2EGNA

Crystal structure of tamalin pdz domain in complex with mglur5 c-terminal peptide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
94
structure length
83
Chain Sequence
QQRKVLTLEKGDNQTFGFEIQTYGVTFVARVHESSPAQLAGLTPGDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General receptor for phosphoinositides 1-associated scaffold
publication title Crystal structures of autoinhibitory PDZ domain of Tamalin: implications for metabotropic glutamate receptor trafficking regulation
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 20
structure length 83
sequence length 94
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2egnA00
3PV5A 3GSLA 1Q3OA 1X5RA 1MFLA 1N6FA 1I92A 3DJ1A 1WF8A 3R68A 5HFBA 1YBOA 2DLSA 3GCOA 1UJDA 4K75A 2K1ZA 2YUYA 2VSVA 5HETA 2KV8A 1RZXA 2G2LA 2KG2A 2W7RA 1UFXA 3ZRTA 2Q9VA 1TE0A 1TQ3A 2KOHA 2F5YA 1UJUA 2KOJA 3SOEA 2OZFA 3TSZA 1SOZA 2H3LA 4JOGA 3VQGA 3GDVA 2QKUA 2EEGA 1R6JA 2OQSA 1IU0A 4EDJA 2AWWA 2ZPLA 4E34A 5F67A 1X5NA 2V90A 4JL7A 2AINA 5E11A 3TSVA 3WKLA 1Q7XA 3CS0A 2FCFA 5I7ZA 3PS4A 1UITA 1V6BA 3I18A 2W4FA 1X6DA 5F3XA 1UEZA 3EGGC 2EDPA 5HFDA 4NXPA 2EXGA 1FC9A 1P1EA 2M3MA 3I1EA 2JINA 1W9QA 1B8QA 2DLUA 5HF4A 2QKTA 3KHFA 3CBYA 2O2TA 5HEBA 2Z17A 2OGPA 2JREA 3QGLA 1N7FA 3LNYA 2I4SA 4NMSA 4P2AB 1N99A 3R69A 4K76A 2YTWA 1GM1A 2JILA 4O06A 1WHAA 2KYLA 1BE9A 4Q6HA 2D90A 3DIWA 1WF7A 3GDUA 3PDVA 1Y7NA 4NMOA 2KPLA 1W9EA 1XZ9A 3FY5A 2PKUA 1UEQA 2KA9A 1MC7A 3TMHA 1RGRA 2DAZA 5GLJA 2ENOA 3O5NA 2DKRA 2OPGA 3ID3A 3B76A 1Q3PA 4JOPA 2EEHA 1LCYA 3E17A 2LC6A 3OTPA 2OCSA 3CC0A 4XHVA 4AMHA 1Z86A 2EEIA 2RCZA 5G1EA 2H2BA 2CSJA 2VZ5A 1TP3A 5HJ1A 2G5MB 2MHOA 2EDZA 2JXOA 1UJVA 2ZPMA 2DJTA 3JXTA 3QE1A 2KJKA 1U38A 1ZOKA 1D5GA 2OMJA 2LOBA 5E22A 4UU6A 1WJLA 2R3YA 1OBXA 3K82A 1KY9A 4OEPA 4Q2OA 3PDZA 2JWEA 4NMVA 5G1DA 2GZVA 1NTEA 2FE5A 2FNEA 4Q2QA 1U3BA 2LC7A 4HOPA 3RLEA 3CBXA 2IWPA 1OZIA 2YT8A 1TP5A 1Z87A 2WL7A 2H2CA 3CBZA 3SUZA 3NFLA 4JOHA 4IC6A 4R2ZA 1X45A 2M0VA 3L4FD 1X5QA 4L8NA 3QO6A 3SHWA 2EAQA 4LMMA 1N7EA 3HVQC 4Q2NA 5FHTA 4JORA 1MFGA 2M0TA 2EHRA 3VQFA 4F8KA 1WI2A 2KAWA 3CYYA 5H3JA 1UEWA 1UEPA 3SFJA 4Z8JA 1WI4A 2EGOA 2EGKA 2EGNA 1N6EA 2UZCA 3QJNA 1UM1A 2PA1A 3K50A 3K1RA 4G69A 4NMQA 4NNLA 4JOJA 1UF1A 3MH7A 2LUIA 4NMRA 2KQFA 3O46A 2I0LA 4H11A 4K72A 5HFCA 5HF1A 2V1WA 4HOPB 4NMTA 4NXRA 1I16A 1V5LA 1U37A 3GDSA 2PNTA 2OSGA 2QBWA 3I4WA 1OBZA 5DTHA 3QIKA 1FCFA 4GVDA 1U39A 3AXAA 1NF3C 5HFEA 2IWQA 1WFVA 1M5ZA 1G9OA 1FC6A 2E7KA 2QT5A 2OS6A 2VWRA 2R4HA 4KFWA 4JOFA 4PQWA 3NGHA 2EDVA 2KPKA 1WHDA 1FC7A 2JOAA 3ID1A 5JXBA 4OEOA 1W9OA 5D13A 1QAVB 4KFVA 5FB8C 3DORA 1OBYA 5EYZA 1P1DA 4Z33A 4P0CA 1V1TA 2HE2A 2L97A 3CH8A 4OAJA 1GQ4A 2AWUA 4YDPA 1UM7A 2D92A 2VSPA 3TSWA 3STJA 2LA8A 2M0ZA 2EEJA 1ZUBA 2PZDA 4Q2PA 1KWAA 2EV8A 2M10A 4Q6SA 2DM8A 4RI0A 2AWXA 4GVCA 4E3BA 4MPAA 1VJ6A 2MX6A 2VPHA 4NXQA 1WFGA 3GJ9A 3MH6A 5E1YA 2Q3GA 1UHPA 3DJ3A 1V62A 1X8SA 2M0UA 2PKTA 1Y8TA 1WIFA 2KJDA 2I0IA 2IWNA 4NNMA 4K78A 