4OAJA

Crystal structure of the complex between sap97 pdz2 and 5ht2a receptor peptide
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
AAIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disks large homolog 1
publication title Crystal structure of the complex between SAP97 PDZ2 and 5HT2A receptor peptide
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4oajA00
2YUYA 3ID2A 2YT8A 2Z9IA 1N7FA 2PNTA 2IWQA 3SFJA 2M10A 2I4SA 2RRMA 1T2MA 3LNXA 2FE5A 1KEFA 2LOBA 1WIFA 2G2LA 1RY4A 2OPGA 5H3JA 4NMTA 2I0LA 2KYLA 3I18A 1Z87A 2PKUA 5E21A 2DLUA 2KA9A 1VAEA 2KQFA 2OSGA 1YBOA 4WYUA 1MC7A 4Q6HA 3NGHA 3TMHA 3PV5A 4HOPA 1UM7A 1WF8A 1WH1A 2VSPA 1PDRA 2OCSA 5JXBA 2R3YA 3TSZA 1RGRA 2DB5A 5I7ZA 3QJNA 2OMJA 2BYGA 2V90A 2AWUA 3VQGA 3MH6A 1X5NA 1OBZA 1N99A 2DMZA 1QLCA 1MFLA 2H2CA 5HFFA 3SUZA 2ZPMA 1QAVB 2L4SA 3GSLA 3RLEA 2EV8A 3GJ9A 1OBYA 2JXOA 5HFEA 1WFVA 2JINA 5E1YA 5FHTA 4L8NA 2EGOA 2LC7A 4JOHA 4OEPA 4NNMA 2ENOA 2I04A 1U38A 2DLSA 4Q2QA 4KFVA 1OBXA 2D92A 5GNDA 3CYYA 1IHJA 4K72A 2E7KA 5A2PA 3RL8A 5HFCA 3OTPA 1QAUA 1P1DA 1Q3PA 4JOFA 5HJ1A 2KPKA 3PV2A 5E6PB 1K32A 1N7EA 2LA8A 5HEYA 2EEJA 1V5QA 2EEGA 2P3WA 4G69A 3HVQC 3QDOA 2KG2A 1B8QA 4NMQA 2W4FA 1RGWA 2H3MA 1VB7A 3ID1A 2JOAA 4KFWA 2VRFA 1UEQA 4Z8JA 2EDVA 3HPKA 3SHUA 1Y7NA 1UJVA 3I4WA 4FGMA 4NMPA 3QIKA 2EGNA 3HPMA 2D8IA 3CS0A 4JOEA 5B6LA 1VA8A 1Y8TA 4IC6A 3RL7A 4K75A 2DM8A 1U3BA 2M0VA 5HFDA 5HETA 3WKMA 3TSVA 2DKRA 4Q3HA 1UJUA 1LCYA 2M0UA 3K82A 3R0HA 4Z33A 4XHVA 1BE9A 1X45A 2L4TA 1U37A 5G1DA 4UU6A 2DC2A 2OZFA 1FC6A 2CSJA 3LNYA 4OEOA 3SOEA 4LMMA 2PKTA 1N7TA 3AXAA 2EHRA 3KHFA 3NFLA 3PDZA 5GLJA 4GVDA 2MX6A 1U39A 3ZRTA 4K78A 3MH7A 3DORA 4Q2PA 1IU2A 3DJ1A 4GVCA 2HE4A 1V5LA 4HOPB 2QBWA 2M0TA 3K1RA 2VZ5A 3EGHC 2IWOA 3DIWA 2X7ZA 3WKLA 3CBZA 1TP3A 1WFGA 1FC7A 1XZ9A 2W7RA 2VWRA 1WHAA 1UEWA 2CSSA 3KZDA 3JXTA 3I1EA 3R68A 2PZDA 4E35A 5EYZA 1X5QA 4NXPA 1ZUBA 3KZEA 2OGPA 1UJDA 4JOKA 1WI4A 2RCZA 1RZXA 3NFKA 2I1NA 5FB8C 2KOMA 2MHOA 2G5MB 4GHNA 2KPLA 3QJMA 5HF1A 5E11A 1X5RA 2I0IA 2CS5A 2EDZA 4K6YA 2PDZA 4PQWA 4Q2OA 2HE2A 1IU0A 2EGKA 3GDSA 1MFGA 4YDPA 1TP5A 4JOGA 2EEIA 2M3MA 2H3LA 2KJDA 3QO6A 1W9OA 2QKUA 4NXQA 3TSWA 3O5NA 1TQ3A 3BPUA 1UF1A 1FC9A 4RI0A 2GZVA 4YYXA 1V6BA 3DJ3A 1VCWA 1I16A 2KJPA 2I6VA 2R4HA 1FCFA 1W9QA 4JOPA 4P0CA 3CH8A 3QE1A 4H11A 2JILA 4NMRA 2KV8A 2AWXA 3ID3A 4Q2NA 5F67A 1KY9A 4NMOA 3CC0A 1SOTA 4NMSA 5G1EA 2K20A 1V1TA 2YT7A 2Q3GA 2K1ZA 4O06A 3R69A 1Q7XA 2YTWA 1R6JA 2QKVA 1GM1A 1M5ZA 2VPHA 4JORA 3MH4A 4UU5A 2O2TA 1N6FA 5F3XA 2QKTA 5DTHA 1X6DA 1D5GA 4NNLA 4OAJA 3ID4A 2DJTA 2LC6A 2Q9VA 2KRGA 1OZIA 1W9EA 4EDJA 2JIKA 1UEZA 2EAQA 2HGAA 2KL1A 4NMVA 5HDYA 1UITA 3OU0A 2OQSA 1G9OA 3K50A 2EXGA 3SHWA 1UM1A 3GDVA 3PS4A 1QAVA 3GCNA 3O46A 2L97A 2DAZA 1UEPA 3VQFA 2KBSA 1WHDA 3GGEA 5HEDA 3CBXA 2Z17A 4N6XA 1GQ5A 2H2BA 1Z86A 2IWNA 2UZCA 2M0ZA 4E34A 2V1WA 4REYA 2AINA 1WG6A 2KOHA 2KOJA 1GQ4A 2JWEA 1ZOKA 3FY5A 1NTEA 4F8KA 2FCFA 1WF7A 3CBYA 5HF4A 2ZPLA 3STJA 4NXRA 2EDPA 3QGLA 4Q6SA 2D90A 4JL7A 5EZ0A 4JOJA 1WI2A 4WYTA 4E3BA 1SOZA 3L4FD 2KJKA 5HFBA 2LUIA 1V62A 3B76A 1UFXA 3EGGC 2QG1A 2JREA 2FN5A 2VSVA 1L6OA 4K76A 2WL7A 1Q3OA 1NF3C 1P1EA 2F0AA 1WJLA 2YUBA 1TE0A 1VJ6A 1N6EA 2EEHA 2AWWA 2REYA 3DJAA 4P2AB 3GCOA 1BFEA 2F5YA 4MPAA 2IWPA 1KWAA 5D13A 3GDUA 3PV4A 3E17A 2OS6A 4R2ZA 2EJYA 2FNEA 1I92A 1N6DA 3PDVA 1X8SA 5HEBA 4AMHA 2QT5A 1UHPA 2KAWA 5E22A 2PA1A
