;  1W9O A;  1X6D A;  2REY A;  4E35 A;  1U39 A;  2JRE A;  1RGR A;  1Q3O A;  2LC7 A;  1FC9 A;  1R6J A;  2M3M A;  2DJT A;  2O2T A;  3MH4 A;  2AIN A;  4YYX A;  1UM1 A;  2JXO A;  3ZRT A;  3OU0 A;  2EV8 A;  4JOE A;  3EGH C;  3QGL A;  5G1E A;  4KFW A;  1T2M A;  2EGN A;  4HOP B;  5HJ1 A;  2IWP A;  4Q2Q A;  2EEH A;  3TMH A;  2Q3G A;  2DC2 A;  2JOA A;  2MX6 A;  5A2P A;  3DJ1 A;  1TP5 A;  4Q6S A;  1YBO A;  1UEQ A;  2GZV A;  2IWN A;  1WF7 A;  2OZF A;  5H3J A;  3ID3 A;  4LMM A;  2M10 A;  1UM7 A;  3PV4 A;  3GDS A;  3GJ9 A;  5HFB A;  3VQG A;  2UZC A;  2KPK A;  2IWO A;  2KPL A;  1UJU A;  1W9Q A;  2I1N A;  4Z8J A;  1UEZ A;  4JOR A;  3EGG C;  1RY4 A;  1TE0 A;  1OBX A;  1UF1 A;  5G1D A;  1N99 A;  1OZI A;  1BFE A;  1WH1 A;  2L4T A;  2D8I A;  1WFV A;  1Z87 A;  4P0C A;  3K82 A;  1N7E A;  3GGE A;  3RL8 A;  3CBY A;  1UIT A;  2PKU A;  2W4F A;  3HVQ C;  1WHD A;  3GDV A;  3BPU A;  1Y8T A;  2DM8 A;  4K78 A;  2FNE A;  2AWU A;  2JIK A;  4NMT A;  2FCF A;  2EGO A;  1WHA A;  1WFG A;  4AMH A;  5EYZ A;  1UJD A;  1I16 A;  2KQF A;  1GQ4 A;  3SUZ A;  4L8N A;  4WYU A;  5HF1 A;  2R3Y A;  4JOG A;  1B8Q A;  3JXT A;  3PV2 A;  2KOH A;  1WF8 A;  2KJK A;  2JWE A;  4NXQ A;  1UEP A;  2K1Z A;  5HEY A;  2D90 A;  1NTE A;  2QKT A;  2RRM A;  2EEG A;  2HGA A;  5E6P B;  1N6F A;  2VZ5 A;  2H2B A;  1MC7 A;  1WG6 A;  4PQW A;  1TP3 A;  2M0U A;  4Q6H A;  2YUB A;  2QG1 A;  2DAZ A;  4NXP A;  1X5N A;  5B6L A;  4WYT A;  5HFF A;  2LA8 A;  1SOT A;  2PNT A;  3R69 A;  2CS5 A;  2Z9I A;  2M0Z A;  1N7F A;  2KG2 A;  2RCZ A;  4EDJ A;  5F67 A;  1P1E A;  2H3M A;  1Z86 A;  1Y7N A;  4JOJ A;  1MFG A;  4E34 A;  1KY9 A;  1IU0 A;  2EEJ A;  1VAE A;  2EJY A;  2OS6 A;  2CSJ A;  2X7Z A;  1ZOK A;  1V5Q A;  4GVD A;  5E11 A;  3PDV A;  5D13 A;  2QKV A;  1FCF A;  4UU6 A;  1V5L A;  2FE5 A;  1K32 A;  3MH6 A;  1XZ9 A;  4NMP A;  1G9O A; 
#chains in the Genus database with same CATH topology