2FN5A 2I04A 2F0AA 1BFEA 2VRFA 3QDOA 3GCNA 2KJPA 1PDRA 3KZDA 3KZEA 4E35A 1WH1A 1VB7A 2YUBA 1IHJA 1VCWA 2CS5A 2QG1A 2K20A 4REYA 1VA8A 1QAVA 4NMPA 4JOKA 5HEYA 3ID2A 2YT7A 5HFFA 1QLCA 4N6XA 4GHNA 5HEDA 2REYA 2X7ZA 1RY4A 2P3WA 4UU5A 2KRGA 2JIKA 3RL7A 5A2PA 2DB5A 5E6PB 1KEFA 3HPKA 3MH4A 5GNDA 2DMZA 2I1NA 3RL8A 1SOTA 5HDYA 1N7TA 5E21A 2HE4A 3QJMA 3GGEA 1V5QA 4WYUA 2KOMA 3SHUA 1RGWA 2KBSA 4JOEA 3R0HA 3PV2A 1T2MA 2BYGA 2D8IA 3DJAA 2EJYA 1VAEA 2CSSA 4WYTA 4Q3HA 2L4TA 2QKVA 2HGAA 4FGMA 3PV4A 3LNXA 1K32A 5EZ0A 3HPMA 2RRMA 3ID4A 2PDZA 2DC2A 2KL1A 1WG6A 1N6DA 3EGHC 3WKMA 2H3MA 1QAUA 2I6VA 3BPUA 3NFKA 2L4SA 2Z9IA 3OU0A 1GQ5A 1L6OA 4YYXA 5B6LA 1IU2A 4K6YA 2IWOA
chains in the Genus database with same CATH superfamily
3PV5A 3GSLA 1Q3OA 1X5RA 1MFLA 1N6FA 1I92A 3DJ1A 5IL9A 1WF8A 3R68A 5HFBA 1YBOA 2DLSA 3GCOA 1UJDA 4K75A 2K1ZA 2YUYA 2VSVA 5HETA 2KV8A 1RZXA 2G2LA 2KG2A 2W7RA 1UFXA 3ZRTA 2Q9VA 1TE0A 1TQ3A 2KOHA 2F5YA 1UJUA 2KOJA 3SOEA 2OZFA 3TSZA 1SOZA 2H3LA 4JOGA 3VQGA 3GDVA 2QKUA 2EEGA 1R6JA 2OQSA 1IU0A 4EDJA 2AWWA 2ZPLA 4E34A 5F67A 1X5NA 2V90A 4JL7A 2AINA 5E11A 3TSVA 3WKLA 1Q7XA 3CS0A 2FCFA 5I7ZA 3PS4A 1UITA 1V6BA 3I18A 2W4FA 1X6DA 5F3XA 1UEZA 3EGGC 2EDPA 5HFDA 4NXPA 2EXGA 1FC9A 1P1EA 2M3MA 3I1EA 2JINA 1W9QA 1B8QA 2DLUA 5HF4A 2QKTA 3KHFA 3CBYA 2O2TA 5HEBA 2Z17A 2OGPA 2JREA 3QGLA 1N7FA 3LNYA 2I4SA 4NMSA 4P2AB 1N99A 3R69A 4K76A 2YTWA 1GM1A 2JILA 4O06A 1WHAA 2KYLA 1BE9A 4Q6HA 2D90A 3DIWA 1WF7A 3GDUA 3PDVA 1Y7NA 4NMOA 2KPLA 3GABA 1W9EA 1XZ9A 3FY5A 2PKUA 1UEQA 2KA9A 1MC7A 3TMHA 1RGRA 2DAZA 5GLJA 2ENOA 3O5NA 2DKRA 2OPGA 3ID3A 3B76A 1Q3PA 4JOPA 2EEHA 1LCYA 3E17A 2LC6A 3OTPA 2OCSA 3CC0A 4XHVA 4AMHA 1Z86A 2EEIA 2RCZA 5G1EA 2H2BA 2CSJA 2VZ5A 1TP3A 5HJ1A 2G5MB 2MHOA 2EDZA 2JXOA 1UJVA 2ZPMA 2DJTA 3JXTA 3QE1A 2KJKA 1U38A 1ZOKA 1D5GA 2OMJA 2LOBA 5E22A 4UU6A 1WJLA 2R3YA 1OBXA 3K82A 1KY9A 4OEPA 4Q2OA 3PDZA 2JWEA 1X9ZA 4NMVA 5G1DA 2GZVA 1NTEA 2FE5A 2FNEA 4Q2QA 1U3BA 2LC7A 3KDGA 4HOPA 3RLEA 3CBXA 2IWPA 1OZIA 2YT8A 5ILBA 1TP5A 1Z87A 2WL7A 2H2CA 3CBZA 3SUZA 3NFLA 4JOHA 4IC6A 4R2ZA 4JJ3A 1X45A 2M0VA 3L4FD 1X5QA 4L8NA 3QO6A 3SHWA 2EAQA 4LMMA 1N7EA 3HVQC 4Q2NA 5FHTA 4JORA 1MFGA 2M0TA 2EHRA 3VQFA 4F8KA 1WI2A 2KAWA 3CYYA 5H3JA 1UEWA 1UEPA 3SFJA 4Z8JA 1WI4A 2EGOA 2GEFA 2EGKA 2EGNA 1N6EA 2UZCA 3QJNA 1UM1A 2PA1A 3K50A 3K1RA 4G69A 4NMQA 4NNLA 4JOJA 1UF1A 3MH7A 2LUIA 4NMRA 2KQFA 3O46A 2I0LA 4H11A 4K72A 5HFCA 5HF1A 2V1WA 4HOPB 4NMTA 4NXRA 1I16A 3NCVA 1V5LA 1U37A 3GDSA 2PNTA 2OSGA 2QBWA 3I4WA 1OBZA 5DTHA 3QIKA 1FCFA 4FLNA 4GVDA 1U39A 3AXAA 1NF3C 5HFEA 2IWQA 1WFVA 1M5ZA 1G9OA 1FC6A 2E7KA 2QT5A 2OS6A 2VWRA 2R4HA 4KFWA 4JOFA 4PQWA 3NGHA 2EDVA 2KPKA 1WHDA 1FC7A 2JOAA 3ID1A 5JXBA 4OEOA 1W9OA 5D13A 1QAVB 4KFVA 5FB8C 3DORA 2JSNA 1OBYA 5EYZA 1P1DA 4Z33A 4P0CA 1V1TA 2HE2A 2L97A 3CH8A 4OAJA 1GQ4A 2AWUA 4YDPA 1UM7A 2D92A 2VSPA 3TSWA 3STJA 2LA8A 2M0ZA 2EEJA 1ZUBA 2PZDA 4Q2PA 1KWAA 2EV8A 2M10A 4Q6SA 2DM8A 4RI0A 2AWXA 4GVCA 4E3BA 4MPAA 1VJ6A 