chains in the Genus database with same CATH superfamily
2YUYA 3ID2A 2YT8A 2Z9IA 1N7FA 2PNTA 2IWQA 3SFJA 2M10A 2I4SA 2RRMA 1T2MA 3LNXA 2FE5A 1KEFA 2LOBA 1WIFA 2G2LA 1RY4A 2OPGA 5H3JA 4NMTA 2I0LA 2KYLA 3I18A 1Z87A 2PKUA 5E21A 2DLUA 2KA9A 1VAEA 2KQFA 2OSGA 1YBOA 3KDGA 4WYUA 1MC7A 4Q6HA 3NGHA 3TMHA 3PV5A 4JJ3A 4HOPA 1UM7A 1WF8A 1WH1A 2VSPA 1PDRA 2OCSA 5JXBA 2R3YA 3TSZA 1RGRA 2DB5A 5I7ZA 3QJNA 2OMJA 2BYGA 2V90A 4FLNA 2AWUA 3VQGA 3MH6A 1X5NA 1OBZA 1N99A 2DMZA 1QLCA 1MFLA 2H2CA 5HFFA 3SUZA 2ZPMA 1QAVB 2L4SA 3GSLA 3RLEA 2EV8A 3GJ9A 1OBYA 2JXOA 5HFEA 1WFVA 2JINA 5E1YA 5FHTA 4L8NA 2EGOA 2LC7A 4JOHA 4OEPA 4NNMA 2ENOA 2I04A 1U38A 2DLSA 4Q2QA 4KFVA 1OBXA 2D92A 5GNDA 3CYYA 1IHJA 4K72A 2E7KA 5ILBA 5A2PA 3RL8A 5HFCA 3OTPA 1QAUA 1P1DA 1Q3PA 4JOFA 5HJ1A 2KPKA 3KDKA 3PV2A 5E6PB 1K32A 1N7EA 2LA8A 5HEYA 2EEJA 1V5QA 2EEGA 2P3WA 4G69A 4JJ0A 3HVQC 3QDOA 2KG2A 1B8QA 4NMQA 2W4FA 1RGWA 2H3MA 1VB7A 3ID1A 2JOAA 4KFWA 2VRFA 1UEQA 4Z8JA 2EDVA 3HPKA 3SHUA 1Y7NA 1UJVA 3I4WA 3NCVA 4FGMA 4NMPA 3QIKA 2EGNA 3HPMA 2D8IA 3CS0A 4JOEA 5B6LA 1VA8A 1Y8TA 4IC6A 3RL7A 4K75A 2DM8A 1U3BA 2M0VA 5HFDA 5HETA 3WKMA 3TSVA 2DKRA 4Q3HA 1UJUA 1LCYA 2M0UA 3K82A 3R0HA 4Z33A 4XHVA 1BE9A 1X45A 2L4TA 1U37A 5G1DA 4UU6A 2DC2A 2OZFA 1FC6A 2CSJA 3LNYA 4OEOA 3SOEA 4LMMA 2PKTA 1N7TA 3AXAA 2EHRA 3KHFA 3NFLA 3PDZA 5GLJA 4GVDA 2MX6A 1U39A 3ZRTA 4K78A 3MH7A 3DORA 4Q2PA 1IU2A 3DJ1A 4GVCA 2HE4A 1V5LA 4HOPB 2QBWA 2M0TA 3K1RA 2VZ5A 3EGHC 2IWOA 3DIWA 2X7ZA 3WKLA 3CBZA 1TP3A 1WFGA 1FC7A 1XZ9A 2W7RA 2VWRA 1WHAA 1UEWA 2CSSA 3KZDA 3JXTA 3I1EA 3R68A 2PZDA 4E35A 5EYZA 1X5QA 4NXPA 1ZUBA 3KZEA 2OGPA 1UJDA 4JOKA 1WI4A 2RCZA 1RZXA 3NFKA 2I1NA 5FB8C 2KOMA 2MHOA 2G5MB 4GHNA 2KPLA 3QJMA 5HF1A 5E11A 1X5RA 2I0IA 2CS5A 2EDZA 4K6YA 2PDZA 4PQWA 4Q2OA 2HE2A 1IU0A 2EGKA 3GDSA 1MFGA 4YDPA 1TP5A 4JOGA 2EEIA 2M3MA 2H3LA 2KJDA 3QO6A 1W9OA 2QKUA 4NXQA 3TSWA 3O5NA 5IL9A 3GABA 1TQ3A 3BPUA 1UF1A 1FC9A 4RI0A 2GZVA 4YYXA 1V6BA 3DJ3A 1VCWA 1I16A 2KJPA 2I6VA 2R4HA 1FCFA 1W9QA 4JOPA 4P0CA 3CH8A 3QE1A 4H11A 2JILA 4NMRA 2KV8A 2AWXA 3ID3A 4Q2NA 1X9ZA 5F67A 1KY9A 5B42A 4NMOA 3CC0A 1SOTA 4NMSA 5G1EA 2K20A 2YT7A 1V1TA 2Q3GA 2K1ZA 4O06A 3R69A 1Q7XA 2YTWA 1R6JA 2QKVA 1GM1A 1M5ZA 2VPHA 4JORA 3MH4A 4UU5A 2O2TA 1N6FA 5F3XA 2QKTA 5DTHA 1X6DA 1D5GA 4NNLA 4OAJA 3ID4A 2DJTA 2LC6A 2Q9VA 2KRGA 1OZIA 1W9EA 4EDJA 2JIKA 1UEZA 2EAQA 2HGAA 2KL1A 4NMVA 5HDYA 1UITA 3OU0A 2OQSA 1G9OA 3K50A 2EXGA 3SHWA 1UM1A 3GDVA 3PS4A 1QAVA 3GCNA 3O46A 2L97A 2DAZA 1UEPA 3VQFA 2KBSA 