3GCOA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyqf omp peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
302
Chain Sequence
b'DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 59
structure length 302
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA01
2F9VA 2GDEH 3BTTE 4HZHA 3VB4A 3C27B 1C1QA 4H11A 2RDLA 1O3IA 4WMFA 3FANA 4UDWH 1C2HA 5B6OA 1EZUC 2SGDE 2FOBA 2VH0A 1T7CA 1CSOE 1X5NA 1DWBH 1O5FH 1HCGA 3SJKA 5E2PA 2BY7X 3OTJE 4FU9A 1BB0B 3SNEA 3MU5A 1TAWA 2QG1A 1NY22 2KJKA 3GCOA 1CQQA 4BXWA 5JDUB 4Z6AH 4ZUHA 1W2KH 4MNVA 1EPTB 4FUFA 1C5NH 2BDHA 2BLQA 2JKHA 1EAWA 1IAUA 2OBOA 3ZVCA 2PWXA 4H6TA 2VIVA 2AH4X 1KXFA 1V1TA 3BV9B 3ZZ5A 3TSZA 4YT6H 1WBGB 2ZPSA 2A4GA 1CVWH 4JZEH 1XUGA 1ZTJA 2XCFA 2ZG0H 3DORA 2QIQA 1GBBA 4FUIA 3VGCC 1MZDA 2KOMA 1N1LA 5DP7A 2BD7A 5EYZA 5C5NA 5HFFA 5B6LA 4E34A 1BIOA 1YBOA 1C2JA 1EAXA 2OPGA 1ELGA 3NKKA 1YCPH 3F1SB 4Z0KA 1C2FA 4JL7A 2FM2A 3HPKA 1P2QA 3QZRA 3QJMA 2ANWA 4ISHH 1AFQC 1XUKA 4X6OA 8ESTE 2KAWA 1O5DH 2OD3B 3RXAA 1QL9A 2Y6TA 1J17T 2ZP0H 1MTVA 1AWHB 2QKVA 1U3BA 3GOVB 5D13A 1GJ7B 1ZHRA 1HXEH 1I16A 5FPTA 1ZMJA 1C5VA 3K50A 2ANYA 2R2WU 3UFAA 5JBCS 2FESH 1WSSH 2ALPA 1W8BH 1EX3A 3SV2H 1O2KA 1UHBA 2NWNA 3PYHA 1QRXA 2VJ1A 3UQVA 4ZH8A 8GCHF 4CR9A 1F5LA 4B1TA 1GHZA 3DJ1A 1FAKH 2LNCA 4U2WA 1GJCB 2PNTA 1YLDA 1O34A 3QWCH 4RI0A 1UTOA 1VZQH 5AHGH 1HRTH 2G51A 3FY5A 2H9TH 1MTNC 1LVYA 2ODYB 5FCKA 1DVAH 3TGJE 2WPIS 2ZU3A 3SUDA 2H3LA 4ABGA 2XBYA 1LCYA 4NFFA 4NIVA 1WHDA 2PZDA 1EB2A 1V5LA 2EDPA 3RU4D 1IQMA 4ABFA 4AGKA 1P2MA 5F8TA 3U1JB 1Q3PA 2OINA 5CMXH 3BTKE 4CH8B 3D49H 2ODPA 3GYMA 4JYTA 2HOBA 5HFDA 3SNAA 3BG8A 2ZPLA 3MYWA 1NRRH 3PROA 1BTYA 2WPKS 1O37A 3FVFB 3LU9B 4AG1A 3FP8E 1P57B 2BX3A 1CU1A 2FOAA 3UR6A 4YLQH 2GX4A 2LOBA 1XVOA 1Y5UT 1C5WB 1GJ9B 2H2ZA 2GD4B 2HGTH 5F8XA 1ZHMA 2ZCKP 4AX9H 3PDVA 1W7GH 2SNVA 1GI7B 4XBDA 1W12U 2D90A 1MBQA 4XE4A 3MNSA 5A8ZA 2UUKB 1Z1JA 2HPPH 1NFXA 3RLEA 1WI2A 1SGQE 2EDZA 1EAUA 4BAHB 2BQ7B 1LO6A 2QN5T 1V62A 1NU7B 4ZAEA 1WOFA 2IJOB 5C67A 2ZDVH 1K1NA 1O2RA 2ZPMA 6CHAB 1UTNA 2WL7A 3RXRA 3EQ0H 1O38A 2Y5HA 2GCTB 5EOKA 2BLWA 3BF6H 5CHAC 4REYA 4IMQA 3SU4A 3UWIA 3KEEA 2XWAA 5C2ZA 2BVRH 1C2KA 4GCHF 1HAXB 1GHVH 1VCWA 1O31A 1UK4A 3LNXA 3ZZ7A 1C2MA 2F0AA 1RGWA 3DD2H 3GCNA 1ZUBA 4XFQA 1P01A 1FAXA 1SGPE 1FPHH 1IOEA 2AEIH 3F9HA 1RIWC 4JK6A 4ABEA 1C5LH 2CSJA 5HF4A 4ISLA 3S9BA 2QAAA 1GJDB 2A0QB 4NXQA 4K75A 4X8UH 2BQ6B 1VITF 3KNXA 1UK3A 3SU5A 2XW9A 1VGCB 5E22A 3TNSA 2JETB 1Z8RA 2WV5A 2Z3CA 3LT3A 4FUCA 1AU8A 1C1PA 4AFUA 2EEIA 1LDTT 1O35A 5J4SA 3S7KB 5G1EA 4X1SU 3SNDA 2I1NA 3S9AA 1NC6A 3UOUA 4BTTB 1NM6A 1MBMA 1PQAA 5I7ZA 3PV4A 3NFLA 4WYUA 4MNXA 1GMCG 4NWKA 1XUJA 3FFGA 5I46H 1TE0A 1DPOA 1UTQA 3KQEA 3E3TA 2X7ZA 2A7CA 2Z9JA 3A7VA 3E91A 5L2ZH 3A8CA 1L1NA 3K65B 4Z8JA 2JH6D 1OZIA 2BDCA 1QQ4A 2CN0H 4BOHA 4DY7B 1EZSC 4AB9A 1W0ZU 2THFB 1QGFA 4EDJA 1HPGA 3LC3A 5GIBA 4D7FA 2VWOA 5G1DA 3Q76A 2UZCA 5HEYA 2V6NA 1C1RA 1SPJA 2J34A 1NRSH 2ZZUH 3ITIA 2FWWA 4Y0ZE 3GY6A 3DIWA 1G3BA 1Y5BT 1LPGB 2EEGA 1Y3VA 2HPQH 1SGFG 1WV7H 5C1XA 2JH5D 1OYQA 1SLWB 3NCLA 3RXMA 4AFSA 1BOQA 1BTWA 2FP7B 4UEHH 1X5QA 2VWMA 1RJXB 2XC0A 2UWOA 2M0ZA 1MKWK 1FIZA 1TNHA 1K21H 7GCHG 2PSXA 2VWNA 3T5FH 1EP5A 2JWEA 1NFWA 1TMTH 1YPHC 4K1EA 5L2YH 1GBFA 1DE7H 1ZMNA 1G2LA 3SUFA 4FUBA 1N8OB 3RL7A 1V2VT 1V2QT 1HAVA 5HF1A 1ZHPA 2ZO3H 4CRDA 1BE9A 1FY4A 1PQ8A 1X5RA 4O9VA 1O3KA 2V35A 4AYYB 2P94A 2OUAA 4WMEA 1L0ZA 1Q3XA 1JOUB 4ZMAH 2OCVB 4XBBA 3WY8A 4CR5A 3TK5A 3M7TA 1ZRBA 3QTOH 5L30H 1TGBA 1UVOA 3GY3A 1TB6H 1TPAE 1A0LA 3URCA 4JZIA 3A82A 3I1EA 2EGNA 4MQAA 2C3SA 1TNJA 2XNIA 2ZPRA 2FCFA 2A45B 1X6DA 1RD3B 1EXFA 3BG4B 1ZJKA 2WYJA 2O8TA 3BTME 4IC6A 1A5HA 1O3LA 3DHKH 2VVUA 3MU1A 1IQIA 3RMLH 1QFKH 2SGFE 4CHAB 1O3OA 5EXLA 1EJMA 1QAVB 2G2LA 4UFFH 1W0YH 1MFLA 2NU1E 5AVDA 1A5IA 2ZF0H 2KV8A 4DCDA 5EU8A 3V13A 5FX5A 4GPGA 2I6SA 5DP5A 1TIOA 1JIMA 3ELAH 2A5IA 1YKTA 4IN2A 1O0DH 1C5SA 1OPHB 1HYLA 3AW1A 1O2QA 4ESTE 4DG4A 1HJ9A 1IQJA 1NT1A 1YPEH 1PQ7A 1PYTC 2C8YB 1BMNH 1NO9H 3D62A 3TVJB 1MD7A 1ARCA 2VVVA 7ESTE 1S0RA 1G36A 3GDVA 1Z87A 2AWXA 5E11A 5E21A 2FOGA 2V3OH 4X8TH 8LPRA 4K78A 1TGCA 2GMTC 2I4SA 2FODA 1LVOA 2EI7A 3LGTA 1E36B 3ID3A 2PGBB 1S0QA 1GBLA 1KLTA 5ESTE 3F68H 4JOFA 1EP6A 1Z8IB 4IMZA 1A3BH 2UUJB 2VGCB 3VEQB 1QURH 3CYYA 4P2AB 3LJOA 4G69A 2XYAA 1T4VH 3WKLA 2ZQ1A 1GJAB 1MZAA 2PSYA 3FP7E 3SJ8A 4A7IB 5ETXA 2O8WA 2EGOA 1CO7E 2ODQA 1K1IA 5EZ0A 1ZRKA 4ABBA 3CBYA 1FN8A 1UCYE 3V7TA 3UR9A 2H3MA 3URDA 1NROH 4WJG2 1AKSA 3TH3H 3LGWA 5FB8C 1GVLA 3HATH 1Y3WA 5GWZA 1UJVA 2KRGA 1HFDA 1ZGVA 3PV2A 1UEPA 5A0AE 1PPCE 1JWTA 2OTVA 2IPHA 2FN5A 1TBQH 4MVNA 3H5CB 3PM3A 4GVDA 3PWCA 2EEKA 2DAZA 3VB3A 2TGTA 1CT4E 1UCYK 2BYAX 1ZYOA 2GZ8A 5DP9A 2VSVA 5HFCA 1ZSJA 2FI4E 2O8MA 3QLPH 1GI1A 1V2ST 4WY3A 1UMAH 3A8DA 1BTZA 2FEQH 3GDSA 6LPRA 5HXFA 1G3CA 4NMSA 1MU6B 1BRBE 1W13U 3O5NA 2BD5A 3RL8A 3E0PB 4ABDA 1K32A 1NU9A 4LOYH 4WXIA 3P92A 1W11U 1OBXA 3HPMA 1S82A 1TABE 3U9AH 2YOLA 2AWWA 4H4FA 1GBCA 2TGPZ 4FUDA 1AUJA 2ZKSA 2BDIA 5HFBA 1GJ5H 2OC0A 3A83A 1DICA 5T6DA 3BTHE 3VGCB 1SMFE 