 3ID4 A;  1X5Q A;  3K50 A;  4OAJ A;  3TSV A;  1UEW A;  1X5R A;  1N6D A;  4NMO A;  3R68 A;  3DJA A;  3LNX A;  2Q9V A;  5HED A;  2DMZ A;  3CBX A;  2PZD A;  3QJN A;  2H3L A;  3SOE A;  4YDP A;  3L4F D;  4NNL A;  3VQF A;  1X45 A;  2OCS A;  4UU5 A;  4G69 A;  3CH8 A;  3ID2 A;  2DKR A;  2GEF A;  2CSS A;  2G2L A;  4JJ0 A;  3FY5 A;  4GHN A;  3GSL A;  2Z17 A;  2D92 A;  4JOF A;  3ID1 A;  4MPA A;  4XHV A;  4Q2O A;  1LCY A;  2EDP A;  3KZD A;  3I1E A;  2KAW A;  2MHO A;  4NMQ A;  3CC0 A;  4K6Y A;  2F0A A;  3PDZ A;  2EDZ A;  4KFV A;  3KDG A;  3DIW A;  2KYL A;  2KA9 A;  4JOP A;  1Q7X A;  1FC7 A;  4NMV A;  2OQS A;  3E17 A;  3I18 A;  1BE9 A;  3QO6 A;  5GLJ A;  2R4H A;  5HDY A;  2QKU A;  2DLU A;  1QAV B;  2HE4 A;  5HFE A;  4E3B A;  2I6V A;  3KHF A;  5B42 A;  2VRF A;  2G5M B;  2HE2 A;  4GVC A;  2ZPL A;  3HPK A;  2KJD A;  4Q2N A;  1MFL A;  2PDZ A;  5E21 A;  1IHJ A;  1VB7 A;  3R0H A;  2EEI A;  2P3W A;  4Q3H A;  4JOK A;  3SHW A;  4H11 A;  2LUI A;  4RI0 A;  1TQ3 A;  2DB5 A;  4N6X A;  1P1D A;  1Q3P A;  2KJP A;  2QBW A;  2M0V A;  3RL7 A;  2OSG A;  2OPG A;  3O46 A;  3TSW A;  4Q2P A;  3NFL A;  1FC6 A;  2EGK A;  2M0T A;  4OEP A;  3QDO A;  3B76 A;  3K1R A;  1M5Z A;  4HOP A;  1VA8 A;  4NMS A;  5HFD A;  4NXR A;  5I7Z A;  4K75 A;  1PDR A;  1UHP A;  1QAU A;  2OGP A;  4OEO A;  5FB8 C;  3WKM A;  3OTP A;  2I0L A;  1W9E A;  1U37 A;  3PS4 A;  3CBZ A;  3O5N A;  2PKT A;  4K72 A;  5HET A;  3SFJ A;  3GCO A;  2VPH A;  3MH7 A;  3SHU A;  3HPM A;  1WI4 A;  2KRG A;  4REY A;  1N7T A;  3CYY A;  3WKL A;  2QT5 A;  2IWQ A;  1N6E A;  3QJM A;  2EDV A;  2EAQ A;  2EHR A;  1WJL A;  4F8K A;  2ENO A;  2L4S A;  1GQ5 A;  3GCN A;  5F3X A;  1V6B A;  5JXB A;  3STJ A;  1RZX A;  1V1T A;  1KEF A;  2JIL A;  1NF3 C;  1OBZ A;  4JL7 A;  2I04 A;  4K76 A;  5DTH A;  2AWW A;  4FLN A;  1KWA A;  2KBS A;  2KV8 A;  2FN5 A;  3CS0 A;  2L97 A;  1UJV A;  1UFX A;  3DOR A;  2W7R A;  4Z33 A;  2LOB A;  1RGW A;  1X9Z A;  3KZE A;  4O06 A;  3GAB A;  4NNM A;  2H2C A;  4FGM A;  1X8S A;  2LC6 A;  1U38 A;  1QLC A;  3LNY A;  3DJ3 A;  4P2A B;  5GND A;  3AXA A;  3I4W A;  4IC6 A;  3PV5 A;  2YT7 A;  3GDU A;  2VWR A;  1D5G A;  2KOM A;  5FHT A;  2ZPM A;  2PA1 A;  1U3B A;  3QE1 A;  1OBY A;  2YUY A;  2V1W A;  1IU2 A;  5E22 A;  2OMJ A;  2VSP A;  2V90 A;  5HF4 A;  1WIF A;  3NGH A;  2KOJ A;  1ZUB A;  3QIK A;  1VJ6 A;  3RLE A;  5HEB A;  4R2Z A;  2F5Y A;  2KL1 A;  2VSV A;  2YT8 A;  2DLS A;  2YTW A;  3TSZ A;  1SOZ A;  5E1Y A;  2WL7 A;  2EXG A;  2I4S A;  2AWX A;  1I92 A;  1L6O A;  1QAV A;  5HFC A;  2E7K A;  2JIN