1WHDA 3GGEA 2GEFA 5HEDA 3CBXA 2Z17A 4N6XA 1GQ5A 2H2BA 1Z86A 2IWNA 2UZCA 2M0ZA 4E34A 2V1WA 4REYA 2AINA 1WG6A 2KOHA 2KOJA 1GQ4A 2JWEA 1ZOKA 3FY5A 1NTEA 4F8KA 2FCFA 1WF7A 3CBYA 5HF4A 2ZPLA 3STJA 4NXRA 2EDPA 3QGLA 4Q6SA 2D90A 4JL7A 5EZ0A 4JOJA 1WI2A 4WYTA 4E3BA 1SOZA 3L4FD 2KJKA 5HFBA 2LUIA 1V62A 3B76A 1UFXA 3EGGC 2QG1A 2JREA 2JSNA 2FN5A 2VSVA 1L6OA 4K76A 2WL7A 1Q3OA 1NF3C 1P1EA 2F0AA 1WJLA 2YUBA 1TE0A 1VJ6A 1N6EA 2EEHA 2AWWA 2REYA 3DJAA 4P2AB 3GCOA 1BFEA 2F5YA 4MPAA 2IWPA 1KWAA 5D13A 3GDUA 3PV4A 3E17A 2OS6A 4R2ZA 2EJYA 2FNEA 1I92A 1N6DA 3PDVA 1X8SA 5HEBA 4AMHA 2QT5A 1UHPA 2KAWA 5E22A 2PA1A
chains in the Genus database with same CATH topology
2YUYA 3ID2A 2YT8A 2Z9IA 1N7FA 2PNTA 2IWQA 3SFJA 2M10A 2I4SA 2RRMA 1T2MA 3LNXA 2FE5A 1KEFA 2LOBA 1WIFA 2G2LA 1RY4A 2OPGA 5H3JA 4NMTA 2I0LA 2KYLA 3I18A 1Z87A 2PKUA 5E21A 2DLUA 2KA9A 1VAEA 2KQFA 2OSGA 1YBOA 3KDGA 4WYUA 1MC7A 4Q6HA 3NGHA 3TMHA 3PV5A 4JJ3A 4HOPA 1UM7A 1WF8A 1WH1A 2VSPA 1PDRA 2OCSA 5JXBA 2R3YA 3TSZA 1RGRA 2DB5A 5I7ZA 3QJNA 2OMJA 2BYGA 2V90A 4FLNA 2AWUA 3VQGA 3MH6A 1X5NA 1OBZA 1N99A 2DMZA 1QLCA 1MFLA 2H2CA 5HFFA 3SUZA 2ZPMA 1QAVB 2L4SA 3GSLA 3RLEA 2EV8A 3GJ9A 1OBYA 2JXOA 5HFEA 1WFVA 2JINA 5E1YA 5FHTA 4L8NA 2EGOA 2LC7A 4JOHA 4OEPA 4NNMA 2ENOA 2I04A 1U38A 2DLSA 4Q2QA 4KFVA 1OBXA 2D92A 5GNDA 3CYYA 1IHJA 4K72A 2E7KA 5ILBA 5A2PA 3RL8A 5HFCA 3OTPA 1QAUA 1P1DA 1Q3PA 4JOFA 5HJ1A 2KPKA 3KDKA 3PV2A 5E6PB 1K32A 1N7EA 2LA8A 5HEYA 2EEJA 1V5QA 2EEGA 2P3WA 4G69A 4JJ0A 3HVQC 3QDOA 2KG2A 1B8QA 4NMQA 2W4FA 1RGWA 2H3MA 1VB7A 3ID1A 2JOAA 4KFWA 2VRFA 1UEQA 4Z8JA 2EDVA 3HPKA 3SHUA 1Y7NA 1UJVA 3I4WA 3NCVA 4FGMA 4NMPA 3QIKA 2EGNA 3HPMA 2D8IA 3CS0A 4JOEA 5B6LA 1VA8A 1Y8TA 4IC6A 3RL7A 4K75A 2DM8A 1U3BA 2M0VA 5HFDA 5HETA 3WKMA 3TSVA 2DKRA 4Q3HA 1UJUA 1LCYA 2M0UA 3K82A 3R0HA 4Z33A 4XHVA 1BE9A 1X45A 2L4TA 1U37A 5G1DA 4UU6A 2DC2A 2OZFA 1FC6A 2CSJA 3LNYA 4OEOA 3SOEA 4LMMA 2PKTA 1N7TA 3AXAA 2EHRA 3KHFA 3NFLA 3PDZA 5GLJA 4GVDA 2MX6A 1U39A 3ZRTA 4K78A 3MH7A 3DORA 4Q2PA 1IU2A 3DJ1A 4GVCA 2HE4A 1V5LA 4HOPB 2QBWA 2M0TA 3K1RA 2VZ5A 3EGHC 2IWOA 3DIWA 2X7ZA 3WKLA 3CBZA 1TP3A 1WFGA 1FC7A 1XZ9A 2W7RA 2VWRA 1WHAA 1UEWA 2CSSA 3KZDA 3JXTA 3I1EA 3R68A 2PZDA 4E35A 5EYZA 1X5QA 4NXPA 1ZUBA 3KZEA 2OGPA 1UJDA 4JOKA 1WI4A 2RCZA 1RZXA 3NFKA 2I1NA 5FB8C 2KOMA 2MHOA 2G5MB 4GHNA 2KPLA 3QJMA 5HF1A 5E11A 1X5RA 2I0IA 2CS5A 2EDZA 4K6YA 2PDZA 4PQWA 4Q2OA 2HE2A 1IU0A 2EGKA 3GDSA 1MFGA 4YDPA 1TP5A 4JOGA 2EEIA 2M3MA 2H3LA 2KJDA 3QO6A 1W9OA 2QKUA 4NXQA 3TSWA 3O5NA 5IL9A 3GABA 1TQ3A 3BPUA 1UF1A 1FC9A 4RI0A 2GZVA 4YYXA 1V6BA 3DJ3A 1VCWA 1I16A 2KJPA 2I6VA 2R4HA 1FCFA 1W9QA 4JOPA 4P0CA 3CH8A 3QE1A 4H11A 2JILA 4NMRA 2KV8A 2AWXA 3ID3A 4Q2NA 1X9ZA 5F67A 1KY9A 5B42A 4NMOA 3CC0A 1SOTA 4NMSA 5G1EA 2K20A 2YT7A 1V1TA 2Q3GA 2K1ZA 4O06A 3R69A 1Q7XA 2YTWA 1R6JA 2QKVA 1GM1A 1M5ZA 2VPHA 4JORA 3MH4A 4UU5A 2O2TA 1N6FA 5F3XA 2QKTA 5DTHA 1X6DA 1D5GA 4NNLA 4OAJA 3ID4A 2DJTA 2LC6A 2Q9VA 