2MX6A 2VPHA 4NXQA 1WFGA 3GJ9A 3MH6A 5E1YA 2Q3GA 1UHPA 3DJ3A 1V62A 1X8SA 2M0UA 2PKTA 1Y8TA 1WIFA 2KJDA 2I0IA 2IWNA 4NNMA 4K78A 2FN5A 2I04A 2F0AA 1BFEA 2VRFA 3QDOA 3GCNA 2KJPA 1PDRA 3KZDA 3KZEA 4E35A 1WH1A 1VB7A 2YUBA 1IHJA 1VCWA 2CS5A 2QG1A 2K20A 4REYA 1VA8A 1QAVA 4NMPA 4JOKA 5HEYA 3ID2A 2YT7A 5HFFA 1QLCA 4N6XA 4GHNA 5HEDA 4JJ0A 2REYA 2X7ZA 1RY4A 2P3WA 4UU5A 2KRGA 2JIKA 3RL7A 5A2PA 2DB5A 5E6PB 1KEFA 3HPKA 3MH4A 5GNDA 2DMZA 2I1NA 3RL8A 1SOTA 5HDYA 1N7TA 5E21A 2HE4A 3QJMA 3GGEA 1V5QA 4WYUA 2KOMA 3SHUA 1RGWA 2KBSA 4JOEA 3R0HA 3PV2A 1T2MA 2BYGA 2D8IA 3DJAA 2EJYA 1VAEA 2CSSA 4WYTA 4Q3HA 2L4TA 3KDKA 2QKVA 2HGAA 4FGMA 3PV4A 3LNXA 1K32A 5EZ0A 3HPMA 2RRMA 3ID4A 5B42A 2PDZA 2DC2A 2KL1A 1WG6A 1N6DA 3EGHC 3WKMA 2H3MA 1QAUA 2I6VA 3BPUA 3NFKA 2L4SA 2Z9IA 3OU0A 1GQ5A 1L6OA 4YYXA 5B6LA 1IU2A 4K6YA 2IWOA
chains in the Genus database with same CATH topology
3PV5A 3GSLA 1Q3OA 1X5RA 1MFLA 1N6FA 1I92A 3DJ1A 5IL9A 1WF8A 3R68A 5HFBA 1YBOA 2DLSA 3GCOA 1UJDA 4K75A 2K1ZA 2YUYA 2VSVA 5HETA 2KV8A 1RZXA 2G2LA 2KG2A 2W7RA 1UFXA 3ZRTA 2Q9VA 1TE0A 1TQ3A 2KOHA 2F5YA 1UJUA 2KOJA 3SOEA 2OZFA 3TSZA 1SOZA 2H3LA 4JOGA 3VQGA 3GDVA 2QKUA 2EEGA 1R6JA 2OQSA 1IU0A 4EDJA 2AWWA 2ZPLA 4E34A 5F67A 1X5NA 2V90A 4JL7A 2AINA 5E11A 3TSVA 3WKLA 1Q7XA 3CS0A 2FCFA 5I7ZA 3PS4A 1UITA 1V6BA 3I18A 2W4FA 1X6DA 5F3XA 1UEZA 3EGGC 2EDPA 5HFDA 4NXPA 2EXGA 1FC9A 1P1EA 2M3MA 3I1EA 2JINA 1W9QA 1B8QA 2DLUA 5HF4A 2QKTA 3KHFA 3CBYA 2O2TA 5HEBA 2Z17A 2OGPA 2JREA 3QGLA 1N7FA 3LNYA 2I4SA 4NMSA 4P2AB 1N99A 3R69A 4K76A 2YTWA 1GM1A 2JILA 4O06A 1WHAA 2KYLA 1BE9A 4Q6HA 2D90A 3DIWA 1WF7A 3GDUA 3PDVA 1Y7NA 4NMOA 2KPLA 3GABA 1W9EA 1XZ9A 3FY5A 2PKUA 1UEQA 2KA9A 1MC7A 3TMHA 1RGRA 2DAZA 5GLJA 2ENOA 3O5NA 2DKRA 2OPGA 3ID3A 3B76A 1Q3PA 4JOPA 2EEHA 1LCYA 3E17A 2LC6A 3OTPA 2OCSA 3CC0A 4XHVA 4AMHA 1Z86A 2EEIA 2RCZA 5G1EA 2H2BA 2CSJA 2VZ5A 1TP3A 5HJ1A 2G5MB 2MHOA 2EDZA 2JXOA 1UJVA 2ZPMA 2DJTA 3JXTA 3QE1A 2KJKA 1U38A 1ZOKA 1D5GA 2OMJA 2LOBA 5E22A 4UU6A 1WJLA 2R3YA 1OBXA 3K82A 1KY9A 4OEPA 4Q2OA 3PDZA 2JWEA 1X9ZA 4NMVA 5G1DA 2GZVA 1NTEA 2FE5A 2FNEA 4Q2QA 1U3BA 2LC7A 3KDGA 4HOPA 3RLEA 3CBXA 2IWPA 1OZIA 2YT8A 5ILBA 1TP5A 1Z87A 2WL7A 2H2CA 3CBZA 3SUZA 3NFLA 4JOHA 4IC6A 4R2ZA 4JJ3A 1X45A 2M0VA 3L4FD 1X5QA 4L8NA 3QO6A 3SHWA 2EAQA 4LMMA 1N7EA 3HVQC 4Q2NA 5FHTA 4JORA 1MFGA 2M0TA 2EHRA 3VQFA 4F8KA 1WI2A 2KAWA 3CYYA 5H3JA 1UEWA 1UEPA 3SFJA 4Z8JA 1WI4A 2EGOA 2GEFA 2EGKA 2EGNA 1N6EA 2UZCA 3QJNA 1UM1A 2PA1A 3K50A 3K1RA 4G69A 4NMQA 4NNLA 4JOJA 1UF1A 3MH7A 2LUIA 4NMRA 2KQFA 3O46A 2I0LA 4H11A 4K72A 5HFCA 5HF1A 2V1WA 4HOPB 4NMTA 4NXRA 1I16A 3NCVA 1V5LA 1U37A 3GDSA 2PNTA 2OSGA 2QBWA 3I4WA 1OBZA 5DTHA 3QIKA 1FCFA 4FLNA 4GVDA 1U39A 3AXAA 1NF3C 5HFEA 2IWQA 1WFVA 1M5ZA 1G9OA 1FC6A 2E7KA 2QT5A 2OS6A 2VWRA 2R4HA 4KFWA 4JOFA 4PQWA 3NGHA 2EDVA 2KPKA 1WHDA 1FC7A 2JOAA 3ID1A 5JXBA 4OEOA 1W9OA 5D13A 1QAVB 4KFVA 5FB8C 3DORA 2JSNA 1OBYA 5EYZA 1P1DA 4Z33A 4P0CA 1V1TA 2HE2A 2L97A 3CH8A 4OAJA 1GQ4A 2AWUA 