1YM0A 4X2XA 2ULLA 1C1VH 4AGJA 3SQEE 1H9HE 3PWBA 5HGGA 1GMHG 2SGEE 1CA0C 3UNSA 2JH0D 4NSYA 1DUAA 4KTCA 1FZZA 1TX7A 3F6UH 4AG2A 1N99A 3SNBA 1SC8U 3L3TA 3SU1A 2BZ6H 4YLUA 3ZZ6A 3TH2H 4ABIA 3H7OA 2GTBA 2J4IA 3TU7H 3MFJA 1K2I1 1AGJA 2A7HA 4OS5A 2YUBA 1YPJH 1TRYA 3SZNA 1UJDA 5JBAS 4QT8C 4BAMB 2Y5GA 4YO9A 3JXTA 2Q6GA 3S0NA 1BRAA 1DX5M 2Z17A 1P04A 1C4Y2 1N7EA 2VH6A 4ZKOU 3RMOH 2P8OC 3M37A 3A81A 1TPOA 2W5EA 1IHJA 3MOCA 3P8FA 5G4BA 4K8YA 4I7YH 1IU0A 2VSPA 4Y8YA 2ZTYA 1KXDA 2ZDKA 4J1YA 1O36A 2G8TA 1X8SA 1OP0A 1C9PA 1S85A 1MTNB 1ELCA 1C5QA 1HAPH 1EPTA 1ZR0A 4MPVA 3NUMA 3PMHB 5I25A 3U98H 1BT7A 3BSQA 3UUZA 3LPRA 3GY2A 1PJPA 1F0SA 3QN7A 1DXWA 7KMEH 4GHTA 4JK5A 1C5UA 3CS7A 4MTBA 2FLBH 3ATKA 1EZQA 4INHA 6GCHG 2V3HH 1HAGE 3O8BA 1V3XA 3GCTG 2B5TB 1GBEA 4O3TA 1SI5H 2ZWLH 3SFJA 1TQ0B 2O9QA 3P6ZB 1SR5C 1A2CH 1WF7A 5F6MA 2AINA 1QHRB 3BEIB 2CV3A 3BN9A 1ZJDA 1KYNA 1DDJA 2WPLS 1QA0A 2BZAA 1D3DB 4GVCA 1LVMA 1ZSKA 3SW2B 2TIOA 5DK1A 1V5QA 2ZDLA 1P8VC 4DIHH 4LZ1H 4U30A 3OTPA 1ZTKA 2SFAA 3ZVGA 4X8SH 2GT7A 1MD8A 2BD4A 1O2WA 2A31A 4X0WU 4B2AA 4A1TA 1EJNA 3BTGE 3GY5A 2ZFQH 1SGYE 2XWBI 3ZVFA 1FCFA 1IQEA 1G3DA 5CHAB 4BNRA 2ZGBH 3DFJA 2DKRA 2AWUA 1JIRA 3GGEA 3R3GB 2R4HA 2A5KA 1BTHH 2F9OA 2RCEA 3A80A 3TH4H 3T62A 1C5RA 1SGTA 2BY5X 1DANH 1PPFE 1FI8A 3ATMA 3ATIA 3EGHC 2ZHEH 2FS8A 4O3UA 1RIWB 2KL1A 4OS7A 1B7XB 1HJ8A 2K1QA 1BRCE 4F8KA 1C9TA 2W3IA 5E1YA 3GISB 3QJNA 3EYDA 3RXPA 1G2MA 3GICB 8KME2 1NN6A 2WV4A 3MU4A 1Y7NA 1KTTB 2FIRH 3P70B 1L1JA 2FYRA 5FBEA 3MNXA 4JZFH 1OKXA 1H4WA 1KLJH 2WPMS 3A7TA 4OS4A 5H4IB 2BDBA 2VVCA 3U8RH 1XUIA 4YOIA 1B0EA 1KIGH 5JB9S 1UTJA 1PPGE 2JXOA 4BANB 1P3CA 2H9HA 4Y0YE 2LA8A 2EHRA 2ZPQA 1HB0B 1SGCA 1P06A 2AERH 3M5MA 2ZDAH 3NXPA 5C1UA 3E0NB 4GHQA 4Q7XA 1QL7A 3EA8A 2H5DA 2GDDA 2PKAB 3SU2A 1ZPBA 1GGDB 8GCHG 1V2TT 3RC6A 1O3JA 3NGHA 1S6HA 2FZZA 1VAEA 4ZHLU 2SNWA 3UQOA 1DT2A 3BTQE 1DLEA 5T6GA 3CP7A 4F49A 1T8MA 1P2KA 1GDUA 1NS3A 2BLVA 3RXBA 1O2OA 4OS2A 1GL1A 1YLCA 2VIPA 1XM1A 3T26A 1AB9C 3I4WA 1IQGA 3HKJB 1IHSH 1O2JA 3RXIA 1ZMLA 2R0LA 5A0CA 1FPCH 3MNBA 1GJ4H 1QNJA 1FY5A 3SUEA 1O2PA 4A1XA 4GHNA 3KHFA 1GCTC 5AFZH 2CGAA 4OEOA 1E37B 1DY9A 2OLGA 1CE5A 1TX8A 2I04A 2PUXB 1RXPA 3K9XB 2CHAC 2BD9A 2FNEA 1MH0A 2J38A 1HAOH 1TP3A 2LUIA 3VXEH 3KCGH 2QXGA 1NESE 3SBKA 3UY9A 2HALA 1AVXA 5TCAA 1UEQA 1UFXA 1FN6A 4KFVA 1SGDE 1P12E 1TGTA 2GGVB 4LMMA 1DSUA 1GHAG 3MH7A 4NMRA 4OEPA 4I33A 4F4OC 3BTFE 1GBKA 3F9FA 4Q3HA 2A5AA 3KL6A 2OSGA 2FOHA 3ID1A 4KFWA 2ZHWH 2DM8A 4JYVH 4YYXA 3RLYH 1BMMH 1QR3E 1SVPA 2A2QH 1TGSZ 2BOHB 3B23B 1NTEA 3AXAA 2D1JA 3BTDE 1HNEE 5JPMH 1P2IA 1VJ6A 1GHXH 3GY8A 4I32A 5LPEA 1P02A 1ELBA 5A2MH 5C3NA 3ID4A 1HJAC 4E05H 4GCHG 1GI0A 4BAQB 1UCYH 1THSH 2KAIB 4DJZB 2IWPA 3RXHA 2J9NA 1E38B 4NMQA 3SUGA 1TRMA 1J15A 3T2NA 4KTUA 1RTFB 2L4TA 1XMNB 2P3WA 3IITA 4P0CA 1O3DA 1OYTH 2RA3A 1WTGH 1QRWA 1LHFH 4X8VH 2DC2A 2G4TA 5TJXA 1VITG 1GPZA 1T2MA 2BYGA 1UM7A 2I0IA 1C2GA 1HAZB 2Y5FA 1NZQH 1UTPA 1GHBF 1MKXK 2BMGB 2PFEA 4K1SA 1UF1A 4RKJB 2EC9H 2RCZA 3STIA 4NWLA 3PS4A 2GV7A 4HI3A 3HVQC 5C1YA 3A7XA 1BMLA 1C4V2 1HDTH 3M35A 1GDQA 2XRCA 1D3TB 3RXEA 1GI2A 5EODA 3C1KA 1OWHA 2OS6A 3JZ2B 3QGJA 2GMTB 4Q7YA 2ZGJA 3ESTA 1PPHE 4LXBH 3RXDA 1OBZA 1EAIA 1GWAA 3QO6A 1FC7A 1Z8JB 1LPZB 2DLSA 1J9CH 1ID5H 2KPKA 4CREA 3DFLA 3QX5H 2PV9B 1U37A 2PTNA 4YOGA 2A32A 4NGAH 3W95A 1O3BA 2PHBA 4Y71A 1ACBE 1TYNA 1WJLA 2EV8A 1BJVA 1L2EA 3SO3A 5EW1H 3BTEE 4M7GA 2EA3A 1KDQA 2PKSC 1O3NA 4TY6A 5DP3A 4TY7A 1DLKB 1FC9A 1GI9B 2Q3GA 5FBIA 3ZVEA 2PTCE 2ZGXH 1MMJN 1BHXF 1ORFA 1N6XA 1J8AA 1Q31A 2ANKH 2TRMA 2AYWA 1K1PA 3LC5A 3M3TA 1NTPA 1GBHA 1UHBB 4JMYA 4AMHA 1NFYA 3U8TH 1AY6H 3ATWA 3RXQA 2WUCA 3ID2A 1UTLM 1LHDH 1O2HA 4AFQA 1HAYB 2QF0A 3PLPA 2QY0B 3V0XA 3SV8A 1QAVA 2Z7FE 5PTPA 5DTHA 2VZ5A 4WH6A 3RP2A 1L1GA 4K2YA 1EPTC 3A7WA 2P93A 4UD9H 4ASHA 3ZV8A 1L4DA 1CHOG 1MAYA 2VB0A 4NA7A 1QB6A 4MNYA 2WINI 4K1TA 4I8LA 5EW2H 1TMUH 1AO5A 2GCHF 1CBWB 2R0KA 4XDEA 3G01A 1Z7KA 5A8YA 2J95A 1S81A 3LGUA 3PTNA 1L6OA 2QKTA 4Q6SA 1B0FA 4KP0A 5JBTA 4AYVB 3SOSA 1O30A 1IQKA 1TNGA 5H3JA 2ZU2A 1W9OA 4HTCH 2FYQA 1UK2A 3O8RA 3PV5A 4J2YB 1NRPH 1W14U 3EGKH 3K6ZA 4GVUA 1AE5A 1PQ5A 1V2OT 1V2KT 5LPRA 1D3PB 1SHHB 2BB4A 1CHGA 2IOTA 1GBAA 3A87A 2OQ5A 5K0HA 2F9UA 3R68A 3BEFB 1NFUA 2FPZA 1GI3A 1H8DH 3QE1A 1C2EA 5GLJA 2IN2A 4JYUH 3EA7A 2G5MB 1CA0B 1AZZA 5HM2A 1G9OA 4FU7A 1ZSLA 1EJAA 2Y7ZA 5K7RA 2AMDA 3PB1E 2VIDA 5GCHF 2BY6X 3E8LA 1GMCF 1P1EA 2YUYA 3WKMA 2ZHDA 1EB1H 2K20A 5EXNA 3M61U 4E7NA 2QV1A 2FS9A 1O2ZA 4TYDA 4Y7AA 1O5CB 4ZHMU 1TONA 4MG3A 1H8IH 2C90B 1GG6C 1D5GA 3EA9A 1W7XH 1K1MA 3CENA 1FY3A 1E0FD 2NU3E 4WXVA 2W3KA 2P8OB 1N6YA 1KSNA 2GV6A 1CGJE 3QK1A 1GMDF 2V0BA 3B9FH 1Z1IA 3SGQE 3TLOA 3QDZB 1C2LA 2OP9A 1OWDA 1XXDA 3FP6E 4I8JA 1P1DA 2FDAA 2ZU5A 3IWMA 2QXHA 4NIXA 2KBSA 1SGIB 5FPYA 2O2TA 3RXGA 4O03A 2C4FH 5J4QA 3TGIE 1S5SA 1TMBH 2EGKA 3K2UA 4WF8A 4O06A 3RXSA 1UVUH 1T8OA 1O3AA 1TBRH 2G5NA 4NG9H 3TSWA 1RZXA 1OOKB 1GHWH 3SHAH 1D4PB 5HDYA 2SGAA 2BTCE 2GKVE 2PR3A 2Z9LA 3LOXA 1Y8TA 2FX4A 3ZYDA 3LKWA 1GHYH 2Y80A 3AAUA 3CBXA 2ZU1A 3TJUA 