A;  4NMR A;  1GM1 A;  2BYG A;  2I0I A;  1VCW A;  1V62 A;  1WI2 A;  4JOH A;  2K20 A;  3NFK A;  5EZ0 A;  1W9O A;  1X6D A;  2REY A;  4E35 A;  1U39 A;  2JRE A;  1RGR A;  1Q3O A;  2LC7 A;  1FC9 A;  1R6J A;  2M3M A;  2DJT A;  2O2T A;  3MH4 A;  2AIN A;  4YYX A;  1UM1 A;  2JXO A;  3ZRT A;  3OU0 A;  2EV8 A;  4JOE A;  3EGH C;  3QGL A;  5G1E A;  4KFW A;  1T2M A;  2EGN A;  4HOP B;  5HJ1 A;  2IWP A;  4Q2Q A;  2EEH A;  3TMH A;  2Q3G A;  2DC2 A;  2JOA A;  2MX6 A;  5A2P A;  3DJ1 A;  1TP5 A;  4Q6S A;  1YBO A;  1UEQ A;  2GZV A;  2IWN A;  1WF7 A;  2OZF A;  5H3J A;  3ID3 A;  4LMM A;  3KDK A;  2M10 A;  1UM7 A;  3PV4 A;  3GDS A;  5IL9 A;  3GJ9 A;  5HFB A;  3VQG A;  2UZC A;  2KPK A;  2IWO A;  2KPL A;  1UJU A;  1W9Q A;  2I1N A;  4Z8J A;  1UEZ A;  2JSN A;  4JOR A;  3EGG C;  1RY4 A;  1TE0 A;  3NCV A;  1OBX A;  1UF1 A;  5G1D A;  1N99 A;  1OZI A;  1BFE A;  1WH1 A;  2L4T A;  2D8I A;  1WFV A;  1Z87 A;  4P0C A;  3K82 A;  1N7E A;  3GGE A;  3RL8 A;  3CBY A;  1UIT A;  2PKU A;  2W4F A;  3HVQ C;  1WHD A;  3GDV A;  3BPU A;  1Y8T A;  2DM8 A;  4K78 A;  2FNE A;  2AWU A;  2JIK A;  4NMT A;  2FCF A;  2EGO A;  1WHA A;  1WFG A;  4AMH A;  4JJ3 A;  5EYZ A;  1UJD A;  1I16 A;  2KQF A;  1GQ4 A;  3SUZ A;  4L8N A;  4WYU A;  5HF1 A;  2R3Y A;  4JOG A;  1B8Q A;  3JXT A;  3PV2 A;  2KOH A;  1WF8 A;  2KJK A;  2JWE A;  4NXQ A;  1UEP A;  2K1Z A;  5HEY A;  2D90 A;  1NTE A;  2QKT A;  2RRM A;  2EEG A;  2HGA A;  5E6P B;  1N6F A;  2VZ5 A;  2H2B A;  1MC7 A;  1WG6 A;  4PQW A;  1TP3 A;  2M0U A;  4Q6H A;  2YUB A;  2QG1 A;  2DAZ A;  4NXP A;  1X5N A;  5B6L A;  4WYT A;  5HFF A;  2LA8 A;  1SOT A;  2PNT A;  3R69 A;  2CS5 A;  2Z9I A;  2M0Z A;  1N7F A;  2KG2 A;  2RCZ A;  4EDJ A;  5F67 A;  1P1E A;  2H3M A;  1Z86 A;  1Y7N A;  4JOJ A;  1MFG A;  4E34 A;  1KY9 A;  1IU0 A;  2EEJ A;  5ILB A;  1VAE A;  2EJY A;  2OS6 A;  2CSJ A;  2X7Z A;  1ZOK A;  1V5Q A;  4GVD A;  5E11 A;  3PDV A;  5D13 A;  2QKV A;  1FCF A;  4UU6 A;  1V5L A;  2FE5 A;  1K32 A;  3MH6 A;  1XZ9 A;  4NMP A;  1G9O A; 
#chains in the Genus database with same CATH homology