2KRGA 1OZIA 1W9EA 4EDJA 2JIKA 1UEZA 2EAQA 2HGAA 2KL1A 4NMVA 5HDYA 1UITA 3OU0A 2OQSA 1G9OA 3K50A 2EXGA 3SHWA 1UM1A 3GDVA 3PS4A 1QAVA 3GCNA 3O46A 2L97A 2DAZA 1UEPA 3VQFA 2KBSA 1WHDA 3GGEA 2GEFA 5HEDA 3CBXA 2Z17A 4N6XA 1GQ5A 2H2BA 1Z86A 2IWNA 2UZCA 2M0ZA 4E34A 2V1WA 4REYA 2AINA 1WG6A 2KOHA 2KOJA 1GQ4A 2JWEA 1ZOKA 3FY5A 1NTEA 4F8KA 2FCFA 1WF7A 3CBYA 5HF4A 2ZPLA 3STJA 4NXRA 2EDPA 3QGLA 4Q6SA 2D90A 4JL7A 5EZ0A 4JOJA 1WI2A 4WYTA 4E3BA 1SOZA 3L4FD 2KJKA 5HFBA 2LUIA 1V62A 3B76A 1UFXA 3EGGC 2QG1A 2JREA 2JSNA 2FN5A 2VSVA 1L6OA 4K76A 2WL7A 1Q3OA 1NF3C 1P1EA 2F0AA 1WJLA 2YUBA 1TE0A 1VJ6A 1N6EA 2EEHA 2AWWA 2REYA 3DJAA 4P2AB 3GCOA 1BFEA 2F5YA 4MPAA 2IWPA 1KWAA 5D13A 3GDUA 3PV4A 3E17A 2OS6A 4R2ZA 2EJYA 2FNEA 1I92A 1N6DA 3PDVA 1X8SA 5HEBA 4AMHA 2QT5A 1UHPA 2KAWA 5E22A 2PA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUY A;  3ID2 A;  2YT8 A;  2Z9I A;  1N7F A;  2PNT A;  2IWQ A;  3SFJ A;  2M10 A;  2I4S A;  2RRM A;  1T2M A;  3LNX A;  2FE5 A;  1KEF A;  2LOB A;  1WIF A;  2G2L A;  1RY4 A;  2OPG A;  5H3J A;  4NMT A;  2I0L A;  2KYL A;  3I18 A;  1Z87 A;  2PKU A;  5E21 A;  2DLU A;  2KA9 A;  1VAE A;  2KQF A;  2OSG A;  1YBO A;  4WYU A;  1MC7 A;  4Q6H A;  3NGH A;  3TMH A;  3PV5 A;  4HOP A;  1UM7 A;  1WF8 A;  1WH1 A;  2VSP A;  1PDR A;  2OCS A;  5JXB A;  2R3Y A;  3TSZ A;  1RGR A;  2DB5 A;  5I7Z A;  3QJN A;  2OMJ A;  2BYG A;  2V90 A;  2AWU A;  3VQG A;  3MH6 A;  1X5N A;  1OBZ A;  1N99 A;  2DMZ A;  1QLC A;  1MFL A;  2H2C A;  5HFF A;  3SUZ A;  2ZPM A;  1QAV B;  2L4S A;  3GSL A;  3RLE A;  2EV8 A;  3GJ9 A;  1OBY A;  2JXO A;  5HFE A;  1WFV A;  2JIN A;  5E1Y A;  5FHT A;  4L8N A;  2EGO A;  2LC7 A;  4JOH A;  4OEP A;  4NNM A;  2ENO A;  2I04 A;  1U38 A;  2DLS A;  4Q2Q A;  4KFV A;  1OBX A;  2D92 A;  5GND A;  3CYY A;  1IHJ A;  4K72 A;  2E7K A;  5A2P A;  3RL8 A;  5HFC A;  3OTP A;  1QAU A;  1P1D A;  1Q3P A;  4JOF A;  5HJ1 A;  2KPK A;  3PV2 A;  5E6P B;  1K32 A;  1N7E A;  2LA8 A;  5HEY A;  2EEJ A;  1V5Q A;  2EEG A;  2P3W A;  4G69 A;  3HVQ C;  3QDO A;  2KG2 A;  1B8Q A;  4NMQ A;  2W4F A;  1RGW A;  2H3M A;  1VB7 A;  3ID1 A;  2JOA A;  4KFW A;  2VRF A;  1UEQ A;  4Z8J A;  2EDV A;  3HPK A;  3SHU A;  1Y7N A;  1UJV A;  3I4W A;  4FGM A;  4NMP A;  3QIK A;  2EGN A;  3HPM A;  2D8I A;  3CS0 A;  4JOE A;  5B6L A;  1VA8 A;  1Y8T A;  4IC6 A;  3RL7 A;  4K75 A;  2DM8 A;  1U3B A;  2M0V A;  5HFD A;  5HET A;  3WKM A;  3TSV A;  2DKR A;  4Q3H A;  1UJU A;  1LCY A;  2M0U A;  3K82 A;  3R0H A;  4Z33 A;  4XHV A;  1BE9 A;  1X45 A;  2L4T A;  1U37 A;  5G1D A;  4UU6 A;  2DC2 A;  2OZF A;  1FC6 A;  2CSJ A;  3LNY A;  4OEO A;  3SOE A;  4LMM A;  2PKT A;  1N7T A;  3AXA A;  2EHR A;  3KHF A;  3NFL A;  3PDZ A;  5GLJ A;  4GVD A;  2MX6 A;  1U39 A;  3ZRT A;  4K78 A;  3MH7 A;  3DOR A;  4Q2P A;  1IU2 A;  3DJ1 A;  4GVC A;  2HE4 A;  1V5L A;  4HOP B;  2QBW A;  2M0T A;  3K1R A;  2VZ5 A;  3EGH C;  2IWO A;  3DIW A;  2X7Z A;  3WKL A;  3CBZ A;  