3GCOA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyqf omp peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
302
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
molecule keywords Protease degS
total genus 59
structure length 302
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA01
1CGHA 2H1UA 1F0UA 1NTEA 1T32A 1AKSA 3SO3A 4ABIA 3PLKA 1O3BA 2FDAA 4JYTA 2JWEA 2PKAA 8LPRA 4YDPA 4I8HA 2IPHA 1A7SA 5L6NH 2Z9GA 4ZAEA 1GMDG 3GYMA 4X2WA 3ODFA 3GY5A 1MTWA 2G4UA 1GHXH 3LOXA 2D26C 1JRSA 5E0JA 1EAIA 3SHCH 1DLEA 1VGCB 1AO5A 5A0CA 3PMHB 1GVLA 4WXIA 1TRYA 4ABHA 1G9OA 1UFXA 2LOBA 4BANB 3NK8A 1O2WA 1GQ5A 1WJLA 1C5VA 2K1ZA 1QL9A 2WYGA 4I8JA 5FBEA 3BN9A 3DD2H 5EZ0A 2PV9B 1C2LA 1X7AC 4NZQA 1ELGA 5C67A 3JXTA 4ABEA 2ALPA 6GCHG 1O3IA 1PDRA 2KOJA 4NMSA 4ZHAA 1O3LA 2ZGJA 2O9QA 2STAE 2Y5FA 1O5DH 2GTBA 1TNHA 1EKBB 1QQUA 2VRFA 2R9PA 1W13U 2OZFA 1QJ6B 1ZJKA 3BTHE 3LNXA 2QBWA 3MU5A 4O3UA 1AFQB 1UM7A 1O2ZA 2OQUA 3LH1A 3EGHC 4CH8B 5L30H 1CT4E 3STIA 1OWDA 1OSSA 1VJ9U 2XC5A 1P2OA 1DUAA 1UK2A 1GCTB 1TX6A 2ZGHA 3SN8A 1THRH 2V6NA 3LC3A 4WMEA 1MTNB 3QTOH 1YPJH 1TYNA 2JILA 1P02A 1TPSA 2ZDAH 1U6QA 1EXFA 3A7WA 1UITA 1VB7A 4MPAA 1KY9A 5C20A 2UZCA 4OGXA 4NIWA 1JOUB 1GI4A 3TSZA 3WKLA 2I6SA 3F9FA 3PROA 1X6DA 1C5OH 5E1YA 1GJ4H 1FDPA 2QF0A 4XBCA 2RRMA 2XC4A 4X2XA 2IWPA 5ESBA 4U2WA 1N6FA 5LPEA 3EGGC 2VSVA 1TBZH 1O3FA 1MTVA 1AHTH 3LNYA 2RG3A 2XBYA 3M5MA 3SGBE 4KTSA 2PTCE 4X1SU 1GHBF 2BZ6H 2OSGA 1N8OC 1A0LA 2YOLA 2BY5X 1AFQC 3MO9A 2NU4E 1V1TA 2FE5A 5E0GA 1P2NA 2BY6X 1C2JA 1UJ1A 1P09A 1CT2E 1DDJA 1MBMA 1GJAB 3NFLA 3BEIB 4DT7B 3L4FD 3BF6H 1P03A 4AORA 1C5UA 1T8NA 4NGAH 5FBIA 5A8ZA 1FY5A 1GMCF 2BLWA 1X45A 3O46A 2A4GA 1GGDB 2GVFA 1XVOA 4CRBA 3P8FA 2AWWA 4K75A 1ZSKA 4DGJA 3CH8A 1HIAA 2FOEA 2WPIS 4Q2KA 3ZVAA 2ZDVH 2WPMS 3D62A 4AG2A 3K82A 4NXQA 3KHVA 3BEUA 3K1RA 3MO3A 1MKXH 4QT8C 3O8BA 4KFWA 4Q2NA 1E34B 3Q76A 1VJAU 2YUYA 2W4FA 