 3ID4 A;  1X5Q A;  3K50 A;  4OAJ A;  3TSV A;  1UEW A;  1X5R A;  1N6D A;  4NMO A;  3R68 A;  3DJA A;  3LNX A;  2Q9V A;  5HED A;  2DMZ A;  3CBX A;  2PZD A;  3QJN A;  2H3L A;  3SOE A;  4YDP A;  3L4F D;  4NNL A;  3VQF A;  1X45 A;  2OCS A;  4UU5 A;  4G69 A;  3CH8 A;  3ID2 A;  2DKR A;  2GEF A;  2CSS A;  2G2L A;  4JJ0 A;  3FY5 A;  4GHN A;  3GSL A;  2Z17 A;  2D92 A;  4JOF A;  3ID1 A;  4MPA A;  4XHV A;  4Q2O A;  1LCY A;  2EDP A;  3KZD A;  3I1E A;  2KAW A;  2MHO A;  4NMQ A;  3CC0 A;  4K6Y A;  2F0A A;  3PDZ A;  2EDZ A;  4KFV A;  3KDG A;  3DIW A;  2KYL A;  2KA9 A;  4JOP A;  1Q7X A;  1FC7 A;  4NMV A;  2OQS A;  3E17 A;  3I18 A;  1BE9 A;  3QO6 A;  5GLJ A;  2R4H A;  5HDY A;  2QKU A;  2DLU A;  1QAV B;  2HE4 A;  5HFE A;  4E3B A;  2I6V A;  3KHF A;  5B42 A;  2VRF A;  2G5M B;  2HE2 A;  4GVC A;  2ZPL A;  3HPK A;  2KJD A;  4Q2N A;  1MFL A;  2PDZ A;  5E21 A;  1IHJ A;  1VB7 A;  3R0H A;  2EEI A;  2P3W A;  4Q3H A;  4JOK A;  3SHW A;  4H11 A;  2LUI A;  4RI0 A;  1TQ3 A;  2DB5 A;  4N6X A;  1P1D A;  1Q3P A;  2KJP A;  2QBW A;  2M0V A;  3RL7 A;  2OSG A;  2OPG A;  3O46 A;  3TSW A;  4Q2P A;  3NFL A;  1FC6 A;  2EGK A;  2M0T A;  4OEP A;  3QDO A;  3B76 A;  3K1R A;  1M5Z A;  4HOP A;  1VA8 A;  4NMS A;  5HFD A;  4NXR A;  5I7Z A;  4K75 A;  1PDR A;  1UHP A;  1QAU A;  2OGP A;  4OEO A;  5FB8 C;  3WKM A;  3OTP A;  2I0L A;  1W9E A;  1U37 A;  3PS4 A;  3CBZ A;  3O5N A;  2PKT A;  4K72 A;  5HET A;  3SFJ A;  3GCO A;  2VPH A;  3MH7 A;  3SHU A;  3HPM A;  1WI4 A;  2KRG A;  4REY A;  1N7T A;  3CYY A;  3WKL A;  2QT5 A;  2IWQ A;  1N6E A;  3QJM A;  2EDV A;  2EAQ A;  2EHR A;  1WJL A;  4F8K A;  2ENO A;  2L4S A;  1GQ5 A;  3GCN A;  5F3X A;  1V6B A;  5JXB A;  3STJ A;  1RZX A;  1V1T A;  1KEF A;  2JIL A;  1NF3 C;  1OBZ A;  4JL7 A;  2I04 A;  4K76 A;  5DTH A;  2AWW A;  4FLN A;  1KWA A;  2KBS A;  2KV8 A;  2FN5 A;  3CS0 A;  2L97 A;  1UJV A;  1UFX A;  3DOR A;  2W7R A;  4Z33 A;  2LOB A;  1RGW A;  1X9Z A;  3KZE A;  4O06 A;  3GAB A;  4NNM A;  2H2C A;  4FGM A;  1X8S A;  2LC6 A;  1U38 A;  1QLC A;  3LNY A;  3DJ3 A;  4P2A B;  5GND A;  3AXA A;  3I4W A;  4IC6 A;  3PV5 A;  2YT7 A;  3GDU A;  2VWR A;  1D5G A;  2KOM A;  5FHT A;  2ZPM A;  2PA1 A;  1U3B A;  3QE1 A;  1OBY A;  2YUY A;  2V1W A;  1IU2 A;  5E22 A;  2OMJ A;  2VSP A;  2V90 A;  5HF4 A;  1WIF A;  3NGH A;  2KOJ A;  1ZUB A;  3QIK A;  1VJ6 A;  3RLE A;  5HEB A;  4R2Z A;  2F5Y A;  