4YDPA 1UM7A 2D92A 2VSPA 3TSWA 3STJA 2LA8A 2M0ZA 2EEJA 1ZUBA 2PZDA 4Q2PA 1KWAA 2EV8A 2M10A 4Q6SA 2DM8A 4RI0A 2AWXA 4GVCA 4E3BA 4MPAA 1VJ6A 2MX6A 2VPHA 4NXQA 1WFGA 3GJ9A 3MH6A 5E1YA 2Q3GA 1UHPA 3DJ3A 1V62A 1X8SA 2M0UA 2PKTA 1Y8TA 1WIFA 2KJDA 2I0IA 2IWNA 4NNMA 4K78A 2FN5A 2I04A 2F0AA 1BFEA 2VRFA 3QDOA 3GCNA 2KJPA 1PDRA 3KZDA 3KZEA 4E35A 1WH1A 1VB7A 2YUBA 1IHJA 1VCWA 2CS5A 2QG1A 2K20A 4REYA 1VA8A 1QAVA 4NMPA 4JOKA 5HEYA 3ID2A 2YT7A 5HFFA 1QLCA 4N6XA 4GHNA 5HEDA 4JJ0A 2REYA 2X7ZA 1RY4A 2P3WA 4UU5A 2KRGA 2JIKA 3RL7A 5A2PA 2DB5A 5E6PB 1KEFA 3HPKA 3MH4A 5GNDA 2DMZA 2I1NA 3RL8A 1SOTA 5HDYA 1N7TA 5E21A 2HE4A 3QJMA 3GGEA 1V5QA 4WYUA 2KOMA 3SHUA 1RGWA 2KBSA 4JOEA 3R0HA 3PV2A 1T2MA 2BYGA 2D8IA 3DJAA 2EJYA 1VAEA 2CSSA 4WYTA 4Q3HA 2L4TA 3KDKA 2QKVA 2HGAA 4FGMA 3PV4A 3LNXA 1K32A 5EZ0A 3HPMA 2RRMA 3ID4A 5B42A 2PDZA 2DC2A 2KL1A 1WG6A 1N6DA 3EGHC 3WKMA 2H3MA 1QAUA 2I6VA 3BPUA 3NFKA 2L4SA 2Z9IA 3OU0A 1GQ5A 1L6OA 4YYXA 5B6LA 1IU2A 4K6YA 2IWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV5 A;  3GSL A;  1Q3O A;  1X5R A;  1MFL A;  1N6F A;  1I92 A;  3DJ1 A;  1WF8 A;  3R68 A;  5HFB A;  1YBO A;  2DLS A;  3GCO A;  1UJD A;  4K75 A;  2K1Z A;  2YUY A;  2VSV A;  5HET A;  2KV8 A;  1RZX A;  2G2L A;  2KG2 A;  2W7R A;  1UFX A;  3ZRT A;  2Q9V A;  1TE0 A;  1TQ3 A;  2KOH A;  2F5Y A;  1UJU A;  2KOJ A;  3SOE A;  2OZF A;  3TSZ A;  1SOZ A;  2H3L A;  4JOG A;  3VQG A;  3GDV A;  2QKU A;  2EEG A;  1R6J A;  2OQS A;  1IU0 A;  4EDJ A;  2AWW A;  2ZPL A;  4E34 A;  5F67 A;  1X5N A;  2V90 A;  4JL7 A;  2AIN A;  5E11 A;  3TSV A;  3WKL A;  1Q7X A;  3CS0 A;  2FCF A;  5I7Z A;  3PS4 A;  1UIT A;  1V6B A;  3I18 A;  2W4F A;  1X6D A;  5F3X A;  1UEZ A;  3EGG C;  2EDP A;  5HFD A;  4NXP A;  2EXG A;  1FC9 A;  1P1E A;  2M3M A;  3I1E A;  2JIN A;  1W9Q A;  1B8Q A;  2DLU A;  5HF4 A;  2QKT A;  3KHF A;  3CBY A;  2O2T A;  5HEB A;  2Z17 A;  2OGP A;  2JRE A;  3QGL A;  1N7F A;  3LNY A;  2I4S A;  4NMS A;  4P2A B;  1N99 A;  3R69 A;  4K76 A;  2YTW A;  1GM1 A;  2JIL A;  4O06 A;  1WHA A;  2KYL A;  1BE9 A;  4Q6H A;  2D90 A;  3DIW A;  1WF7 A;  3GDU A;  3PDV A;  1Y7N A;  4NMO A;  2KPL A;  1W9E A;  1XZ9 A;  3FY5 A;  2PKU A;  1UEQ A;  2KA9 A;  1MC7 A;  3TMH A;  1RGR A;  2DAZ A;  5GLJ A;  2ENO A;  3O5N A;  2DKR A;  2OPG A;  3ID3 A;  3B76 A;  1Q3P A;  4JOP A;  2EEH A;  1LCY A;  3E17 A;  2LC6 A;  3OTP A;  2OCS A;  3CC0 A;  4XHV A;  4AMH A;  1Z86 A;  2EEI A;  2RCZ A;  5G1E A;  2H2B A;  2CSJ A;  2VZ5 A;  1TP3 A;  5HJ1 A;  2G5M B;  2MHO A;  2EDZ A;  2JXO A;  1UJV A;  2ZPM A;  2DJT A;  3JXT A;  3QE1 A;  2KJK A;  1U38 A;  1ZOK A;  1D5G A;  2OMJ A;  2LOB A;  5E22 A;  4UU6 A;  1WJL A;  2R3Y A;  1OBX A;  3K82 A;  1KY9 A;  4OEP A;  4Q2O A;  3PDZ A;  2JWE A;  4NMV A;  5G1D A;  2GZV A;  1NTE A;  2FE5 A;  2FNE A;  4Q2Q A;  1U3B A;  2LC7 A;  4HOP A;  3RLE A;  3CBX A;  2IWP A;  1OZI A;  2YT8 A;  1TP5 A;  1Z87 A;  2WL7 A;  2H2C A;  3CBZ A;  3SUZ A;  3NFL A;  4JOH A;  4IC6 A;  