4H42U 1P09A 3L4FD 4SGBE 1DOJA 5CE1A 1U39A 5AFYH 3P17H 1TQ7B 4TWYA 2JOAA 1SQOA 5A0BA 2NU2E 2ZDMA 3SHCH 5LH8A 1XXFA 4D9RA 5HYOA 1F5KU 4XBCA 4PQWA 1XKBC 4OAJA 4RKOB 1ELEE 2G4UA 2M5TA 4YT7H 2Z9GA 4GAWA 4X6NA 5FAHA 2FLRH 2FXRA 5EPNA 1OWIA 4X1RU 2GCTC 3KZDA 4B76A 1O5EH 1XZ9A 1H9IE 4D7GA 3KQDA 4B71A 1HIAB 3GCHB 3MU8A 1YC0A 5HEDA 1YF4A 3HGNA 3MMGA 1OS8A 5DKMA 1TRNA 5EQSA 4JOHA 1MTWA 1SFIA 5A8XA 1VR1H 3ZVBA 3A86A 1DM4B 2KJPA 1QRZA 2VIQA 4R2ZA 4X2YA 1FQ3A 2EEHA 2F83A 1WFVA 1O2VA 3KQCA 2BDYA 3MTYA 3SV7A 1C1WH 1VGCC 1EUFA 2KOJA 4JOGA 3TJNA 1ZZZA 2BD8A 1C2DA 1TQ3A 1C5XB 3HPTB 4TWWA 3RDZA 3ZV9A 4INLA 2VIOA 4Q6HA 3MWIU 1QY6A 1ANDA 1PPZA 1Z6JH 4MPAA 1WYKA 9LPRA 3AASA 2G81E 4KKDA 3CS0A 3RXFA 2WPHS 2M3MA 1AUTC 2A2XH 3ZZ8A 3Q77A 1AVGH 2M0UA 1C1TA 1V2PT 2HRVA 5IDKA 1E34B 1TNKA 4E3BA 1RRKA 1GI8B 4XSKU 1DSTA 5E2OA 5A2PA 1ELAA 5HETA 1F0RA 1DXPA 3HK3B 2OQSA 2XBWA 2ZHFH 1MQ5A 1U38A 1MKXH 2BY8X 3RU4T 2AGGX 2HNTE 3EE0B 1GBMA 2REYA 1BMAA 1O3HA 2ZFPH 1GDNA 2ZI2H 3RMNH 4YOJA 5ABWA 1P0SH 3ZZ3A 2KA9A 2ENOA 1FC6A 1IQHA 1RTKA 4AORA 3QGLA 1SGFA 4GUXA 1BJUA 2HLCA 3MH5A 2AMPA 4B73A 2OXSA 3VQFA 1ZGIA 1RGRA 2CF9H 1SBWA 1BHXB 1K28D 1G37A 4MLFB 1OBYA 2MX6A 1FY8E 1R6JA 3ZZCA 5E8EH 1GCDA 1GBIA 2PKUA 1AFQB 3PMJA 1O3CA 1O2MA 3SGBE 3T27A 4SGAE 2VIWA 2FOEA 2C8ZB 1V2NT 2W7UA 3UNRA 1TBZH 4JORA 4ZXXH 2ZDNA 2CHAB 2Q6DA 3L33A 1ZOMA 4WVPE 1UJUA 2HNTC 2L4SA 1UEWA 1BQYA 1N8OC 1BTXA 4B2CA 4Y7BA 1ESBA 2VU8E 3CH8A 5LPFA 1SHYA 2F91A 2A4QA 1DS2E 1LPKB 3E1XB 2F3CE 1QLCA 3R0HA 4THNH 2TGDA 4UFGH 4OGYA 5BPEA 2AMQA 1QBNA 1VA8A 4JOKA 1HUTH 4ZXYH 3SI3H 1SLVB 1UJ1A 3LGVA 2UUFB 2IWQA 3I29A 2EI8A 1V2UT 3PLKA 2D92A 3QIKA 1FXYA 2ZFRH 1A7SA 3BG4C 2LC6A 2J2UA 2H1UA 3CBZA 2B8OH 3HGPA 1YPLH 1O2GH 4Y76A 2FX6A 1C1SA 3VB5A 1C1UH 2MHOA 3TJVA 4E35A 3LGYA 3GJ9A 3RXCA 4CBNA 3SQHE 5EGMA 2EDVA 5HMAA 2AIPA 2C8XB 1M5ZA 2LC7A 4Q2NA 5EQRA 3OY6U 1O2UA 1HAIH 1GBTA 1OXGA 1FLEE 4A5TS 1AQ7A 1PDRA 4LK4A 3VB6A 1OSSA 3P8GA 4ZROA 2BD2A 3K1RA 4FUGA 1A5GH 4ISOA 4UE7H 1OX1A 1YBWA 1S84A 1EOLA 2A4OA 4Q2KA 1NPMA 1G3EA 3SU6A 1DFPA 2SGPE 1BUIA 2PKTA 1RY4A 1OWJA 2BXUH 3OYPA 1MCTA 1QJ7B 3A85A 4JZDH 2ZGHA 1A0HB 2BHGA 1ELFA 3DJAA 3T25A 3O8CA 1Q3OA 4FXGH 3AW0A 1AFEH 4MDSA 2VGCC 1Q2WA 5DPAA 1O3FA 3TK6A 3RXVA 3H7TA 1ZTLA 2QGRA 1LTOA 5F67A 1C1MA 1P11E 2AGEX 3KN2A 3NWUA 3LGIA 3VB7A 2KYLA 4Q2PA 3NK8A 4B75A 1XUHA 2OC1A 2QXJA 1A4WH 3ZYEA 1GQ4A 2EAQA 1CT0E 3M7QA 4U32A 3RXJA 4ZHAA 1O2YA 1O3GA 1GM1A 2V90A 4Q2OA 3STJA 2OC7A 3A7ZA 5HFEA 3ATLA 1KXEA 3TNTA 2PKSB 1ZOKA 1AVWA 3OU0A 2I6VA 2DB5A 1G32B 4LZ4B 3MO9A 1C5PA 2Y7XA 2OC8A 4FVBA 2VNTA 3A8BA 1BFEA 3TGKE 1SOZA 1FUJA 1ELTA 2BQWB 2KAIA 5LGOA 3SNCA 4X1NU 1UITA 4TPIZ 1SLXB 1O2IA 2BDGA 1LHGH 5F8ZA 3CC0A 2ZHQH 3F9EA 2OQUA 4HGCA 2ZTXA 4A1VA 2ZGCA 2EEJA 3HKIB 4I8HA 4I8GA 4NA8A 1IU2A 3DJ3A 2Q1JA 1O2LA 1FJSA 1C5OH 2P3UB 4D8NA 2BXTH 1HV7A 4UFEH 2HNTF 3ZRTA 4K76A 1C2IA 1DWDH 1EATA 2W7SA 2PUQH 1ZPCA 1WIFA 1KXCA 1MUEB 4HOPB 4CRBA 1LQEA 1TOCB 5GPIB 3S69A 5AF9H 4KELA 3SHWA 1AIXH 1KLIH 2WPJS 1BITA 3R0FA 3KF2A 1C5TA 1D6WA 1KXBA 1O3PB 1TP5A 1YPMH 1CT2E 2XTTB 3BIVH 2DUCA 3K6YA 4BAKB 3Q3KA 3RXUA 4JOPA 1TALA 1V2RT 4FUHA 3PMAB 2WUBA 1QBOA 4KGAA 3SGAE 2QA9E 3SJIA 1W9QA 1U6QA 1P10A 3M5LA 5DP4A 2A7JA 1BA8B 2W4FA 3V12A 1TOMH 1WTHD 3TMHA 1WFGA 3E16B 9ESTA 2ALVA 3LDXH 3RMMH 2AS9A 4NCYA 1UM1A 1BZXE 3D65E 1TA2A 1BTPA 4IC5A 2FI5E 3I78A 1GHBG 1T8NA 2W26A 1Z71A 2Z3DA 3ENSB 3QZQA 4ABJA 2Y82A 4FU8A 1UEZA 1TFXA 5HEBA 3RC4A 1ANEA 3U8OH 5EQQA 1BBRE 3UOPA 1T31A 5JYIA 3A8AA 1WCZA 5E6PB 1GG6B 1PPBH 2G00A 2H9EH 2R2MB 2YNBA 2EJYA 1ETTH 1LVBA 1XKAC 1FY1A 1AWFH 2EXGA 2XCNA 4WH8A 1RTLA 5E0GA 4NA9H 1ELVA 4ISNA 3TJOA 4NMVA 3A7YA 1K1OA 1LQDB 5JB8S 3OSYA 4XOJA 4HFPB 5JBBS 2GT8A 3W94A 1BBRK 2I0LA 2Q9VA 1ANCA 2BD3A 4IGDA 5C5OA 1SL3A 2JILA 3VQGA 4Y10E 5ESBA 2ASUB 1GI4A 4IS5A 4FVDA 1DUEA 4VGCC 4I31A 1O33A 1EZXC 5FXLA 1YCPM 1MFGA 2DMZA 1MTSA 1GI5A 3PO1C 2PA1A 5HM9A 1ABIH 2IWNA 4NZQA 3ODDA 2C93B 4CRGA 2OBQA 1GJ8B 4NMTA 4DGJA 2Y81A 2P3TB 4MNWA 1D6RA 2NU4E 1YGCH 1GHAF 4UONA 2SGQE 2JIKA 2HE4A 3R69A 1WU1A 1C5ZB 4WWYA 3MHWU 2YTWA 4R8TB 1B8QA 1I92A 1G9IE 1SGRE 2M0VA 2HGAA 1WUNH 2XBVA 1ELDE 1K1JA 3KHVA 5DO4H 2Z94A 2ZNKH 2KG2A 1GVKB 2QXIA 1WAYB 1V2MT 3SJOA 4DVAU 1KY9A 1H9LB 4NSVA 3M5OA 5EPYA 3M36A 5JXBA 4MPWA 1VJ9U 1QL8A 5FHTA 2O8LA 4CRFA 3QUMP 2A4RA 3FAOA 2GCHG 1FNIA 3EGGC 2VRFA 1AI8H 1QAUA 3ZZAA 1YPGH 5L6NH 2QCYA 3RUOA 2BLOA 1A0JA 2R3YA 5IYTA 1VCQA 1GBJA 3D23A 2BVXH 4MPXA 5GXPA 1NRNH 1WG6A 2P3FH 2D2DA 1O2NA 2G5VA 1RS0A 1O2TA 3K82A 3SU3A 3MU0A 2OMJA 1SLUB 2VWRA 1YPKH 3P8NA 3ZZBA 4YTAA 1F92A 3T28A 2K1ZA 1RGQA 4RN6A 1ESAA 1GJBB 2CJIA 2ZIQH 2E7KA 5HJ1A 1Z6EA 2BX4A 3MO6A 4NFEA 1QJ1B 2H5CA 2VPHA 4GLYA 1N6FA 1JRSA 4Q2QA 2J94A 3U69H 2BOKA 1WH1A 1HBTH 3A84A 1TPPA 2GZVA 2STAE 5GCHG 4A6LA 1SOTA 4YM9A 1O5GH 2B7DH 2FI3E 2QYIA 3UTUH 1QB9A 4X2WA 2ZEBA 4UU5A 2Z3EA 2BY9X 3HK6B 2CSSA 1UHPA 1V6DA 1ETRH 1GGDC 3LH3A 1YPHE 1MQ6A 1Y3XA 1F5RA 3O8DA 1C4U2 1ZLRA 3PTBA 4RSPA 4DT7B 1P05A 2UWPA 1AE8H 3MO3A 1F2SE 1QCPA 1D9IA 2CF8H 2D8WA 1HLTH 1WI4A 1SQAA 