2KL1 A;  2VSV A;  2YT8 A;  2DLS A;  2YTW A;  3TSZ A;  1SOZ A;  5E1Y A;  2WL7 A;  2EXG A;  2I4S A;  2AWX A;  1I92 A;  1L6O A;  1QAV A;  5HFC A;  2E7K A;  2JIN A;  4NMR A;  1GM1 A;  2BYG A;  2I0I A;  1VCW A;  1V62 A;  1WI2 A;  4JOH A;  2K20 A;  3NFK A;  5EZ0 A;  1W9O A;  1X6D A;  2REY A;  4E35 A;  1U39 A;  2JRE A;  1RGR A;  1Q3O A;  2LC7 A;  1FC9 A;  1R6J A;  2M3M A;  2DJT A;  2O2T A;  3MH4 A;  2AIN A;  4YYX A;  1UM1 A;  2JXO A;  3ZRT A;  3OU0 A;  2EV8 A;  4JOE A;  3EGH C;  3QGL A;  5G1E A;  4KFW A;  1T2M A;  2EGN A;  4HOP B;  5HJ1 A;  2IWP A;  4Q2Q A;  2EEH A;  3TMH A;  2Q3G A;  2DC2 A;  2JOA A;  2MX6 A;  5A2P A;  3DJ1 A;  1TP5 A;  4Q6S A;  1YBO A;  1UEQ A;  2GZV A;  2IWN A;  1WF7 A;  2OZF A;  5H3J A;  3ID3 A;  4LMM A;  3KDK A;  2M10 A;  1UM7 A;  3PV4 A;  3GDS A;  5IL9 A;  3GJ9 A;  5HFB A;  3VQG A;  2UZC A;  2KPK A;  2IWO A;  2KPL A;  1UJU A;  1W9Q A;  2I1N A;  4Z8J A;  1UEZ A;  2JSN A;  4JOR A;  3EGG C;  1RY4 A;  1TE0 A;  3NCV A;  1OBX A;  1UF1 A;  5G1D A;  1N99 A;  1OZI A;  1BFE A;  1WH1 A;  2L4T A;  2D8I A;  1WFV A;  1Z87 A;  4P0C A;  3K82 A;  1N7E A;  3GGE A;  3RL8 A;  3CBY A;  1UIT A;  2PKU A;  2W4F A;  3HVQ C;  1WHD A;  3GDV A;  3BPU A;  1Y8T A;  2DM8 A;  4K78 A;  2FNE A;  2AWU A;  2JIK A;  4NMT A;  2FCF A;  2EGO A;  1WHA A;  1WFG A;  4AMH A;  4JJ3 A;  5EYZ A;  1UJD A;  1I16 A;  2KQF A;  1GQ4 A;  3SUZ A;  4L8N A;  4WYU A;  5HF1 A;  2R3Y A;  4JOG A;  1B8Q A;  3JXT A;  3PV2 A;  2KOH A;  1WF8 A;  2KJK A;  2JWE A;  4NXQ A;  1UEP A;  2K1Z A;  5HEY A;  2D90 A;  1NTE A;  2QKT A;  2RRM A;  2EEG A;  2HGA A;  5E6P B;  1N6F A;  2VZ5 A;  2H2B A;  1MC7 A;  1WG6 A;  4PQW A;  1TP3 A;  2M0U A;  4Q6H A;  2YUB A;  2QG1 A;  2DAZ A;  4NXP A;  1X5N A;  5B6L A;  4WYT A;  5HFF A;  2LA8 A;  1SOT A;  2PNT A;  3R69 A;  2CS5 A;  2Z9I A;  2M0Z A;  1N7F A;  2KG2 A;  2RCZ A;  4EDJ A;  5F67 A;  1P1E A;  2H3M A;  1Z86 A;  1Y7N A;  4JOJ A;  1MFG A;  4E34 A;  1KY9 A;  1IU0 A;  2EEJ A;  5ILB A;  1VAE A;  2EJY A;  2OS6 A;  2CSJ A;  2X7Z A;  1ZOK A;  1V5Q A;  4GVD A;  5E11 A;  3PDV A;  5D13 A;  2QKV A;  1FCF A;  4UU6 A;  1V5L A;  2FE5 A;  1K32 A;  3MH6 A;  1XZ9 A;  4NMP A;  1G9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...