4R2Z A;  1X45 A;  2M0V A;  3L4F D;  1X5Q A;  4L8N A;  3QO6 A;  3SHW A;  2EAQ A;  4LMM A;  1N7E A;  3HVQ C;  4Q2N A;  5FHT A;  4JOR A;  1MFG A;  2M0T A;  2EHR A;  3VQF A;  4F8K A;  1WI2 A;  2KAW A;  3CYY A;  5H3J A;  1UEW A;  1UEP A;  3SFJ A;  4Z8J A;  1WI4 A;  2EGO A;  2EGK A;  2EGN A;  1N6E A;  2UZC A;  3QJN A;  1UM1 A;  2PA1 A;  3K50 A;  3K1R A;  4G69 A;  4NMQ A;  4NNL A;  4JOJ A;  1UF1 A;  3MH7 A;  2LUI A;  4NMR A;  2KQF A;  3O46 A;  2I0L A;  4H11 A;  4K72 A;  5HFC A;  5HF1 A;  2V1W A;  4HOP B;  4NMT A;  4NXR A;  1I16 A;  1V5L A;  1U37 A;  3GDS A;  2PNT A;  2OSG A;  2QBW A;  3I4W A;  1OBZ A;  5DTH A;  3QIK A;  1FCF A;  4GVD A;  1U39 A;  3AXA A;  1NF3 C;  5HFE A;  2IWQ A;  1WFV A;  1M5Z A;  1G9O A;  1FC6 A;  2E7K A;  2QT5 A;  2OS6 A;  2VWR A;  2R4H A;  4KFW A;  4JOF A;  4PQW A;  3NGH A;  2EDV A;  2KPK A;  1WHD A;  1FC7 A;  2JOA A;  3ID1 A;  5JXB A;  4OEO A;  1W9O A;  5D13 A;  1QAV B;  4KFV A;  5FB8 C;  3DOR A;  1OBY A;  5EYZ A;  1P1D A;  4Z33 A;  4P0C A;  1V1T A;  2HE2 A;  2L97 A;  3CH8 A;  4OAJ A;  1GQ4 A;  2AWU A;  4YDP A;  1UM7 A;  2D92 A;  2VSP A;  3TSW A;  3STJ A;  2LA8 A;  2M0Z A;  2EEJ A;  1ZUB A;  2PZD A;  4Q2P A;  1KWA A;  2EV8 A;  2M10 A;  4Q6S A;  2DM8 A;  4RI0 A;  2AWX A;  4GVC A;  4E3B A;  4MPA A;  1VJ6 A;  2MX6 A;  2VPH A;  4NXQ A;  1WFG A;  3GJ9 A;  3MH6 A;  5E1Y A;  2Q3G A;  1UHP A;  3DJ3 A;  1V62 A;  1X8S A;  2M0U A;  2PKT A;  1Y8T A;  1WIF A;  2KJD A;  2I0I A;  2IWN A;  4NNM A;  4K78 A;  2FN5 A;  2I04 A;  2F0A A;  1BFE A;  2VRF A;  3QDO A;  3GCN A;  2KJP A;  1PDR A;  3KZD A;  3KZE A;  4E35 A;  1WH1 A;  1VB7 A;  2YUB A;  1IHJ A;  1VCW A;  2CS5 A;  2QG1 A;  2K20 A;  4REY A;  1VA8 A;  1QAV A;  4NMP A;  4JOK A;  5HEY A;  3ID2 A;  2YT7 A;  5HFF A;  1QLC A;  4N6X A;  4GHN A;  5HED A;  2REY A;  2X7Z A;  1RY4 A;  2P3W A;  4UU5 A;  2KRG A;  2JIK A;  3RL7 A;  5A2P A;  2DB5 A;  5E6P B;  1KEF A;  3HPK A;  3MH4 A;  5GND A;  2DMZ A;  2I1N A;  3RL8 A;  1SOT A;  5HDY A;  1N7T A;  5E21 A;  2HE4 A;  3QJM A;  3GGE A;  1V5Q A;  4WYU A;  2KOM A;  3SHU A;  1RGW A;  2KBS A;  4JOE A;  3R0H A;  3PV2 A;  1T2M A;  2BYG A;  2D8I A;  3DJA A;  2EJY A;  1VAE A;  2CSS A;  4WYT A;  4Q3H A;  2L4T A;  2QKV A;  2HGA A;  4FGM A;  3PV4 A;  3LNX A;  1K32 A;  5EZ0 A;  3HPM A;  2RRM A;  3ID4 A;  2PDZ A;  2DC2 A;  2KL1 A;  1WG6 A;  1N6D A;  3EGH C;  3WKM A;  2H3M A;  1QAU A;  2I6V A;  3BPU A;  3NFK A;  2L4S A;  2Z9I A;  3OU0 A;  1GQ5 A;  1L6O A;  4YYX A;  5B6L A;  1IU2 A;  4K6Y A;  2IWO A; 
#chains in the Genus database with same CATH topology