3TPIZ 4X6PA 2BQWB 2BZAA 2PHBA 2P3WA 1GG6C 1S6HA 3HPTB 4ISHH 4Z33A 1C5RA 2BVSH 1C1UH 2F5YA 1EOJA 1U39A 1Z8JB 3E0NB 1TFXA 1GMHG 3ID1A 1ELBA 2B8OH 3GICB 2ZPRA 1C1QA 3GDVA 2ZPMA 3ELAH 1KXEA 3TJUA 2RA3A 3OU0A 1P9SA 2QXJA 1KDQA 1N99A 1QL7A 1RS0A 1D3QB 2IN2A 2PGBB 1AN1E 2AS9A 2KRGA 4A1XA 4I31A 1TGTA 3BG8A 3PV4A 2R3YA 4NIYA 4DJZB 1Z7KA 4MVNA 3MTYA 4K3JA 1HV7A 3GY6A 2KAWA 2BQ7B 1E35B 1AFEH 1YC0A 5DP6A 3B23B 1GBCA 3D23A 1EZUC 2ALVA 3SOSA 3SZNA 4PQWA 1O2NA 3E8LA 3C1KA 1FC6A 4MPVA 2BMGB 3RXSA 1WHAA 2P3FH 3ZZ8A 1ARBA 3ATMA 4AGJA 2D8WA 2P3TB 5ETXA 3TGKE 4X2YA 1H9LB 2KG2A 3IITA 1RRKA 1OP0A 1OP8A 4INKA 2XW9A 1LKAA 1MZDA 5EG4A 3ZV9A 3TH2H 1MFGA 1A3EH 1AUTC 2C8YB 4D8NA 4VGCC 1BBRK 1U37A 3BTEE 3KGPA 4BAOB 5B6OA 1SLVB 1J15A 5T6DA 2W7SA 3LGVA 2A31A 2EC9H 2TIOA 3P8GA 3U8RH 3R68A 1J9CH 1O3JA 4ESTE 1FAXA 2HNTF 4ASHA 1O3MA 1EUFA 3PLPA 4ISNA 1NROH 4IBLH 4DY7B 1B8QA 5HMAA 1WHDA 3MOCA 1YCPH 4Y0YE 3S69A 4TY7A 1O2UA 2DB5A 2QCYA 1YCPM 1Q3OA 1K2I1 1ZHMA 3A82A 5E6PB 3GCHB 1W7GH 1HAVA 3SNDA 5F8ZA 2ANWA 2ODQA 3SI4H 2GZ8A 3A7ZA 1P0SH 1KDQB 3CENA 3QDOA 1O5FH 2REYA 1TPOA 1EB2A 2W3IA 3GY4A 3CBXA 3M3TA 1GBEA 1ETTH 3U8TH 1YF4A 2YTWA 3QZQA 2FZZA 1G32B 3QJNA 1GI7B 1O36A 3E17A 3GDUA 1T7CA 3LJOA 2C8XB 3GSLA 2NU1E 2VU8E 3GCTG 3CP7A 3DFJA 4K5ZA 1TLDA 4NMVA 1KXBA 4AB9A 4TWWA 4A6LA 3RXVA 2J2UA 5JYIA 1W2KH 4K6YA 1O3KA 1TQ3A 1LHGH 2D1JA 4UE7H 4Y11E 3I1EA 2CJIA 3PTBA 2C90B 1Z71A 3G01A 1W9QA 3VB6A 2VWNA 1KXCA 1SC8U 2ANKH 1C5MD 4MPUA 2FXRA 4ABJA 1Y3VA 2SGQE 1T2MA 3PTNA 1X5QA 1F7ZA 4Q2PA 1TBRH 1S83A 3ID2A 2ZPLA 4Q7YA 1BOQA 2PKSB 2JETB 3KEEA 1QBVH 3T2NA 4TWYA 3ATLA 3VB4A 2TGDA 4GLYA 2OBQA 1FLEE 1QJ7B 2A5AA 1NFYA 1PJPA 2M5TA 1KLJH 4IW4E 3QWCH 1ZSLA 3F9EA 2VIWA 4JOHA 1K1NA 2LUIA 1SGIB 1KXFA 5JDUB 3UQVA 1NN6A 1O32A 2W7RA 4YT6H 1ELTA 1HXFH 2FS8A 1HIAB 3SU3A 5HYOA 4ZHLU 2FI5E 5E22A 2M3MA 3EAJA 4ZXYH 4K1TA 2G5NA 4TPIZ 1B5GH 1V2WT 1ZGVA 2P16A 1T4UH 1FIZA 