1TP3 A;  1WFG A;  1FC7 A;  1XZ9 A;  2W7R A;  2VWR A;  1WHA A;  1UEW A;  2CSS A;  3KZD A;  3JXT A;  3I1E A;  3R68 A;  2PZD A;  4E35 A;  5EYZ A;  1X5Q A;  4NXP A;  1ZUB A;  3KZE A;  2OGP A;  1UJD A;  4JOK A;  1WI4 A;  2RCZ A;  1RZX A;  3NFK A;  2I1N A;  5FB8 C;  2KOM A;  2MHO A;  2G5M B;  4GHN A;  2KPL A;  3QJM A;  5HF1 A;  5E11 A;  1X5R A;  2I0I A;  2CS5 A;  2EDZ A;  4K6Y A;  2PDZ A;  4PQW A;  4Q2O A;  2HE2 A;  1IU0 A;  2EGK A;  3GDS A;  1MFG A;  4YDP A;  1TP5 A;  4JOG A;  2EEI A;  2M3M A;  2H3L A;  2KJD A;  3QO6 A;  1W9O A;  2QKU A;  4NXQ A;  3TSW A;  3O5N A;  1TQ3 A;  3BPU A;  1UF1 A;  1FC9 A;  4RI0 A;  2GZV A;  4YYX A;  1V6B A;  3DJ3 A;  1VCW A;  1I16 A;  2KJP A;  2I6V A;  2R4H A;  1FCF A;  1W9Q A;  4JOP A;  4P0C A;  3CH8 A;  3QE1 A;  4H11 A;  2JIL A;  4NMR A;  2KV8 A;  2AWX A;  3ID3 A;  4Q2N A;  5F67 A;  1KY9 A;  4NMO A;  3CC0 A;  1SOT A;  4NMS A;  5G1E A;  2K20 A;  1V1T A;  2YT7 A;  2Q3G A;  2K1Z A;  4O06 A;  3R69 A;  1Q7X A;  2YTW A;  1R6J A;  2QKV A;  1GM1 A;  1M5Z A;  2VPH A;  4JOR A;  3MH4 A;  4UU5 A;  2O2T A;  1N6F A;  5F3X A;  2QKT A;  5DTH A;  1X6D A;  1D5G A;  4NNL A;  4OAJ A;  3ID4 A;  2DJT A;  2LC6 A;  2Q9V A;  2KRG A;  1OZI A;  1W9E A;  4EDJ A;  2JIK A;  1UEZ A;  2EAQ A;  2HGA A;  2KL1 A;  4NMV A;  5HDY A;  1UIT A;  3OU0 A;  2OQS A;  1G9O A;  3K50 A;  2EXG A;  3SHW A;  1UM1 A;  3GDV A;  3PS4 A;  1QAV A;  3GCN A;  3O46 A;  2L97 A;  2DAZ A;  1UEP A;  3VQF A;  2KBS A;  1WHD A;  3GGE A;  5HED A;  3CBX A;  2Z17 A;  4N6X A;  1GQ5 A;  2H2B A;  1Z86 A;  2IWN A;  2UZC A;  2M0Z A;  4E34 A;  2V1W A;  4REY A;  2AIN A;  1WG6 A;  2KOH A;  2KOJ A;  1GQ4 A;  2JWE A;  1ZOK A;  3FY5 A;  1NTE A;  4F8K A;  2FCF A;  1WF7 A;  3CBY A;  5HF4 A;  2ZPL A;  3STJ A;  4NXR A;  2EDP A;  3QGL A;  4Q6S A;  2D90 A;  4JL7 A;  5EZ0 A;  4JOJ A;  1WI2 A;  4WYT A;  4E3B A;  1SOZ A;  3L4F D;  2KJK A;  5HFB A;  2LUI A;  1V62 A;  3B76 A;  1UFX A;  3EGG C;  2QG1 A;  2JRE A;  2FN5 A;  2VSV A;  1L6O A;  4K76 A;  2WL7 A;  1Q3O A;  1NF3 C;  1P1E A;  2F0A A;  1WJL A;  2YUB A;  1TE0 A;  1VJ6 A;  1N6E A;  2EEH A;  2AWW A;  2REY A;  3DJA A;  4P2A B;  3GCO A;  1BFE A;  2F5Y A;  4MPA A;  2IWP A;  1KWA A;  5D13 A;  3GDU A;  3PV4 A;  3E17 A;  2OS6 A;  4R2Z A;  2EJY A;  2FNE A;  1I92 A;  1N6D A;  3PDV A;  1X8S A;  5HEB A;  4AMH A;  2QT5 A;  1UHP A;  2KAW A;  5E22 A;  2PA1 A; 
#chains in the Genus database with same CATH topology
 2YUY A;  3ID2 A;  2YT8 A;  2Z9I A;  1N7F A;  2PNT A;  2IWQ A;  3SFJ A;  2M10 A;  2I4S A;  2RRM A;  1T2M A;  3LNX A;  2FE5 A;  1KEF A;  2LOB A;  1WIF A;  2G2L A;  1RY4 A;  2OPG A;  5H3J A;  4NMT A;  2I0L A;  2KYL A;  3I18 A;  1Z87 A;  2PKU A;  5E21 A;  2DLU A;  2KA9 A;  1VAE A;  2KQF A;  2OSG A;  1YBO A;  3KDG A;  4WYU A;  1MC7 A;  4Q6H A;  3NGH A;  3TMH A;  3PV5 A;  4JJ3 A;  4HOP A;  1UM7 A;  1WF8 A;  1WH1 A;  2VSP A;  1PDR A;  2OCS A;  5JXB A;  2R3Y A;  3TSZ A;  1RGR A;  2DB5 A;  5I7Z A;  3QJN A;  2OMJ A;  2BYG A;  2V90 A;  4FLN A;  2AWU A;  3VQG A;  3MH6 A;  1X5N A;  1OBZ A;  1N99 A;  2DMZ A;  1QLC A;  1MFL A;  2H2C A;  5HFF A;  3SUZ A;  2ZPM A;  1QAV B;  2L4S A;  3GSL A;  3RLE A;  2EV8 A;  3GJ9 A;  1OBY A;  2JXO A;  5HFE A;  1WFV A;  2JIN A;  5E1Y A;  5FHT A;  4L8N A;  2EGO A;  2LC7 A;  4JOH A;  4OEP A;  4NNM A;  2ENO A;  2I04 A;  1U38 A;  2DLS A;  4Q2Q A;  4KFV A;  1OBX A;  2D92 A;  5GND A;  3CYY A;  1IHJ A;  4K72 A;  2E7K A;  5ILB A;  5A2P A;  3RL8 A;  5HFC A;  3OTP A;  1QAU A;  1P1D A;  1Q3P A;  4JOF A;  5HJ1 A;  2KPK A;  3KDK A;  3PV2 A;  5E6P B;  1K32 A;  1N7E A;  2LA8 A;  5HEY A;  2EEJ A;  1V5Q A;  2EEG A;  2P3W A;  4G69 A;  4JJ0 A;  3HVQ C;  3QDO A;  2KG2 A;  1B8Q A;  4NMQ A;  2W4F A;  1RGW A;  2H3M A;  1VB7 A;  3ID1 A;  2JOA A;  4KFW A;  2VRF A;  1UEQ A;  4Z8J A;  2EDV A;  3HPK A;  3SHU A;  1Y7N A;  1UJV A;  3I4W A;  3NCV A;  4FGM A;  4NMP A;  3QIK A;  2EGN A;  3HPM A;  2D8I A;  3CS0 A;  4JOE A;  5B6L A;  1VA8 A;  1Y8T A;  4IC6 A;  3RL7 A;  4K75 A;  2DM8 A;  1U3B A;  2M0V A;  5HFD A;  5HET A;  3WKM A;  3TSV A;  2DKR A;  4Q3H A;  1UJU A;  1LCY A;  2M0U A;  3K82 A;  3R0H A;  4Z33 A;  4XHV A;  1BE9 A;  1X45 A;  2L4T A;  1U37 A;  5G1D A;  4UU6 A;  2DC2 A;  2OZF A;  1FC6 A;  2CSJ A;  3LNY A;  4OEO A;  3SOE A;  4LMM A;  2PKT A;  1N7T A;  3AXA A;  2EHR A;  3KHF A;  3NFL A;  3PDZ A;  5GLJ A;  4GVD A;  2MX6 A;  1U39 A;  3ZRT A;  4K78 A;  3MH7 A;  3DOR A;  4Q2P A;  1IU2 A;  3DJ1 A;  4GVC A;  2HE4 A;  1V5L A;  4HOP B;  2QBW A;  2M0T A;  3K1R A;  2VZ5 A;  3EGH C;  2IWO A;  3DIW A;  2X7Z A;  3WKL A;  3CBZ A;  1TP3 A;  1WFG A;  1FC7 A;  1XZ9 A;  2W7R A;  2VWR A;  1WHA A;  1UEW A;  2CSS A;  3KZD A;  3JXT A;  3I1E A;  3R68 A;  2PZD A;  4E35 A;  5EYZ A;  1X5Q A;  4NXP A;  1ZUB A;  3KZE A;  2OGP A;  1UJD A;  4JOK A;  1WI4 A;  2RCZ A;  1RZX A;  3NFK A;  2I1N A;  5FB8 C;  2KOM A;  2MHO A;  2G5M B;  4GHN A;  2KPL A;  3QJM A;  5HF1 A;  5E11 A;  1X5R A;  2I0I A;  2CS5 A;  2EDZ A;  4K6Y A;  2PDZ A;  4PQW A;  4Q2O A;  2HE2 A;  1IU0 A;  2EGK A;  3GDS A;  1MFG A;  4YDP A;  1TP5 A;  4JOG A;  2EEI A;  2M3M A;  2H3L A;  2KJD A;  3QO6 A;  1W9O A;  2QKU A;  4NXQ A;  3TSW A;  3O5N A;  5IL9 A;  3GAB A;  1TQ3 A;  3BPU A;  1UF1 A;  1FC9 A;  4RI0 A;  2GZV A;  4YYX A;  1V6B A;  3DJ3 A;  1VCW A;  1I16 A;  2KJP A;  2I6V A;  2R4H A;  1FCF A;  1W9Q A;  4JOP A;  4P0C A;  3CH8 A;  3QE1 A;  4H11 A;  2JIL A;  4NMR A;  2KV8 A;  2AWX A;  3ID3 A;  4Q2N A;  1X9Z A;  5F67 A;  1KY9 A;  5B42 A;  4NMO A;  3CC0 A;  1SOT A;  4NMS A;  5G1E A;  2K20 A;  2YT7 A;  1V1T A;  2Q3G A;  2K1Z A;  4O06 A;  3R69 A;  1Q7X A;  2YTW A;  1R6J A;  2QKV A;  1GM1 A;  1M5Z A;  2VPH A;  4JOR A;  3MH4 A;  4UU5 A;  2O2T A;  1N6F A;  5F3X A;  2QKT A;  5DTH A;  1X6D A;  1D5G A;  4NNL A;  4OAJ A;  3ID4 A;  2DJT A;  2LC6 A;  2Q9V A;  2KRG A;  1OZI A;  1W9E A;  4EDJ A;  2JIK