 3PV5 A;  3GSL A;  1Q3O A;  1X5R A;  1MFL A;  1N6F A;  1I92 A;  3DJ1 A;  5IL9 A;  1WF8 A;  3R68 A;  5HFB A;  1YBO A;  2DLS A;  3GCO A;  1UJD A;  4K75 A;  2K1Z A;  2YUY A;  2VSV A;  5HET A;  2KV8 A;  1RZX A;  2G2L A;  2KG2 A;  2W7R A;  1UFX A;  3ZRT A;  2Q9V A;  1TE0 A;  1TQ3 A;  2KOH A;  2F5Y A;  1UJU A;  2KOJ A;  3SOE A;  2OZF A;  3TSZ A;  1SOZ A;  2H3L A;  4JOG A;  3VQG A;  3GDV A;  2QKU A;  2EEG A;  1R6J A;  2OQS A;  1IU0 A;  4EDJ A;  2AWW A;  2ZPL A;  4E34 A;  5F67 A;  1X5N A;  2V90 A;  4JL7 A;  2AIN A;  5E11 A;  3TSV A;  3WKL A;  1Q7X A;  3CS0 A;  2FCF A;  5I7Z A;  3PS4 A;  1UIT A;  1V6B A;  3I18 A;  2W4F A;  1X6D A;  5F3X A;  1UEZ A;  3EGG C;  2EDP A;  5HFD A;  4NXP A;  2EXG A;  1FC9 A;  1P1E A;  2M3M A;  3I1E A;  2JIN A;  1W9Q A;  1B8Q A;  2DLU A;  5HF4 A;  2QKT A;  3KHF A;  3CBY A;  2O2T A;  5HEB A;  2Z17 A;  2OGP A;  2JRE A;  3QGL A;  1N7F A;  3LNY A;  2I4S A;  4NMS A;  4P2A B;  1N99 A;  3R69 A;  4K76 A;  2YTW A;  1GM1 A;  2JIL A;  4O06 A;  1WHA A;  2KYL A;  1BE9 A;  4Q6H A;  2D90 A;  3DIW A;  1WF7 A;  3GDU A;  3PDV A;  1Y7N A;  4NMO A;  2KPL A;  3GAB A;  1W9E A;  1XZ9 A;  3FY5 A;  2PKU A;  1UEQ A;  2KA9 A;  1MC7 A;  3TMH A;  1RGR A;  2DAZ A;  5GLJ A;  2ENO A;  3O5N A;  2DKR A;  2OPG A;  3ID3 A;  3B76 A;  1Q3P A;  4JOP A;  2EEH A;  1LCY A;  3E17 A;  2LC6 A;  3OTP A;  2OCS A;  3CC0 A;  4XHV A;  4AMH A;  1Z86 A;  2EEI A;  2RCZ A;  5G1E A;  2H2B A;  2CSJ A;  2VZ5 A;  1TP3 A;  5HJ1 A;  2G5M B;  2MHO A;  2EDZ A;  2JXO A;  1UJV A;  2ZPM A;  2DJT A;  3JXT A;  3QE1 A;  2KJK A;  1U38 A;  1ZOK A;  1D5G A;  2OMJ A;  2LOB A;  5E22 A;  4UU6 A;  1WJL A;  2R3Y A;  1OBX A;  3K82 A;  1KY9 A;  4OEP A;  4Q2O A;  3PDZ A;  2JWE A;  1X9Z A;  4NMV A;  5G1D A;  2GZV A;  1NTE A;  2FE5 A;  2FNE A;  4Q2Q A;  1U3B A;  2LC7 A;  3KDG A;  4HOP A;  3RLE A;  3CBX A;  2IWP A;  1OZI A;  2YT8 A;  5ILB A;  1TP5 A;  1Z87 A;  2WL7 A;  2H2C A;  3CBZ A;  3SUZ A;  3NFL A;  4JOH A;  4IC6 A;  4R2Z A;  4JJ3 A;  1X45 A;  2M0V A;  3L4F D;  1X5Q A;  4L8N A;  3QO6 A;  3SHW A;  2EAQ A;  4LMM A;  1N7E A;  3HVQ C;  4Q2N A;  5FHT A;  4JOR A;  1MFG A;  2M0T A;  2EHR A;  3VQF A;  4F8K A;  1WI2 A;  2KAW A;  3CYY A;  5H3J A;  1UEW A;  1UEP A;  3SFJ A;  4Z8J A;  1WI4 A;  2EGO A;  2GEF A;  2EGK A;  2EGN A;  1N6E A;  2UZC A;  3QJN A;  1UM1 A;  2PA1 A;  3K50 A;  3K1R A;  4G69 A;  4NMQ A;  4NNL A;  4JOJ A;  1UF1 A;  3MH7 A;  2LUI A;  4NMR A;  2KQF A;  3O46 A;  2I0L A;  4H11 A;  4K72 A;  5HFC A;  5HF1 A;  2V1W A;  4HOP B;  4NMT A;  4NXR A;  1I16 A;  3NCV A;  1V5L A;  1U37 A;  3GDS A;  2PNT A;  2OSG A;  2QBW A;  3I4W A;  1OBZ A;  5DTH A;  3QIK A;  1FCF A;  4FLN A;  4GVD A;  1U39 A;  3AXA A;  1NF3 C;  5HFE A;  2IWQ A;  1WFV A;  1M5Z A;  1G9O A;  1FC6 A;  2E7K A;  2QT5 A;  2OS6 A;  2VWR A;  2R4H A;  4KFW A;  4JOF A;  4PQW A;  3NGH A;  2EDV A;  2KPK A;  1WHD A;  1FC7 A;  2JOA A;  3ID1 A;  5JXB A;  4OEO A;  1W9O A;  5D13 A;  1QAV B;  4KFV A;  5FB8 C;  3DOR A;  2JSN A;  1OBY A;  5EYZ A;  1P1D A;  4Z33 A;  4P0C A;  1V1T A;  2HE2 A;  2L97 A;  3CH8 A;  4OAJ A;  1GQ4 A;  2AWU A;  4YDP A;  1UM7 A;  2D92 A;  2VSP A;  3TSW A;  3STJ A;  2LA8 A;  2M0Z A;  2EEJ A;  1ZUB A;  2PZD A;  4Q2P A;  1KWA A;  2EV8 A;  2M10 A;  4Q6S A;  2DM8 A;  4RI0 A;  2AWX A;  4GVC A;  4E3B A;  4MPA A;  1VJ6 A;  2MX6 A;  2VPH A;  