1GMDG 3TK9A 1LMWB 1TPSA 3GDUA 1S6FA 4X2VA 1LKAA 3BTWE 2C8WB 1OP2A 1V2JT 4BAOB 2CMYA 4CH2B 4Q7ZA 1J14A 4NIWA 2FOMB 3IG6B 1BTUA 3ZZDA 4K72A 1SGNE 2ZCLP 2OZFA 1O5BB 3ZVAA 2H2BA 4AOQA 2EI6A 5E0HA 1HIAA 3QGNB 3RLWH 3S7HB 2YNAA 2XC5A 3Q3YA 2ESTE 1C5MD 3BPUA 1HGTH 3M3VA 2TBSA 4NMOA 1IQFA 1OWEA 1SSXA 1Z8GA 4CBOA 1CGIE 3P95A 2ZFSA 1V2WT 1NRQH 3PMBB 4NIYA 3RXOA 4ISIH 2ZCHP 2F5YA 1N6DA 2YT7A 2JINA 1A46H 3U1IB 4DURA 2YT8A 1TNIA 2HVXA 2KJDA 4Y8ZA 1E35B 1P9UA 3KIDU 1GVZA 1P9SA 1FDPA 4OGXA 1CHOF 1UVSH 1QTFA 3OY5U 3I77A 1O2XA 1O39A 1GQ5A 1V6BA 1K22H 2LPRA 2BVSH 1KDQB 2ZTZA 2ZU4A 1SB1H 2VINA 2TGAA 5C20A 4U01A 2O8UA 4D76A 1ETSH 1K9OE 1ZPZA 2HWLB 2WYGA 1VB7A 1MCVA 1KXAA 2GVFA 1W3CA 1L4ZA 4A92A 2M10A 1VITH 3Q3XA 5DJ7A 1ESTA 7GCHF 1KTSB 4Y6DA 3MH6A 5E0JA 4UU6A 1O3MA 1P03A 4OS6A 2B0FA 5DP8A 1T4UH 2FOFA 3M5NA 2PLXA 3RXKA 3M3SA 3SI4H 1TNLA 3N7OA 1AD8H 1O32A 1MAXA 2DJTA 2ZC9H 4E7RG 1AMHA 2AGIX 4NNLA 1INCA 4AN7A 2KPLA 1LKBA 4K8BA 4FUJA 6CHAC 1P2OA 1DY8A 2I6QA 3QTVH 1F0TA 1T8LA 2FTLE 4JOEA 4WMDA 3SV9A 1F0UA 2D8IA 1X7AC 1DWCH 2G52A 1SGEE 1EKBB 4GSOA 1TWXB 4YESB 4NXRA 1YCPK 1UTKA 2CXVA 1YP9A 1QB1A 2L97A 1K1LA 4D9QA 4FUEA 1THRH 2QBWA 1V2LT 2RG3A 1WHAA 4B2BA 1EQ9A 1UVTH 2ILNA 2BDAA 3RXTA 1IQLA 4ABHA 4ZKSU 4X1PU 3RM0H 3E90B 3MI4A 1SG8B 3UWJH 3B76A 2RA0A 2JETC 4AFZA 1HAVB 2GP9B 1QA7A 3FZZA 2QF3A 1GI6A 1ANBA 4BTUB 1DWEH 1BCUH 5T6FA 1M9UA 4X1QU 2G55A 2FTMA 1TX6A 1JBUH 1TLDA 3I18A 2PDZA 2KOHA 4O97A 3VXFH 3VPKA 3GY7A 4IN1A 5GNDA 4OS1A 3NPSA 4UFDH 1VCPA 4X6PA 1UTMA 4NMPA 4CRAA 2FE5A 1S83A 4K60A 2ZFFH 1RFNA 1WQSA 1BBRH 1AZ8A 1D3QB 4JZ1A 3KZEA 3GSLA 2PGQB 1OP8A 1F7ZA 2D26C 2W7RA 5SGAE 3V3MA 1GL0E 1Y3UA 4JCNA 3TIUA 2HE2A 2UWLA 1WQVH 1JXPA 3LIWA 3SV6A 3S9CA 4PROA 1O3EA 2R9PA 4AB8A 3NFKA 1Z86A 1JRTA 1A1RA 1MU8B 5F03A 1KWAA 1CBWC 2Z6BD 3RU4E 4K69A 2XXLA 1PPEE 1VJAU 2OGPA 1P2NA 1G30B 3AVZA 4JOJA 1AB9B 1Y59T 1NF3C 1OWKA 1Y5AT 4FGMA 1EASA 3ODFA 3AAVA 3UPEA 1C5YB 5TCCA 1SFQB 4I8KA 1Y3YA 1QIXB 1WF8A 5FCRA 1GCTB 1P3EA 2JREA 4L8NA 1QQUA 1XUFA 4WYTA 1QJ6B 4CRCA 1FMGA 1EOJA 1H1BA 1SQTA 2H6MA 2NU0E 4Y79A 3O46A 1T32A 3EDXB 4R0IA 3T29A 4TPYA 1PFXC 1HAHH 4H6SB 2P59A 4B74A 3E17A 4NXPA 5DG6A 3PDZA 1X45A 1THPB 3P8OA 4NZLA 4Y8XA 5EXMA 2QKUA 2ZQ2A 3RC5A 1A61H 2ZA5A 4IBLH 4Z33A 3A88A 1LHEH 5F3XA 3RXLA 3SN8A 1FV9A 3EAJA 7LPRA 2P95A 1Q7XA 2PW8H 1W9EA 1GJ6A 2KQFA 4K3JA 5T3HA 1ABJH 4AZ2B 3DUXH 1CA8B 1UO6A 3PLBA 2FMJA 2UUYA 1UVPA 4K5ZA 4MPUA 2DLUA 5FX6A 3QDOA 4DW2U 4XHVA 4IW4E 4INKA 2VWLA 4ZKRU 3F9GA 1AKSB 1N7TA 3VFEA 1HJAB 3LH1A 1AHTH 5GDSH 3DA9B 4CHAC 4X6MA 6ESTA 2PKAA 3E6PH 4ZKNU 2OCSA 3TSVA 2M0TA 3SOEA 4K6YA 3KQBA 1GMHF 3UNQA 2F9NA 4Y11E 1CGHA 2AIQA 3UIRA 4HOPA 4YDPA 2V1WA 3ZZ9A 4DOQA 3UREA 1C1NA 3A89A 3FZDA 3GYLB 1QBVH 3SUZA 1MTUA 1KEFA 2FOCA 1O2SA 2QC2A 1MC7A 2STBE 3LJJA 2F9PA 3GY4A 3L6PA 3JZ1B 4VGCB 4BTIB 2GZ9A 5GJ4B 5BRRE 2R3UA 5DGJA 1DITH 3DT0H 1IHTH 3PO1B 2F9BH 3SORA 1W10U 2B9LA 3SU0A 1FIWA 1N6EA 3B8JA 4NNMA 2RRMA 1J16A 1XX9A 1O5AB 3ZZ4A 2A1DB 1C1OA 2Z9KA 2XC4A 3Q00A 2CS5A 1AN1E 3LNYA 4N6XA 2IWOA 2J92A 2ZECA 5DP6A 1MKWH 3BIUH 3M7UA 5EG4A 3SJ9A 3OX7U 3LONA 1YYY1 4BXSA 2FO9A 3TITA 1IQNA 4KTSA 2BM2A 4Q80A 3BEUA 1BRUP 2DE9A 1P2JA 3GCHC 1ARBA 3ZVDA 2GZ7A 2ANMH 1GBDA 3KGPA 1TGNA 5FPSA 1TA6A 1BDAA 3MNCA 1FONA 3NZIA 2Z9IA 2ZFTA 1JMOH 1B5GH 1PYTD 1LHCH 2DE8A 4E06H 3TPIZ 4DIIH 2Q6FA 1XVMA 4ABAA 5A09A 3RM2H 1A3EH 1N7FA 2QT5A 2H2CA 2P16A 2AFQB 2XBXA 4YZUA 6GCHF 3MH4A 3GCTF 2TPIZ 1HXFH 3SHUA
chains in the Genus database with same CATH superfamily
2F9VA 2GDEH 3BTTE 4HZHA 3VB4A 1WDIA 3C27B 1C1QA 4H11A 2RDLA 1O3IA 4WMFA 3FANA 4UDWH 1C2HA 5B6OA 1EZUC 2SGDE 2FOBA 2VH0A 1T7CA 1CSOE 1X5NA 1DWBH 1O5FH 1HCGA 3SJKA 5E2PA 2BY7X 3OTJE 4FU9A 1BB0B 3SNEA 3MU5A 1TAWA 3ZIAD 2QG1A 1NY22 2JDID 3SYJA 2KJKA 3GCOA 1CQQA 4BXWA 5JDUB 3FO8D 4Z6AH 4ZUHA 1W2KH 4MNVA 1EPTB 4FUFA 1C5NH 2BDHA 2BLQA 2JKHA 1EAWA 1IAUA 2OBOA 3ZVCA 2PWXA 4H6TA 2VIVA 2AH4X 1KXFA 1V1TA 3BV9B 3ZZ5A 3TSZA 1FX0B 4YT6H 1WBGB 2ZPSA 2A4GA 1CVWH 4JZEH 1XUGA 3PRDA 1ZTJA 2XCFA 2ZG0H 3DORA 2QIQA 1GBBA 4FUIA 2JIZD 3VGCC 1MZDA 2KOMA 1N1LA 5DP7A 2BD7A 5EYZA 5C5NA 5HFFA 5B6LA 2JJ2D 4E34A 1BIOA 1YBOA 1C2JA 1EAXA 2OPGA 1ELGA 3NKKA 1YCPH 3F1SB 4Z0KA 1C2FA 4JL7A 2FM2A 2J5UA 3HPKA 1P2QA 3QZRA 3QJMA 2ANWA 3F2GA 4ISHH 1AFQC 1XUKA 1YLNA 4X6OA 8ESTE 2KAWA 1O5DH 2OD3B 3RXAA 1QL9A 2AHME 2Y6TA 1J17T 2ZP0H 1MTVA 1AWHB 2QKVA 1U3BA 3GOVB 5D13A 1GJ7B 1ZHRA 1HXEH 3H09A 1I16A 5FPTA 1ZMJA 1C5VA 3K50A 2ANYA 2R2WU 3UFAA 5JBCS 2FESH 1WSSH 2ALPA 1W8BH 1EX3A 2KCOA 3SV2H 1O2KA 1UHBA 2NWNA 3PYHA 1QRXA 2KM0A 2VJ1A 3UQVA 4ZH8A 8GCHF 4CR9A 1F5LA 4B1TA 1GHZA 3DJ1A 1FAKH 2LNCA 4U2WA 1GJCB 2PNTA 1YLDA 1O34A 3QWCH 4RI0A 1UTOA 1VZQH 5AHGH 1UW7A 1HRTH 2G51A 3FY5A 2H9TH 1MTNC 1LVYA 2ODYB 5FCKA 2J98B 1DVAH 3TGJE 2WPIS 2ZU3A 3SUDA 2H3LA 4ABGA 2XBYA 4ACAA 1LCYA 4NFFA 4NIVA 1WHDA 2PZDA 1EB2A 1V5LA 2EDPA 3RU4D 1IQMA 4ABFA 4AGKA 1P2MA 5F8TA 3U1JB 1Q3PA 2OINA 5CMXH 3BTKE 4CH8B 3D49H 2ODPA 3GYMA 4JYTA 2HOBA 5HFDA 3SNAA 3BG8A 2ZPLA 3MYWA 1NRRH 3PROA 1BTYA 2WPKS 1O37A 3FVFB 