A;  1UEZ A;  2EAQ A;  2HGA A;  2KL1 A;  4NMV A;  5HDY A;  1UIT A;  3OU0 A;  2OQS A;  1G9O A;  3K50 A;  2EXG A;  3SHW A;  1UM1 A;  3GDV A;  3PS4 A;  1QAV A;  3GCN A;  3O46 A;  2L97 A;  2DAZ A;  1UEP A;  3VQF A;  2KBS A;  1WHD A;  3GGE A;  2GEF A;  5HED A;  3CBX A;  2Z17 A;  4N6X A;  1GQ5 A;  2H2B A;  1Z86 A;  2IWN A;  2UZC A;  2M0Z A;  4E34 A;  2V1W A;  4REY A;  2AIN A;  1WG6 A;  2KOH A;  2KOJ A;  1GQ4 A;  2JWE A;  1ZOK A;  3FY5 A;  1NTE A;  4F8K A;  2FCF A;  1WF7 A;  3CBY A;  5HF4 A;  2ZPL A;  3STJ A;  4NXR A;  2EDP A;  3QGL A;  4Q6S A;  2D90 A;  4JL7 A;  5EZ0 A;  4JOJ A;  1WI2 A;  4WYT A;  4E3B A;  1SOZ A;  3L4F D;  2KJK A;  5HFB A;  2LUI A;  1V62 A;  3B76 A;  1UFX A;  3EGG C;  2QG1 A;  2JRE A;  2JSN A;  2FN5 A;  2VSV A;  1L6O A;  4K76 A;  2WL7 A;  1Q3O A;  1NF3 C;  1P1E A;  2F0A A;  1WJL A;  2YUB A;  1TE0 A;  1VJ6 A;  1N6E A;  2EEH A;  2AWW A;  2REY A;  3DJA A;  4P2A B;  3GCO A;  1BFE A;  2F5Y A;  4MPA A;  2IWP A;  1KWA A;  5D13 A;  3GDU A;  3PV4 A;  3E17 A;  2OS6 A;  4R2Z A;  2EJY A;  2FNE A;  1I92 A;  1N6D A;  3PDV A;  1X8S A;  5HEB A;  4AMH A;  2QT5 A;  1UHP A;  2KAW A;  5E22 A;  2PA1 A; 
#chains in the Genus database with same CATH homology
 2YUY A;  3ID2 A;  2YT8 A;  2Z9I A;  1N7F A;  2PNT A;  2IWQ A;  3SFJ A;  2M10 A;  2I4S A;  2RRM A;  1T2M A;  3LNX A;  2FE5 A;  1KEF A;  2LOB A;  1WIF A;  2G2L A;  1RY4 A;  2OPG A;  5H3J A;  4NMT A;  2I0L A;  2KYL A;  3I18 A;  1Z87 A;  2PKU A;  5E21 A;  2DLU A;  2KA9 A;  1VAE A;  2KQF A;  2OSG A;  1YBO A;  3KDG A;  4WYU A;  1MC7 A;  4Q6H A;  3NGH A;  3TMH A;  3PV5 A;  4JJ3 A;  4HOP A;  1UM7 A;  1WF8 A;  1WH1 A;  2VSP A;  1PDR A;  2OCS A;  5JXB A;  2R3Y A;  3TSZ A;  1RGR A;  2DB5 A;  5I7Z A;  3QJN A;  2OMJ A;  2BYG A;  2V90 A;  4FLN A;  2AWU A;  3VQG A;  3MH6 A;  1X5N A;  1OBZ A;  1N99 A;  2DMZ A;  1QLC A;  1MFL A;  2H2C A;  5HFF A;  3SUZ A;  2ZPM A;  1QAV B;  2L4S A;  3GSL A;  3RLE A;  2EV8 A;  3GJ9 A;  1OBY A;  2JXO A;  5HFE A;  1WFV A;  2JIN A;  5E1Y A;  5FHT A;  4L8N A;  2EGO A;  2LC7 A;  4JOH A;  4OEP A;  4NNM A;  2ENO A;  2I04 A;  1U38 A;  2DLS A;  4Q2Q A;  4KFV A;  1OBX A;  2D92 A;  5GND A;  3CYY A;  1IHJ A;  4K72 A;  2E7K A;  5ILB A;  5A2P A;  3RL8 A;  5HFC A;  3OTP A;  1QAU A;  1P1D A;  1Q3P A;  4JOF A;  5HJ1 A;  2KPK A;  3KDK A;  3PV2 A;  5E6P B;  1K32 A;  1N7E A;  2LA8 A;  5HEY A;  2EEJ A;  1V5Q A;  2EEG A;  2P3W A;  4G69 A;  4JJ0 A;  3HVQ C;  3QDO A;  2KG2 A;  1B8Q A;  4NMQ A;  2W4F A;  1RGW A;  2H3M A;  1VB7 A;  3ID1 A;  2JOA A;  4KFW A;  2VRF A;  1UEQ A;  4Z8J A;  2EDV A;  3HPK A;  3SHU A;  1Y7N A;  1UJV A;  3I4W A;  3NCV A;  4FGM A;  4NMP A;  3QIK A;  2EGN A;  3HPM A;  2D8I A;  3CS0 A;  4JOE A;  5B6L A;  1VA8 A;  1Y8T A;  4IC6 A;  3RL7 A;  4K75 A;  2DM8 A;  1U3B A;  2M0V A;  5HFD A;  5HET A;  3WKM A;  3TSV A;  2DKR A;  4Q3H A;  1UJU A;  1LCY A;  2M0U A;  3K82 A;  3R0H A;  4Z33 A;  4XHV A;  