4NXQ A;  1WFG A;  3GJ9 A;  3MH6 A;  5E1Y A;  2Q3G A;  1UHP A;  3DJ3 A;  1V62 A;  1X8S A;  2M0U A;  2PKT A;  1Y8T A;  1WIF A;  2KJD A;  2I0I A;  2IWN A;  4NNM A;  4K78 A;  2FN5 A;  2I04 A;  2F0A A;  1BFE A;  2VRF A;  3QDO A;  3GCN A;  2KJP A;  1PDR A;  3KZD A;  3KZE A;  4E35 A;  1WH1 A;  1VB7 A;  2YUB A;  1IHJ A;  1VCW A;  2CS5 A;  2QG1 A;  2K20 A;  4REY A;  1VA8 A;  1QAV A;  4NMP A;  4JOK A;  5HEY A;  3ID2 A;  2YT7 A;  5HFF A;  1QLC A;  4N6X A;  4GHN A;  5HED A;  4JJ0 A;  2REY A;  2X7Z A;  1RY4 A;  2P3W A;  4UU5 A;  2KRG A;  2JIK A;  3RL7 A;  5A2P A;  2DB5 A;  5E6P B;  1KEF A;  3HPK A;  3MH4 A;  5GND A;  2DMZ A;  2I1N A;  3RL8 A;  1SOT A;  5HDY A;  1N7T A;  5E21 A;  2HE4 A;  3QJM A;  3GGE A;  1V5Q A;  4WYU A;  2KOM A;  3SHU A;  1RGW A;  2KBS A;  4JOE A;  3R0H A;  3PV2 A;  1T2M A;  2BYG A;  2D8I A;  3DJA A;  2EJY A;  1VAE A;  2CSS A;  4WYT A;  4Q3H A;  2L4T A;  3KDK A;  2QKV A;  2HGA A;  4FGM A;  3PV4 A;  3LNX A;  1K32 A;  5EZ0 A;  3HPM A;  2RRM A;  3ID4 A;  5B42 A;  2PDZ A;  2DC2 A;  2KL1 A;  1WG6 A;  1N6D A;  3EGH C;  3WKM A;  2H3M A;  1QAU A;  2I6V A;  3BPU A;  3NFK A;  2L4S A;  2Z9I A;  3OU0 A;  1GQ5 A;  1L6O A;  4YYX A;  5B6L A;  1IU2 A;  4K6Y A;  2IWO A; 
#chains in the Genus database with same CATH homology
 3PV5 A;  3GSL A;  1Q3O A;  1X5R A;  1MFL A;  1N6F A;  1I92 A;  3DJ1 A;  5IL9 A;  1WF8 A;  3R68 A;  5HFB A;  1YBO A;  2DLS A;  3GCO A;  1UJD A;  4K75 A;  2K1Z A;  2YUY A;  2VSV A;  5HET A;  2KV8 A;  1RZX A;  2G2L A;  2KG2 A;  2W7R A;  1UFX A;  3ZRT A;  2Q9V A;  1TE0 A;  1TQ3 A;  2KOH A;  2F5Y A;  1UJU A;  2KOJ A;  3SOE A;  2OZF A;  3TSZ A;  1SOZ A;  2H3L A;  4JOG A;  3VQG A;  3GDV A;  2QKU A;  2EEG A;  1R6J A;  2OQS A;  1IU0 A;  4EDJ A;  2AWW A;  2ZPL A;  4E34 A;  5F67 A;  1X5N A;  2V90 A;  4JL7 A;  2AIN A;  5E11 A;  3TSV A;  3WKL A;  1Q7X A;  3CS0 A;  2FCF A;  5I7Z A;  3PS4 A;  1UIT A;  1V6B A;  3I18 A;  2W4F A;  1X6D A;  5F3X A;  1UEZ A;  3EGG C;  2EDP A;  5HFD A;  4NXP A;  2EXG A;  1FC9 A;  1P1E A;  2M3M A;  3I1E A;  2JIN A;  1W9Q A;  1B8Q A;  2DLU A;  5HF4 A;  2QKT A;  3KHF A;  3CBY A;  2O2T A;  5HEB A;  2Z17 A;  2OGP A;  2JRE A;  3QGL A;  1N7F A;  3LNY A;  2I4S A;  4NMS A;  4P2A B;  1N99 A;  3R69 A;  4K76 A;  2YTW A;  1GM1 A;  2JIL A;  4O06 A;  1WHA A;  2KYL A;  1BE9 A;  4Q6H A;  2D90 A;  3DIW A;  1WF7 A;  3GDU A;  3PDV A;  1Y7N A;  4NMO A;  2KPL A;  3GAB A;  1W9E A;  1XZ9 A;  3FY5 A;  2PKU A;  1UEQ A;  2KA9 A;  1MC7 A;  3TMH A;  1RGR A;  2DAZ A;  5GLJ A;  2ENO A;  3O5N A;  2DKR A;  2OPG A;  3ID3 A;  3B76 A;  1Q3P A;  4JOP A;  2EEH A;  1LCY A;  3E17 A;  2LC6 A;  3OTP A;  2OCS A;  3CC0 A;  4XHV A;  4AMH A;  1Z86 A;  2EEI A;  2RCZ A;  5G1E A;  2H2B A;  2CSJ A;  2VZ5 A;  1TP3 A;  5HJ1 A;  2G5M B;  2MHO A;  2EDZ A;  2JXO A;  1UJV A;  2ZPM A;  2DJT A;  3JXT A;  3QE1 A;  2KJK A;  1U38 A;  1ZOK A;  1D5G A;  2OMJ A;  2LOB A;  5E22 A;  4UU6 A;  1WJL A;  2R3Y A;  1OBX A;  