3LU9B 4AG1A 3FP8E 1P57B 2BX3A 1CU1A 2FOAA 3UR6A 4YLQH 2GX4A 2LOBA 1XVOA 1Y5UT 1C5WB 1GJ9B 2H2ZA 2GD4B 2HGTH 5F8XA 1ZHMA 2ZCKP 4AX9H 3PDVA 1W7GH 2SNVA 1GI7B 4XBDA 1W12U 2D90A 1MBQA 4XE4A 3MNSA 5A8ZA 2UUKB 1Z1JA 2HPPH 1NFXA 3RLEA 1WI2A 1SGQE 2EDZA 2JJ1D 1EAUA 4BAHB 2BQ7B 1LO6A 2QN5T 1V62A 1NU7B 4ZAEA 1WOFA 2IJOB 5C67A 2ZDVH 1K1NA 1O2RA 2ZPMA 6CHAB 1UTNA 2WL7A 3RXRA 3EQ0H 1O38A 2Y5HA 2GCTB 5EOKA 2BLWA 3BF6H 5CHAC 4REYA 4IMQA 3SU4A 3UWIA 3KEEA 2XWAA 5C2ZA 2BVRH 1C2KA 4GCHF 1HAXB 1GHVH 1VCWA 1O31A 1UK4A 3UAIC 3LNXA 4DT4A 3ZZ7A 1C2MA 2F0AA 1RGWA 3DD2H 3GCNA 1ZUBA 4XFQA 1P01A 1FAXA 1SGPE 1FPHH 1IOEA 2AEIH 3F9HA 1RIWC 4JK6A 4ABEA 1C5LH 2CSJA 5HF4A 2RDEA 4ISLA 3S9BA 2QAAA 1GJDB 2A0QB 4NXQA 4K75A 4X8UH 2BQ6B 1VITF 3KNXA 1UK3A 3SU5A 2XW9A 1VGCB 5E22A 3TNSA 2JETB 1Z8RA 2WV5A 2Z3CA 3LT3A 4FUCA 1AU8A 1C1PA 4AFUA 2EEIA 1LDTT 1O35A 5J4SA 3S7KB 5G1EA 4X1SU 3SNDA 2I1NA 3S9AA 1NC6A 3UOUA 4BTTB 2W6ID 1NM6A 1MBMA 1PQAA 5I7ZA 3PV4A 3NFLA 4WYUA 4MNXA 1GMCG 4NWKA 1NBME 1XUJA 3FFGA 4RT1A 5I46H 1TE0A 1DPOA 1S6LA 1UTQA 3KQEA 3E3TA 2X7ZA 2A7CA 2Z9JA 2EY4C 3A7VA 3E91A 5L2ZH 3A8CA 1L1NA 2WZQA 3K65B 4Z8JA 2JH6D 1OZIA 2BDCA 1QQ4A 2CN0H 4BOHA 4DY7B 1EZSC 4AB9A 1W0ZU 2THFB 1QGFA 4EDJA 1HPGA 3LC3A 5GIBA 4D7FA 2VWOA 5G1DA 3Q76A 2UZCA 5HEYA 4Q4LA 2V6NA 1C1RA 1SPJA 2J34A 1NRSH 2ZZUH 3ITIA 2FWWA 4Y0ZE 3GY6A 5C0UA 3DIWA 1G3BA 2WHXA 1Y5BT 1LPGB 2EEGA 1Y3VA 2HPQH 1SGFG 1WV7H 5C1XA 2JH5D 1OYQA 1SLWB 3NCLA 3RXMA 4AFSA 1BOQA 1BTWA 2FP7B 4UEHH 1X5QA 2VWMA 2V7QD 1RJXB 2XC0A 2UWOA 2M0ZA 3PRBA 1MKWK 1FIZA 1TNHA 1K21H 7GCHG 2PSXA 2VWNA 3T5FH 1EP5A 2JWEA 1NFWA 1TMTH 1YPHC 2EQNA 4K1EA 5L2YH 1GBFA 1DE7H 1ZMNA 1G2LA 3SUFA 4FUBA 1N8OB 3RL7A 1V2VT 1V2QT 4F55A 1HAVA 2KCPA 5HF1A 2F4LA 1ZHPA 2ZO3H 4CRDA 1BE9A 1FY4A 1PQ8A 1X5RA 4O9VA 1O3KA 2V35A 4AYYB 2P94A 2OUAA 4WMEA 1L0ZA 1Q3XA 1JOUB 4ZMAH 2OCVB 3GS9A 4XBBA 3WY8A 4CR5A 3TK5A 3M7TA 1ZRBA 3QTOH 5L30H 1TGBA 1UVOA 3GY3A 1TB6H 1TPAE 1A0LA 3URCA 4JZIA 3A82A 3I1EA 2EGNA 4MQAA 2C3SA 1TNJA 2XNIA 2ZPRA 2FCFA 2A45B 1X6DA 1RD3B 1EXFA 3BG4B 1ZJKA 2WYJA 2O8TA 3BTME 4IC6A 1A5HA 1O3LA 3DHKH 2VVUA 3MU1A 1IQIA 3RMLH 1QFKH 2SGFE 3W1EA 4CHAB 1O3OA 5EXLA 1EJMA 1QAVB 2G2LA 4UFFH 1W0YH 1MFLA 2NU1E 5AVDA 1A5IA 2ZF0H 2KV8A 4DCDA 5EU8A 3V13A 5FX5A 4GPGA 2I6SA 5DP5A 1TIOA 1JIMA 3ELAH 2A5IA 1YKTA 4IN2A 1O0DH 1C5SA 1OPHB 1HYLA 3AW1A 1O2QA 4ESTE 4DG4A 1HJ9A 1IQJA 1NT1A 1YPEH 1PQ7A 1PYTC 2C8YB 1BMNH 1NO9H 3D62A 3TVJB 1MD7A 1ARCA 2VVVA 7ESTE 1S0RA 1G36A 3GDVA 1Z87A 2AWXA 5E11A 5E21A 2FOGA 2V3OH 4X8TH 8LPRA 4K78A 1COWD 1TGCA 2GMTC 2I4SA 2FODA 1LVOA 2EI7A 3LGTA 1E36B 3ID3A 2PGBB 1S0QA 1GBLA 1X9ZA 1KLTA 5ESTE 2WSSD 3F68H 4JOFA 1EP6A 1Z8IB 4IMZA 1A3BH 2UUJB 2VGCB 3F0PA 1QURH 3CYYA 3VEQB 4P2AB 3LJOA 4TT3D 4G69A 2XYAA 1T4VH 3WKLA 2ZQ1A 1GJAB 1MZAA 2PSYA 3FP7E 3SJ8A 4A7IB 5ETXA 2O8WA 2EGOA 1CO7E 2ODQA 1K1IA 5EZ0A 3DSGA 1ZRKA 4ABBA 3CBYA 1FN8A 1UCYE 3V7TA 3UR9A 2H3MA 3URDA 1NROH 4WJG2 1AKSA 3TH3H 3LGWA 5FB8C 3KQ5A 1GVLA 3HATH 1Y3WA 5GWZA 1UJVA 2KRGA 1HFDA 1ZGVA 3PV2A 4RT0A 3OE7D 1UEPA 5A0AE 2QF4A 1PPCE 1JWTA 2OTVA 2IPHA 2FN5A 1TBQH 4MVNA 3F3BA 3H5CB 3PM3A 4GVDA 3PWCA 2EEKA 2DAZA 3VB3A 2TGTA 1CT4E 1UCYK 2BYAX 1ZYOA 2GZ8A 5DP9A 2VSVA 5HFCA 1ZSJA 2FI4E 2O8MA 3QLPH 1GI1A 1V2ST 4WY3A 1UMAH 4Z1MD 3A8DA 1BTZA 2FEQH 3GDSA 1MABB 6LPRA 5HXFA 1G3CA 4NMSA 1MU6B 3UB0A 1BRBE 1W13U 3O5NA 2BD5A 3RL8A 3E0PB 4ABDA 1K32A 1NU9A 4LOYH 4WXIA 5ILBA 3P92A 1W11U 1OBXA 3HPMA 1S82A 1TABE 3U9AH 2YOLA 2AWWA 3OEHD 4H4FA 1GBCA 2TGPZ 4FUDA 1AUJA 2ZKSA 2BDIA 5HFBA 1GJ5H 2OC0A 3A83A 1DICA 5T6DA 3BTHE 3VGCB 1SMFE 1YM0A 4X2XA 2ULLA 1C1VH 4AGJA 3SQEE 1H9HE 3PWBA 5HGGA 1GMHG 2SGEE 1CA0C 3UNSA 2JH0D 4NSYA 2L74A 1DUAA 4KTCA 1FZZA 1TX7A 3F6UH 4AG2A 1N99A 3SNBA 1SC8U 3L3TA 3SU1A 2BZ6H 4YLUA 3ZZ6A 3TH2H 4ABIA 3H7OA 2GTBA 2J4IA 3TU7H 3MFJA 1K2I1 1AGJA 2A7HA 4OS5A 2YUBA 1YPJH 1TRYA 3SZNA 1UJDA 5JBAS 4QT8C 4BAMB 2Y5GA 4YO9A 3JXTA 2Q6GA 3S0NA 1BRAA 1DX5M 2Z17A 1P04A 1NBMD 1C4Y2 1N7EA 2VH6A 4ZKOU 3RMOH 2P8OC 3M37A 3A81A 1TPOA 2W5EA 1IHJA 3MOCA 3P8FA 5G4BA 4K8YA 4I7YH 1IU0A 2VSPA 4Y8YA 2ZTYA 1KXDA 2ZDKA 4J1YA 1O36A 2LP6A 2G8TA 1X8SA 1OP0A 1C9PA 1S85A 2IJD1 1MTNB 1ELCA 1C5QA 4B6EA 1HAPH 1EPTA 1ZR0A 4MPVA 2GEFA 3NUMA 3PMHB 5I25A 4HG6A 3U98H 1BT7A 3BSQA 3UUZA 3LPRA 3GY2A 3U28C 1PJPA 1F0SA 3QN7A 1DXWA 7KMEH 4GHTA 4JK5A 1C5UA 3CS7A 4MTBA 2FLBH 3ATKA 1EZQA 4INHA 6GCHG 2V3HH 1HAGE 3O8BA 1V3XA 3GCTG 2B5TB 1GBEA 4O3TA 1SI5H 2ZWLH 3SFJA 1TQ0B 2O9QA 3P6ZB 1SR5C 1A2CH 1WF7A 5F6MA 2AINA 1QHRB 3AK5A 3BEIB 2CV3A 3BN9A 1ZJDA 1KYNA 1DDJA 2WPLS 1QA0A 2BZAA 1D3DB 4GVCA 1LVMA 1ZSKA 3SW2B 2TIOA 5DK1A 1V5QA 2ZDLA 5C94A 1P8VC 4DIHH 4LZ1H 4U30A 3OTPA 1ZTKA 2SFAA 3ZVGA 4X8SH 2GT7A 1MD8A 2BD4A 1O2WA 2A31A 4X0WU 4B2AA 4A1TA 1EJNA 3BTGE 3GY5A 2ZFQH 1SGYE 2XWBI 3ZVFA 1FCFA 1IQEA 1G3DA 5CHAB 4BNRA 2ZGBH 3DFJA 2DKRA 2AWUA 1JIRA 3GGEA 3R3GB 2R4HA 2A5KA 1BTHH 2F9OA 2RCEA 3A80A 3TH4H 3T62A 1C5RA 1SGTA 2BY5X 1DANH 1PPFE 1FI8A 3ATMA 3ATIA 3EGHC 2ZHEH 2FS8A 4O3UA 1RIWB 2KL1A 4OS7A 1B7XB 1HJ8A 2K1QA 1BRCE 4F8KA 1C9TA 2W3IA 5E1YA 3F2FA 3GISB 3QJNA 3EYDA 3RXPA 1G2MA 3GICB 8KME2 1NN6A 2WV4A 3MU4A 1Y7NA 1KTTB 2FIRH 3P70B 1L1JA 2J98A 2FYRA 5FBEA 3MNXA 4JZFH 1OKXA 1H4WA 1KLJH 2WPMS 3A7TA 4OS4A 5H4IB 2BDBA 2VVCA 3U8RH 1XUIA 4YOIA 1B0EA 1KIGH 5JB9S 1UTJA 1PPGE 2JXOA 4BANB 1P3CA 2H9HA 4Y0YE 2LA8A 2EHRA 2ZPQA 1HB0B 1SGCA 1P06A 2AERH 3M5MA 2ZDAH 3NXPA 5C1UA 3NRLA 3E0NB 4GHQA 4Q7XA 1QL7A 3EA8A 2H5DA 2GDDA 2PKAB 3SU2A 1ZPBA 1GGDB 8GCHG 1V2TT 3RC6A 1O3JA 3NGHA 1S6HA 2FZZA 1VAEA 4ZHLU 2SNWA 3UQOA 1DT2A 3BTQE 1DLEA 5T6GA 3CP7A 4F49A 1E1QD 1T8MA 4FOUC 1P2KA 1GDUA 3WWBA 1NS3A 2BLVA 3RXBA 1O2OA 4OS2A 1GL1A 1YLCA 2VIPA 1XM1A 2J97A 3T26A 1AB9C 1WXRA 3I4WA 1IQGA 3HKJB 1IHSH 1O2JA 3RXIA 1ZMLA 2R0LA 5A0CA 1FPCH 3MNBA 1GJ4H 1QNJA 1FY5A 3SUEA 1O2PA 1E79D 4A1XA 4GHNA 3KHFA 1GCTC 5AFZH 2CGAA 4OEOA 1E37B 5EJLA 1DY9A 2OLGA 1CE5A 1TX8A 2I04A 2PUXB 1RXPA 3K9XB 2CHAC 2BD9A 2FNEA 1MH0A 2J38A 1HAOH 1TP3A 2LUIA 3VXEH 5IL9A 2QXGA 1NESE 3KCGH 3SBKA 2HALA 3UY9A 1AVXA 5TCAA 1UEQA 1UFXA 1FN6A 5KEDA 4KFVA 1SGDE 1P12E 3SZEA 1TGTA 2GGVB 4LMMA 1DSUA 1GHAG 3MH7A 4NMRA 4OEPA 3F0OA 4I33A 4F4OC 3BTFE 2V3MA 1GBKA 3F9FA 4Q3HA 2A5AA 3KL6A 2WPDD 2OSGA 2FOHA 3ID1A 4KFWA 2ZHWH 2DM8A 4JYVH 4YYXA 3RLYH 1BMMH 1QR3E 1SVPA 2A2QH 1TGSZ 2BOHB 3B23B 1NTEA 3AXAA 2D1JA 3BTDE 1HNEE 5JPMH 1P2IA 1VJ6A 1GHXH 3GY8A 4I32A 5LPEA 1P02A 1ELBA 5CHBA 5A2MH 5C3NA 3ID4A 2YMSC 1HJAC 4E05H 4GCHG 1GI0A 4BAQB 1UCYH 1THSH 2KAIB 4DJZB 2IWPA 3RXHA 2J9NA 1E38B 4NMQA 3SUGA 1TRMA 1J15A 3T2NA 4KTUA 1RTFB 2L4TA 1XMNB 2P3WA 3IITA 4P0CA 1O3DA 1OYTH 2RA3A 1WTGH 1QRWA 1LHFH 4X8VH 2DC2A 2G4TA 5TJXA 1VITG 1GPZA 1T2MA 2BYGA 1UM7A 2I0IA 1C2GA 1HAZB 2Y5FA 1NZQH 1UTPA 5HIZA 1GHBF 1MKXK 2BMGB 2PFEA 4K1SA 1UF1A 4RKJB 2EC9H 2RCZA 3STIA 5EJZA 4NWLA 3PS4A 2GV7A 4HI3A 3HVQC 5C1YA 3A7XA 1BMLA 1C4V2 1HDTH 3M35A 1GDQA 2XRCA 1D3TB 1H8ED 3RXEA 2OK5A 1GI2A 2KZ4A 4FETA 5EODA 3C1KA 1OWHA 2OS6A 2KX4A 3JZ2B 3QGJA 2GMTB 4P00A 4Q7YA 2ZGJA 3ESTA 1PPHE 4LXBH 3RXDA 1OBZA 1EAIA 1GWAA 3QO6A 1FC7A 1Z8JB 1LPZB 2DLSA 1J9CH 1ID5H 2KPKA 4CREA 3DFLA 3QX5H 2PV9B 1U37A 2PTNA 4YOGA 2A32A 4NGAH 3W95A 1O3BA 2PHBA 4Y71A 1ACBE 1TYNA 1WJLA 2EV8A 1BJVA 1L2EA 3SO3A 5EW1H 3BTEE 4M7GA 2EA3A 1KDQA 2HLDD 2PKSC 1O3NA 4TY6A 5DP3A 4TY7A 1DLKB 1FC9A 1GI9B 2Q3GA 5FBIA 3ZVEA 4JJ3A 2PTCE 2ZGXH 1MMJN 1BHXF 1ORFA 1N6XA 1J8AA 1Q31A 2ANKH 2TRMA 2AYWA 1K1PA 3LC5A 3M3TA 1NTPA 1GBHA 1UHBB 4JMYA 4AMHA 1NFYA 3U8TH 1AY6H 3ATWA 3RXQA 2WUCA 3ID2A 1UTLM 1LHDH 1O2HA 4AFQA 1HAYB 2QF0A 3PLPA 2QY0B 3V0XA 3SV8A 1QAVA 2WV9A 2Z7FE 5PTPA 5DTHA 2VZ5A 4WH6A 3RP2A 1L1GA 4K2YA 3N7EA 1EPTC 3A7WA 2P93A 4UD9H 4ASHA 3ZV8A 1L4DA 1CHOG 1MAYA 2VB0A 4NA7A 1QB6A 4MNYA 2WINI 3OEED 4K1TA 4I8LA 2JSNA 5EW2H 1TMUH 1AO5A 2GCHF 1CBWB 2R0KA 4XDEA 3G01A 1Z7KA 5A8YA 2J95A 1S81A 3LGUA 3PTNA 1L6OA 2QKTA 4Q6SA 1B0FA 4KP0A 5JBTA 4AYVB 3SOSA 1O30A 1IQKA 1TNGA 5H3JA 2ZU2A 1W9OA 4HTCH 4FLNA 2FYQA 2K8IA 3OFND 1UK2A 3O8RA 3PV5A 4J2YB 1NRPH 1W14U 3EGKH 3K6ZA 4GVUA 1AE5A 1PQ5A 1V2OT 1W0KD 1V2KT 5LPRA 1D3PB 1SHHB 2BB4A 1CHGA 2IOTA 1GBAA 3A87A 2OQ5A 5K0HA 2F9UA 3R68A 3BEFB 1NFUA 2FPZA 1GI3A 1H8DH 3QE1A 1C2EA 5GLJA 2IN2A 4JYUH 3EA7A 2G5MB 1CA0B 1AZZA 5HM2A 1G9OA 4FU7A 1ZSLA 1EJAA 2Y7ZA 5K7RA 2AMDA 3PB1E 2VIDA 5GCHF 2BY6X 3E8LA 1GMCF 1P1EA 2YUYA 3WKMA 2PP6A 1EB1H 2K20A 2ZHDA 5EXNA 3M61U 4E7NA 2QV1A 2FS9A 1O2ZA 4TYDA 4Y7AA 1O5CB 4ZHMU 1TONA 4MG3A 1H8IH 2C90B 1GG6C 1D5GA 3EA9A 1W7XH 1K1MA 3CNRA 3CENA 1FY3A 1E0FD 2NU3E 4WXVA 2W3KA 2P8OB 1N6YA 1KSNA 2GV6A 1CGJE 3QK1A 1GMDF 2V0BA 3B9FH 1Z1IA 3SGQE 3TLOA 3QDZB 1C2LA 2OP9A 1OWDA 1XXDA 3FP6E 4I8JA 1P1DA 2FDAA 2ZU5A 3IWMA 2QXHA 4NIXA 2KBSA 1SGIB 5FPYA 2O2TA 3RXGA 4O03A 2C4FH 5J4QA 3TGIE 1S5SA 1TMBH 2EGKA 3K2UA 4WF8A 4O06A 2GJGA 3RXSA 1UVUH 1T8OA 1YY3A 1O3AA 1TBRH 2G5NA 4NG9H 3TSWA 1RZXA 1OOKB 1GHWH 3SHAH 1D4PB 5HDYA 2SGAA 2BTCE 2GKVE 2PR3A 2Z9LA 3LOXA 1Y8TA 2FX4A 3ZYDA 3LKWA 1GHYH 2Y80A 3AAUA 3CBXA 2ZU1A 3TJUA 4H42U 1P09A 3L4FD 4SGBE 2YMSD 1DOJA 5CE1A 1U39A 5AFYH 3P17H 1TQ7B 4TWYA 2JOAA 1SQOA 5A0BA 2NU2E 2ZDMA 3SHCH 5LH8A 1XXFA 4D9RA 5HYOA 1F5KU 4XBCA 4PQWA 1XKBC 4OAJA 4RKOB 1ELEE 2G4UA 2M5TA 4YT7H 2Z9GA 4GAWA 4X6NA 5FAHA 2FLRH 2FXRA 5EPNA 1OWIA 4X1RU 2GCTC 3KZDA 4B76A 1O5EH 2XNDD 1XZ9A 1H9IE 4D7GA 3KQDA 4B71A 1HIAB 3GCHB 3MU8A 1YC0A 5HEDA 1YF4A 3HGNA 3MMGA 1OS8A 5DKMA 1TRNA 5EQSA 4JOHA 4F48B 1MTWA 1SFIA 5A8XA 1VR1H 3ZVBA 3A86A 1DM4B 2KJPA 1QRZA 2VIQA 4R2ZA 4X2YA 1FQ3A 2EEHA 2F83A 1WFVA 1O2VA 3KQCA 2BDYA 3MTYA 3SV7A 1C1WH 1VGCC 1EUFA 2KOJA 4JOGA 3TJNA 1ZZZA 2BD8A 1C2DA 1TQ3A 1C5XB 3HPTB 4TWWA 3RDZA 3ZV9A 4INLA 2VIOA 4Q6HA 3MWIU 1QY6A 1ANDA 1PPZA 1Z6JH 4MPAA 1WYKA 9LPRA 3AASA 2G81E 4KKDA 3CS0A 3RXFA 2WPHS 2M3MA 1AUTC 2A2XH 3ZZ8A 3Q77A 1AVGH 2M0UA 1C1TA 1V2PT 2HRVA 5IDKA 1E34B 1TNKA 2K0QA 4E3BA 1RRKA 1GI8B 4XSKU 1DSTA 5E2OA 5A2PA 1ELAA 5HETA 3F2HA 3FKSD 1F0RA 1DXPA 3HK3B 2OQSA 2XBWA 2ZHFH 1MQ5A 1U38A 1MKXH 2BY8X 5HIYA 3RU4T 2AGGX 3NCVA 2HNTE 3EE0B 1GBMA 2REYA 1BMAA 1O3HA 2ZFPH 1GDNA 2ZI2H 3RMNH 4YOJA 5ABWA 1P0SH 3ZZ3A 2KA9A 2ENOA 1FC6A 1IQHA 1RTKA 4AORA 3QGLA 1SGFA 4GUXA 1BJUA 2HLCA 