1BE9 A;  1X45 A;  2L4T A;  1U37 A;  5G1D A;  4UU6 A;  2DC2 A;  2OZF A;  1FC6 A;  2CSJ A;  3LNY A;  4OEO A;  3SOE A;  4LMM A;  2PKT A;  1N7T A;  3AXA A;  2EHR A;  3KHF A;  3NFL A;  3PDZ A;  5GLJ A;  4GVD A;  2MX6 A;  1U39 A;  3ZRT A;  4K78 A;  3MH7 A;  3DOR A;  4Q2P A;  1IU2 A;  3DJ1 A;  4GVC A;  2HE4 A;  1V5L A;  4HOP B;  2QBW A;  2M0T A;  3K1R A;  2VZ5 A;  3EGH C;  2IWO A;  3DIW A;  2X7Z A;  3WKL A;  3CBZ A;  1TP3 A;  1WFG A;  1FC7 A;  1XZ9 A;  2W7R A;  2VWR A;  1WHA A;  1UEW A;  2CSS A;  3KZD A;  3JXT A;  3I1E A;  3R68 A;  2PZD A;  4E35 A;  5EYZ A;  1X5Q A;  4NXP A;  1ZUB A;  3KZE A;  2OGP A;  1UJD A;  4JOK A;  1WI4 A;  2RCZ A;  1RZX A;  3NFK A;  2I1N A;  5FB8 C;  2KOM A;  2MHO A;  2G5M B;  4GHN A;  2KPL A;  3QJM A;  5HF1 A;  5E11 A;  1X5R A;  2I0I A;  2CS5 A;  2EDZ A;  4K6Y A;  2PDZ A;  4PQW A;  4Q2O A;  2HE2 A;  1IU0 A;  2EGK A;  3GDS A;  1MFG A;  4YDP A;  1TP5 A;  4JOG A;  2EEI A;  2M3M A;  2H3L A;  2KJD A;  3QO6 A;  1W9O A;  2QKU A;  4NXQ A;  3TSW A;  3O5N A;  5IL9 A;  3GAB A;  1TQ3 A;  3BPU A;  1UF1 A;  1FC9 A;  4RI0 A;  2GZV A;  4YYX A;  1V6B A;  3DJ3 A;  1VCW A;  1I16 A;  2KJP A;  2I6V A;  2R4H A;  1FCF A;  1W9Q A;  4JOP A;  4P0C A;  3CH8 A;  3QE1 A;  4H11 A;  2JIL A;  4NMR A;  2KV8 A;  2AWX A;  3ID3 A;  4Q2N A;  1X9Z A;  5F67 A;  1KY9 A;  5B42 A;  4NMO A;  3CC0 A;  1SOT A;  4NMS A;  5G1E A;  2K20 A;  2YT7 A;  1V1T A;  2Q3G A;  2K1Z A;  4O06 A;  3R69 A;  1Q7X A;  2YTW A;  1R6J A;  2QKV A;  1GM1 A;  1M5Z A;  2VPH A;  4JOR A;  3MH4 A;  4UU5 A;  2O2T A;  1N6F A;  5F3X A;  2QKT A;  5DTH A;  1X6D A;  1D5G A;  4NNL A;  4OAJ A;  3ID4 A;  2DJT A;  2LC6 A;  2Q9V A;  2KRG A;  1OZI A;  1W9E A;  4EDJ A;  2JIK A;  1UEZ A;  2EAQ A;  2HGA A;  2KL1 A;  4NMV A;  5HDY A;  1UIT A;  3OU0 A;  2OQS A;  1G9O A;  3K50 A;  2EXG A;  3SHW A;  1UM1 A;  3GDV A;  3PS4 A;  1QAV A;  3GCN A;  3O46 A;  2L97 A;  2DAZ A;  1UEP A;  3VQF A;  2KBS A;  1WHD A;  3GGE A;  2GEF A;  5HED A;  3CBX A;  2Z17 A;  4N6X A;  1GQ5 A;  2H2B A;  1Z86 A;  2IWN A;  2UZC A;  2M0Z A;  4E34 A;  2V1W A;  4REY A;  2AIN A;  1WG6 A;  2KOH A;  2KOJ A;  1GQ4 A;  2JWE A;  1ZOK A;  3FY5 A;  1NTE A;  4F8K A;  2FCF A;  1WF7 A;  3CBY A;  5HF4 A;  2ZPL A;  3STJ A;  4NXR A;  2EDP A;  3QGL A;  4Q6S A;  2D90 A;  4JL7 A;  5EZ0 A;  4JOJ A;  1WI2 A;  4WYT A;  4E3B A;  1SOZ A;  3L4F D;  2KJK A;  5HFB A;  2LUI A;  1V62 A;  3B76 A;  1UFX A;  3EGG C;  2QG1 A;  2JRE A;  2JSN A;  2FN5 A;  2VSV A;  1L6O A;  4K76 A;  2WL7 A;  1Q3O A;  1NF3 C;  1P1E A;  2F0A A;  1WJL A;  2YUB A;  1TE0 A;  1VJ6 A;  1N6E A;  2EEH A;  2AWW A;  2REY A;  3DJA A;  4P2A B;  3GCO A;  1BFE A;  2F5Y A;  4MPA A;  2IWP A;  1KWA A;  5D13 A;  3GDU A;  3PV4 A;  3E17 A;  2OS6 A;  4R2Z A;  2EJY A;  2FNE A;  1I92 A;  1N6D A;  3PDV A;  1X8S A;  5HEB A;  4AMH A;  2QT5 A;  1UHP A;  2KAW A;  5E22 A;  2PA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...