3K82 A;  1KY9 A;  4OEP A;  4Q2O A;  3PDZ A;  2JWE A;  1X9Z A;  4NMV A;  5G1D A;  2GZV A;  1NTE A;  2FE5 A;  2FNE A;  4Q2Q A;  1U3B A;  2LC7 A;  3KDG A;  4HOP A;  3RLE A;  3CBX A;  2IWP A;  1OZI A;  2YT8 A;  5ILB A;  1TP5 A;  1Z87 A;  2WL7 A;  2H2C A;  3CBZ A;  3SUZ A;  3NFL A;  4JOH A;  4IC6 A;  4R2Z A;  4JJ3 A;  1X45 A;  2M0V A;  3L4F D;  1X5Q A;  4L8N A;  3QO6 A;  3SHW A;  2EAQ A;  4LMM A;  1N7E A;  3HVQ C;  4Q2N A;  5FHT A;  4JOR A;  1MFG A;  2M0T A;  2EHR A;  3VQF A;  4F8K A;  1WI2 A;  2KAW A;  3CYY A;  5H3J A;  1UEW A;  1UEP A;  3SFJ A;  4Z8J A;  1WI4 A;  2EGO A;  2GEF A;  2EGK A;  2EGN A;  1N6E A;  2UZC A;  3QJN A;  1UM1 A;  2PA1 A;  3K50 A;  3K1R A;  4G69 A;  4NMQ A;  4NNL A;  4JOJ A;  1UF1 A;  3MH7 A;  2LUI A;  4NMR A;  2KQF A;  3O46 A;  2I0L A;  4H11 A;  4K72 A;  5HFC A;  5HF1 A;  2V1W A;  4HOP B;  4NMT A;  4NXR A;  1I16 A;  3NCV A;  1V5L A;  1U37 A;  3GDS A;  2PNT A;  2OSG A;  2QBW A;  3I4W A;  1OBZ A;  5DTH A;  3QIK A;  1FCF A;  4FLN A;  4GVD A;  1U39 A;  3AXA A;  1NF3 C;  5HFE A;  2IWQ A;  1WFV A;  1M5Z A;  1G9O A;  1FC6 A;  2E7K A;  2QT5 A;  2OS6 A;  2VWR A;  2R4H A;  4KFW A;  4JOF A;  4PQW A;  3NGH A;  2EDV A;  2KPK A;  1WHD A;  1FC7 A;  2JOA A;  3ID1 A;  5JXB A;  4OEO A;  1W9O A;  5D13 A;  1QAV B;  4KFV A;  5FB8 C;  3DOR A;  2JSN A;  1OBY A;  5EYZ A;  1P1D A;  4Z33 A;  4P0C A;  1V1T A;  2HE2 A;  2L97 A;  3CH8 A;  4OAJ A;  1GQ4 A;  2AWU A;  4YDP A;  1UM7 A;  2D92 A;  2VSP A;  3TSW A;  3STJ A;  2LA8 A;  2M0Z A;  2EEJ A;  1ZUB A;  2PZD A;  4Q2P A;  1KWA A;  2EV8 A;  2M10 A;  4Q6S A;  2DM8 A;  4RI0 A;  2AWX A;  4GVC A;  4E3B A;  4MPA A;  1VJ6 A;  2MX6 A;  2VPH A;  4NXQ A;  1WFG A;  3GJ9 A;  3MH6 A;  5E1Y A;  2Q3G A;  1UHP A;  3DJ3 A;  1V62 A;  1X8S A;  2M0U A;  2PKT A;  1Y8T A;  1WIF A;  2KJD A;  2I0I A;  2IWN A;  4NNM A;  4K78 A;  2FN5 A;  2I04 A;  2F0A A;  1BFE A;  2VRF A;  3QDO A;  3GCN A;  2KJP A;  1PDR A;  3KZD A;  3KZE A;  4E35 A;  1WH1 A;  1VB7 A;  2YUB A;  1IHJ A;  1VCW A;  2CS5 A;  2QG1 A;  2K20 A;  4REY A;  1VA8 A;  1QAV A;  4NMP A;  4JOK A;  5HEY A;  3ID2 A;  2YT7 A;  5HFF A;  1QLC A;  4N6X A;  4GHN A;  5HED A;  4JJ0 A;  2REY A;  2X7Z A;  1RY4 A;  2P3W A;  4UU5 A;  2KRG A;  2JIK A;  3RL7 A;  5A2P A;  2DB5 A;  5E6P B;  1KEF A;  3HPK A;  3MH4 A;  5GND A;  2DMZ A;  2I1N A;  3RL8 A;  1SOT A;  5HDY A;  1N7T A;  5E21 A;  2HE4 A;  3QJM A;  3GGE A;  1V5Q A;  4WYU A;  2KOM A;  3SHU A;  1RGW A;  2KBS A;  4JOE A;  3R0H A;  3PV2 A;  1T2M A;  2BYG A;  2D8I A;  3DJA A;  2EJY A;  1VAE A;  2CSS A;  4WYT A;  4Q3H A;  2L4T A;  3KDK A;  2QKV A;  2HGA A;  4FGM A;  3PV4 A;  3LNX A;  1K32 A;  5EZ0 A;  3HPM A;  2RRM A;  3ID4 A;  5B42 A;  2PDZ A;  2DC2 A;  2KL1 A;  1WG6 A;  1N6D A;  3EGH C;  3WKM A;  2H3M A;  1QAU A;  2I6V A;  3BPU A;  3NFK A;  2L4S A;  2Z9I A;  3OU0 A;  1GQ5 A;  1L6O A;  4YYX A;  5B6L A;  1IU2 A;  4K6Y A;  2IWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...