3MH5A 2AMPA 4B73A 2OXSA 3VQFA 1ZGIA 1RGRA 2CF9H 1SBWA 1BHXB 4DT7B 1K28D 1G37A 4MLFB 1OBYA 1BMFD 2MX6A 1FY8E 1R6JA 3ZZCA 5E8EH 1GCDA 1GBIA 2PKUA 1AFQB 3PMJA 1O3CA 1O2MA 3SGBE 3T27A 4SGAE 2VIWA 2FOEA 2C8ZB 1V2NT 2W7UA 3UNRA 1TBZH 4JORA 4ZXXH 2ZDNA 2CHAB 2Q6DA 3OAAD 3L33A 1ZOMA 4WVPE 1UJUA 2HNTC 2L4SA 1UEWA 1BQYA 1N8OC 1BTXA 4B2CA 4Y7BA 1ESBA 2VU8E 3CH8A 5LPFA 1SHYA 2F91A 2A4QA 1DS2E 1LPKB 3E1XB 2F3CE 1QLCA 3R0HA 4THNH 2TGDA 4UFGH 4OGYA 5BPEA 2AMQA 1QBNA 1VA8A 4TSFD 4JOKA 1HUTH 4ZXYH 4I86A 3SI3H 1SLVB 1UJ1A 3LGVA 2UUFB 2IWQA 3I29A 2EI8A 1V2UT 3PLKA 2D92A 3QIKA 1FXYA 3N7DA 3FOAA 2VBCA 2ZFRH 1A7SA 3BG4C 2LC6A 2J2UA 2H1UA 3CBZA 2B8OH 3HGPA 1YPLH 1O2GH 4Y76A 2FX6A 1C1SA 3VB5A 1C1UH 4ASUD 2MHOA 3TJVA 4E35A 4Q63A 3LGYA 3GJ9A 3RXCA 4CBNA 3SQHE 5DN6D 5EGMA 2EDVA 5HMAA 2AIPA 2C8XB 1M5ZA 2LC7A 4Q2NA 5EQRA 3OY6U 1O2UA 1HAIH 4JJ0A 1GBTA 1OXGA 1FLEE 4A5TS 3GABA 1AQ7A 1PDRA 4LK4A 3VB6A 1OSSA 3P8GA 4ZROA 2QF5A 2BD2A 3K1RA 4FUGA 1A5GH 4ISOA 4UE7H 1OX1A 1YBWA 1S84A 1EOLA 2A4OA 4Q2KA 1NPMA 1G3EA 3SU6A 1DFPA 2SGPE 1BUIA 2PKTA 1RY4A 1OWJA 2BXUH 3OYPA 1MCTA 1QJ7B 3A85A 4JZDH 2HVYB 2ZGHA 1A0HB 2BHGA 1ELFA 3DJAA 3T25A 3O8CA 1Q3OA 4FXGH 3AW0A 1AFEH 4MDSA 2VGCC 1Q2WA 5DPAA 1O3FA 3TK6A 3RXVA 4OM9A 4B6FA 3H7TA 1ZTLA 2QGRA 1LTOA 5F67A 1C1MA 1P11E 2AGEX 2KR7A 3KN2A 3NWUA 3LGIA 3VB7A 2KYLA 4Q2PA 3NK8A 4B75A 1XUHA 2OC1A 2QXJA 2F43B 1A4WH 3ZYEA 1GQ4A 2EAQA 1CT0E 3M7QA 4U32A 3RXJA 4ZHAA 1O2YA 1O3GA 1GM1A 2V90A 5CDFE 4Q2OA 3STJA 2OC7A 3A7ZA 5HFEA 3ATLA 1KXEA 3TNTA 2PKSB 1ZOKA 1AVWA 5B42A 3OU0A 2I6VA 2DB5A 1G32B 4LZ4B 3MO9A 1C5PA 2Y7XA 4M9FA 2OC8A 4FVBA 2VNTA 3A8BA 1BFEA 3TGKE 1SOZA 1FUJA 1ELTA 2BQWB 2KAIA 5LGOA 3SNCA 4X1NU 1UITA 4TPIZ 1SLXB 1O2IA 2BDGA 1LHGH 5F8ZA 3CC0A 2ZHQH 3F9EA 2OQUA 4HGCA 2ZTXA 4A1VA 2ZGCA 2EEJA 3HKIB 4I8HA 4I8GA 4NA8A 5IK2D 1IU2A 1K0HA 3DJ3A 2Q1JA 1O2LA 4AC9A 1FJSA 1C5OH 2P3UB 5T1VA 4D8NA 2BXTH 1HV7A 4UFEH 2HNTF 3ZRTA 4K76A 1C2IA 1DWDH 1EATA 2W7SA 2PUQH 1ZPCA 2W6JD 1WIFA 1KXCA 1MUEB 4HOPB 4CRBA 1LQEA 1TOCB 5GPIB 3S69A 5AF9H 4KELA 3SHWA 1AIXH 1KLIH 2WPJS 1BITA 3R0FA 3KF2A 1C5TA 1D6WA 1KXBA 1QZ8A 1O3PB 1TP5A 1YPMH 1CT2E 2XTTB 3BIVH 2DUCA 3K6YA 4BAKB 3Q3KA 3RXUA 4JOPA 1TALA 1V2RT 4FUHA 3PMAB 2WUBA 1QBOA 4KGAA 3SGAE 2QA9E 3SJIA 5KECA 1W9QA 1U6QA 1P10A 3M5LA 5DP4A 2A7JA 1BA8B 5F53A 2W4FA 3V12A 1TOMH 1WTHD 3TMHA 1WFGA 3E16B 9ESTA 2ALVA 3LDXH 3RMMH 2AS9A 4NCYA 1UM1A 1BZXE 3D65E 1TA2A 1BTPA 4IC5A 2FI5E 3I78A 1GHBG 1T8NA 3DCLA 2W26A 1Z71A 2Z3DA 3ENSB 3QZQA 4ABJA 2Y82A 4FU8A 1UEZA 1TFXA 5HEBA 2KCYA 3RC4A 1ANEA 3U8OH 5EQQA 1BBRE 3UOPA 1T31A 5JYIA 5FL7D 3A8AA 1WCZA 5E6PB 1GG6B 1PPBH 2G00A 2H9EH 3MQKC 1OHHD 2R2MB 2YNBA 2EJYA 1ETTH 1LVBA 1XKAC 2XOKD 1FY1A 1AWFH 2EXGA 2XCNA 4WH8A 1RTLA 5E0GA 4NA9H 1ELVA 4ISNA 3TJOA 4NMVA 3A7YA 1K1OA 1LQDB 5JB8S 3OSYA 4XOJA 4HFPB 5JBBS 2GT8A 3W94A 1BBRK 2I0LA 2Q9VA 1ANCA 2BD3A 4IGDA 5C5OA 1SL3A 2JILA 3VQGA 4Y10E 5ESBA 2ASUB 1GI4A 4IS5A 4FVDA 1DUEA 2KFWA 4VGCC 4I31A 1O33A 1EZXC 5FXLA 1YCPM 1MFGA 2DMZA 1MTSA 1GI5A 3PO1C 2PA1A 5HM9A 5EJ1A 1ABIH 2IWNA 4NZQA 3ODDA 2C93B 4CRGA 2OBQA 1GJ8B 4NMTA 4DGJA 2Y81A 2P3TB 4MNWA 1KMHB 1D6RA 2NU4E 1YGCH 1GHAF 4UONA 2SGQE 2JIKA 2HE4A 3R69A 1WU1A 1C5ZB 4WWYA 3MHWU 2YTWA 4R8TB 1B8QA 1I92A 1G9IE 1SGRE 2M0VA 2HGAA 1WUNH 2XBVA 1ELDE 1K1JA 3KHVA 5DO4H 3DSPA 2Z94A 2ZNKH 2KG2A 1GVKB 2QXIA 1WAYB 1V2MT 3SJOA 4DVAU 2RFKC 1KY9A 1H9LB 4NSVA 1SKYE 3M5OA 2M2AA 5EPYA 3M36A 5JXBA 4MPWA 1VJ9U 1QL8A 5FHTA 2O8LA 4CRFA 3QUMP 2A4RA 3FAOA 2GCHG 1FNIA 3EGGC 2VRFA 1AI8H 1QAUA 3ZZAA 1YPGH 5L6NH 2QCYA 3RUOA 2BLOA 1A0JA 2R3YA 5IYTA 1VCQA 1GBJA 3D23A 2BVXH 3N99A 4MPXA 5GXPA 1NRNH 1WG6A 2P3FH 2D2DA 1O2NA 2G5VA 1RS0A 1O2TA 3K82A 3SU3A 4P02A 3MU0A 2OMJA 1SLUB 2VWRA 1YPKH 3P8NA 3ZZBA 4YTAA 1F92A 3T28A 2K1ZA 1RGQA 3DSOA 1ESAA 1GJBB 2CJIA 4RN6A 2ZIQH 2E7KA 5HJ1A 1Z6EA 2BX4A 3MO6A 4NFEA 1QJ1B 2H5CA 2VPHA 4GLYA 1N6FA 1JRSA 4Q2QA 2J94A 3U69H 2BOKA 1WH1A 1HBTH 3A84A 1TPPA 2GZVA 2STAE 5GCHG 4A6LA 2KCAA 1SOTA 4YM9A 1O5GH 2B7DH 2FI3E 2QYIA 3UTUH 5EIYA 1QB9A 4X2WA 2ZEBA 4UU5A 2Z3EA 2BY9X 3HK6B 2CSSA 1UHPA 3WWFA 1V6DA 1ETRH 1GGDC 3LH3A 1YPHE 1MQ6A 1Y3XA 1F5RA 3O8DA 1C4U2 1ZLRA 3PTBA 4RSPA 3WW7A 1P05A 2UWPA 1AE8H 3MO3A 5KGOA 1F2SE 1QCPA 1D9IA 2CF8H 2D8WA 1HLTH 1WI4A 1W0JD 1SQAA 1GMDG 2LELA 3TK9A 1LMWB 1TPSA 3GDUA 1S6FA 4X2VA 1LKAA 3BTWE 2C8WB 1OP2A 1V2JT 4BAOB 2CMYA 4CH2B 4Q7ZA 1J14A 4NIWA 2FOMB 3IG6B 1BTUA 3ZZDA 4K72A 1SGNE 1SQRA 2ZCLP 2OZFA 1O5BB 3ZVAA 2H2BA 4AOQA 2EI6A 5E0HA 1HIAA 3QGNB 3RLWH 3S7HB 2YNAA 2XC5A 2QE7D 3Q3YA 2ESTE 1C5MD 3BPUA 1HGTH 3M3VA 2TBSA 4NMOA 1IQFA 1OWEA 1SSXA 1Z8GA 4CBOA 1CGIE 3P95A 2ZFSA 1V2WT 1NRQH 3PMBB 4NIYA 3RXOA 4ISIH 2ZCHP 2F5YA 1N6DA 2YT7A 2JINA 1A46H 3U1IB 4DURA 2YT8A 1TNIA 2HVXA 2KJDA 4Y8ZA 1E35B 1P9UA 3KIDU 1GVZA 1P9SA 1FDPA 4OGXA 1CHOF 1UVSH 1QTFA 3OY5U 3I77A 1O2XA 1O39A 1GQ5A 1V6BA 1K22H 1EFRD 2LPRA 2BVSH 1KDQB 2ZTZA 2ZU4A 1SB1H 2VINA 2TGAA 5C20A 4U01A 2O8UA 4D76A 1ETSH 1K9OE 1ZPZA 2HWLB 2WYGA 1VB7A 1MCVA 1KXAA 2GVFA 1W3CA 1L4ZA 4A92A 2M10A 1VITH 3KDKA 3Q3XA 1YWUA 5DJ7A 1ESTA 7GCHF 1KTSB 4Y6DA 3MH6A 5E0JA 4UU6A 1O3MA 1P03A 4ACBA 4OS6A 1VKYA 2B0FA 5DP8A 1T4UH 2FOFA 3M5NA 2PLXA 3RXKA 3M3SA 3SI4H 1TNLA 3N7OA 1AD8H 1O32A 1MAXA 2DJTA 2ZC9H 4E7RG 1AMHA 2AGIX 4NNLA 1INCA 2IPQX 4AN7A 2KPLA 1LKBA 4K8BA 4FUJA 6CHAC 1P2OA 1DY8A 2I6QA 3QTVH 1F0TA 1T8LA 2FTLE 4JOEA 4WMDA 3SV9A 1F0UA 2D8IA 1X7AC 1DWCH 2G52A 1SGEE 1EKBB 4GSOA 1TWXB 4YESB 4NXRA 1YCPK 1UTKA 2CXVA 1YP9A 1QB1A 2L97A 1K1LA 4D9QA 4FUEA 1THRH 2QBWA 1V2LT 2RG3A 1WHAA 4B2BA 1EQ9A 1UVTH 2ILNA 2BDAA 3RXTA 1IQLA 4ZCNA 4ABHA 4ZKSU 4X1PU 3RM0H 3E90B 2L6OA 3MI4A 1SG8B 3UWJH 3B76A 2RA0A 2JETC 4AFZA 1HAVB 2GP9B 1QA7A 3FZZA 2QF3A 1GI6A 1ANBA 4BTUB 1DWEH 5DSFA 1BCUH 5T6FA 1M9UA 4X1QU 2G55A 2FTMA 1TX6A 1JBUH 1TLDA 3I18A 2PDZA 2KOHA 4O97A 3VXFH 3VPKA 4YXWD 3GY7A 4IN1A 5GNDA 4OS1A 3NPSA 4UFDH 1VCPA 4X6PA 5HKKD 1UTMA 4NMPA 4CRAA 2FE5A 1S83A 4K60A 2ZFFH 1RFNA 1WQSA 1BBRH 1AZ8A 3EE7A 1D3QB 4JZ1A 4XRNA 3KZEA 3GSLA 2PGQB 1OP8A 1F7ZA 2D26C 2W7RA 5SGAE 3V3MA 1GL0E 1Y3UA 4JCNA 3TIUA 2HE2A 2UWLA 1WQVH 1JXPA 3LIWA 3SV6A 3S9CA 4PROA 1O3EA 2R9PA 4AB8A 3NFKA 1Z86A 1JRTA 1A1RA 1MU8B 5F03A 1KWAA 1CBWC 2Z6BD 3RU4E 4K69A 2XXLA 1PPEE 1VJAU 2OGPA 1P2NA 1G30B 3AVZA 4JOJA 1AB9B 1Y59T 1NF3C 1OWKA 1Y5AT 4FGMA 1EASA 3ODFA 3AAVA 3UPEA 1C5YB 5TCCA 1SFQB 4I8KA 1Y3YA 1QIXB 1WF8A 5FCRA 1GCTB 1P3EA 2JREA 4L8NA 1QQUA 1XUFA 4WYTA 1QJ6B 4CRCA 1FMGA 1EOJA 1H1BA 1SQTA 2H6MA 2NU0E 4Y79A 3O46A 1T32A 3EDXB 2CK3D 4R0IA 3T29A 4TPYA 1PFXC 1HAHH 4H6SB 2P59A 4B74A 3E17A 4NXPA 5DG6A 3PDZA 3KYFA 1X45A 1THPB 3P8OA 4NZLA 4Y8XA 5EXMA 2QKUA 2ZQ2A 3RC5A 1A61H 2ZA5A 4IBLH 4Z33A 3A88A 1LHEH 5F3XA 3RXLA 3SN8A 1FV9A 3EAJA 7LPRA 2P95A 1Q7XA 2PW8H 1W9EA 1GJ6A 2KQFA 4K3JA 5T3HA 1ABJH 4AZ2B 3DUXH 1CA8B 1UO6A 3PLBA 2FMJA 2UUYA 1UVPA 4K5ZA 4MPUA 2DLUA 5FX6A 3QDOA 4DW2U 4XHVA 4IW4E 4INKA 2VWLA 4ZKRU 3F9GA 1AKSB 1H8HD 1N7TA 3VFEA 2YMSB 1HJAB 5C0TA 3LH1A 1AHTH 1E1RD 5GDSH 3DA9B 4CHAC 4X6MA 6ESTA 2PKAA 3E6PH 4ZKNU 2OCSA 3TSVA 2M0TA 3SOEA 4K6YA 3VG8A 3KQBA 1GMHF 3UNQA 2F9NA 4Y11E 1CGHA 2AIQA 3UIRA 4HOPA 4YDPA 2V1WA 3ZZ9A 4DOQA 3UREA 1C1NA 3A89A 3FZDA 3GYLB 3KYGA 1QBVH 3SUZA 1MTUA 4XD7D 1KEFA 2FOCA 1O2SA 2QC2A 1MC7A 2STBE 3LJJA 2F9PA 3GY4A 3L6PA 3JZ1B 4VGCB 4BTIB 2GZ9A 5GJ4B 5BRRE 5C17A 2R3UA 5DGJA 1DITH 3DT0H 1IHTH 3PO1B 2F9BH 3SORA 1W10U 2B9LA 3SU0A 1FIWA 1N6EA 3B8JA 4NNMA 2RRMA 1J16A 1XX9A 1O5AB 3ZZ4A 2A1DB 1C1OA 2Z9KA 2XC4A 3Q00A 2CS5A 1AN1E 3LNYA 4N6XA 2IWOA 2J92A 2ZECA 5DP6A 3KDGA 1MKWH 3BIUH 3M7UA 5EG4A 3SJ9A 3OX7U 3LONA 1YYY1 4BXSA 2FO9A 3TITA 1IQNA 4KTSA 2BM2A 4Q80A 3BEUA 1BRUP 2DE9A 1P2JA 3GCHC 1ARBA 3ZVDA 2GZ7A 2ANMH 1GBDA 3KGPA 1TGNA 5FPSA 1TA6A 1BDAA 3FN8A 3MNCA 1FONA 3NZIA 2Z9IA 2ZFTA 1JMOH 1B5GH 1PYTD 1LHCH 2DE8A 4E06H 3TPIZ 4DIIH 2Q6FA 1XVMA 4ABAA 5A09A 3RM2H 1A3EH 1N7FA 2QT5A 2H2CA 2P16A 2AFQB 2XBXA 4YZUA 6GCHF 3MH4A 3GCTF 2TPIZ 1HXFH 3SHUA
chains in the Genus database with same CATH topology
2F9VA 2GDEH 3BTTE 4HZHA 3VB4A 3C27B 1C1QA 4H11A 2RDLA 1O3IA 4WMFA 3FANA 4UDWH 1C2HA 5B6OA 1EZUC 2SGDE 2FOBA 2VH0A 1T7CA 1CSOE 1X5NA 1DWBH 1O5FH 1HCGA 3SJKA 5E2PA 2BY7X 3OTJE 4FU9A 1BB0B 3SNEA 3MU5A 1TAWA 2QG1A 1NY22 2KJKA 3GCOA 1CQQA 4BXWA 5JDUB 4Z6AH 4ZUHA 1W2KH 4MNVA 1EPTB 4FUFA 1C5NH 2BDHA 2BLQA 2JKHA 1EAWA 1IAUA 2OBOA 3ZVCA 2PWXA 4H6TA 2VIVA 2AH4X 1KXFA 1V1TA 3BV9B 3ZZ5A 3TSZA 4YT6H 1WBGB 2ZPSA 2A4GA 1CVWH 4JZEH 1XUGA 1ZTJA 2XCFA 2ZG0H 3DORA 2QIQA 1GBBA 4FUIA 3VGCC 1MZDA 2KOMA 1N1LA 5DP7A 2BD7A 5EYZA 5C5NA 5HFFA 5B6LA 4E34A 1BIOA 1YBOA 1C2JA 1EAXA 2OPGA 1ELGA 3NKKA 1YCPH 3F1SB 4Z0KA 1C2FA 4JL7A 2FM2A 3HPKA 1P2QA 3QZRA 3QJMA 2ANWA 4ISHH 1AFQC 1XUKA 4X6OA 8ESTE 2KAWA 1O5DH 2OD3B 3RXAA 1QL9A 2Y6TA 1J17T 2ZP0H 1MTVA 1AWHB 2QKVA 1U3BA 3GOVB 5D13A 1GJ7B 1ZHRA 1HXEH 1I16A 5FPTA 1ZMJA 1C5VA 3K50A 2ANYA 2R2WU 3UFAA 5JBCS 2FESH 1WSSH 2ALPA 1W8BH 1EX3A 3SV2H 1O2KA 1UHBA 2NWNA 3PYHA 1QRXA 2VJ1A 3UQVA 4ZH8A 8GCHF 4CR9A 1F5LA 4B1TA 1GHZA 3DJ1A 1FAKH 2LNCA 4U2WA 1GJCB 2PNTA 1YLDA 1O34A 3QWCH 4RI0A 1UTOA 1VZQH 5AHGH 1HRTH 2G51A 3FY5A 2H9TH 1MTNC 1LVYA 2ODYB 5FCKA 1DVAH 3TGJE 2WPIS 2ZU3A 3SUDA 2H3LA 4ABGA 2XBYA 1LCYA 4NFFA 4NIVA 1WHDA 2PZDA 1EB2A 1V5LA 2EDPA 3RU4D 1IQMA 4ABFA 4AGKA 1P2MA 5F8TA 3U1JB 1Q3PA 2OINA 5CMXH 3BTKE 4CH8B 3D49H 2ODPA 3GYMA 4JYTA 2HOBA 5HFDA 3SNAA 3BG8A 2ZPLA 3MYWA 1NRRH 3PROA 1BTYA 2WPKS 1O37A 3FVFB 3LU9B 4AG1A 3FP8E 1P57B 2BX3A 1CU1A 2FOAA 3UR6A 4YLQH 2GX4A 2LOBA 1XVOA 1Y5UT 1C5WB 1GJ9B 2H2ZA 2GD4B 2HGTH 5F8XA 1ZHMA 2ZCKP 4AX9H 3PDVA 1W7GH 2SNVA 1GI7B 4XBDA 1W12U 2D90A 1MBQA 4XE4A 3MNSA 5A8ZA 2UUKB 1Z1JA 2HPPH 1NFXA 3RLEA 1WI2A 1SGQE 2EDZA 1EAUA 4BAHB 2BQ7B 1LO6A 2QN5T 1V62A 1NU7B 4ZAEA 1WOFA 2IJOB 5C67A 2ZDVH 1K1NA 1O2RA 2ZPMA 6CHAB 1UTNA 2WL7A 3RXRA 3EQ0H 1O38A 2Y5HA 2GCTB 5EOKA 2BLWA 3BF6H 5CHAC 4REYA 4IMQA 3SU4A 3UWIA 3KEEA 2XWAA 5C2ZA 2BVRH 1C2KA 4GCHF 1HAXB 1GHVH 1VCWA 1O31A 1UK4A 3LNXA 3ZZ7A 1C2MA 2F0AA 1RGWA 3DD2H 3GCNA 1ZUBA 4XFQA 1P01A 1FAXA 1SGPE 1FPHH 1IOEA 2AEIH 3F9HA 1RIWC 4JK6A 4ABEA 1C5LH 2CSJA 5HF4A 4ISLA 3S9BA 2QAAA 1GJDB 2A0QB 4NXQA 4K75A 4X8UH 2BQ6B 1VITF