2Q6DA 3FP6E 4NMRA 4RKJB 5EGMA 1GG6B 3HPKA 2AWXA 1TE0A 4M7GA 4IN1A 1NO9H 3TH4H 2O8UA 3URDA 4YM9A 4JOGA 4ZROA 4RN6A 4GUXA 2Y7ZA 3SGQE 3SORA 3HPMA 2TRMA 1LHEH 1UK4A 1O2IA 5DP5A 3T28A 2FN5A 2OLGA 3DUXH 1UJDA 2TGPZ 1E36B 7LPRA 1BBRE 1O5EH 1BTXA 3RXFA 2R3UA 4NIVA 2QC2A 3RXAA 1GJ7B 1VZQH 1UEPA 4B74A 1P3CA 1PYTD 2PA1A 2STBE 2QV1A 3P6ZB 4KTCA 4NZLA 1G3CA 1AVWA 2FI4E 3T62A 4CRCA 5E2OA 4NA7A 4NFFA 2ZQ2A 3M7QA 1NRRH 1WTHD 1GM1A 2HGTH 2BLVA 4P2AB 1C5WB 1D3PB 4FGMA 3NGHA 1X5NA 2GDDA 1SLWB 3DA9B 4GVUA 1ZOKA 1ZMNA 2H9EH 1BE9A 2ZZUH 1GWAA 2J9NA 3BIUH 3KF2A 5IYTA 2BY9X 3ZVDA 3CYYA 2JH5D 1C5ZB 1WCZA 1Y5BT 1ESAA 4Z0KA 3FP7E 5GNDA 2KV8A 2ZFFH 5JBAS 1C5LH 4WF8A 3MH7A 1PPGE 4D76A 7GCHF 1CA0C 1YCPK 3PMAB 4X8UH 2H2CA 1QCPA 3A87A 1F5KU 1PPFE 1VCQA 3NUMA 4WMFA 4DVAU 1P04A 1TA6A 2Y5HA 1FY1A 3PO1B 1HLTH 3ATKA 1K1PA 4NCYA 3ITIA 1C4V2 4H6SB 1TBQH 2W7UA 2BY7X 3AVZA 3O5NA 1T8MA 2QKUA 2PLXA 4CH2B 4E7RG 2UUFB 2OC7A 1MQ5A 4AFSA 2C8WB 2WPJS 2ZHQH 2GT8A 4IC5A 4HFPB 1S0RA 5TCAA 1YPGH 3EA8A 1BTZA 3M3VA 2VWMA 1SMFE 1ZTLA 4FUCA 1ESBA 1MUEB 1C2MA 2XRCA 5HM9A 2NU2E 3HK6B 3ID4A 3UFAA 1AMHA 4ZHMU 1RTLA 3ZYEA 2GMTB 1AVGH 3KCGH 1Z87A 1LVYA 3E3TA 2P8OC 5E21A 2FODA 2VIVA 5K0HA 1BTWA 1PYTC 1UEQA 1DANH 3FZZA 4DG4A 2O8MA 2P95A 2H6MA 4H42U 5I46H 3PV5A 4E05H 2GT7A 3B76A 4NSYA 5EPNA 1XX9A 2BYGA 3TVJB 3PS4A 3M35A 5H3JA 1YLCA 4D7GA 4ABFA 3SV9A 1GMHF 1MC7A 2C3SA 1DWEH 3EQ0H 1UTKA 5E8EH 1RGWA 1GI9B 2FPZA 4FU9A 1QBNA 4WVPE 1W0YH 2XCFA 3EYDA 1Y3XA 3S0NA 4BTIB 1UTNA 3KQBA 3T5FH 1AQ7A 2ZKSA 1GCDA 4X6MA 4YESB 1NRNH 3KZDA 3ZVEA 4HZHA 2VIDA 2AINA 1C5SA 3BTME 5A0BA 2F83A 3OYPA 1EPTC 1MH0A 2C8ZB 5EW2H 2F9NA 1M9UA 2OC1A 4K2YA 1GL1A 3HGPA 1NZQH 5C1XA 3QJMA 1C1SA 1L2EA 4NMPA 1GJBB 2J92A 1GMCG 1AI8H 1BRBE 5E0HA 1NT1A 1V6BA 1BUIA 3RC5A 1FONA 5CHAB 2JOAA 3U98H 4GHNA 5K7RA 1ZPZA 5HFEA 3QGJA 2OP9A 4JZFH 4ISIH 1UHBA 1VAEA 2QXIA 1GDQA 2XBWA 3VB5A 2ZU4A 2H9HA 1RIWB 4D9RA 3BV9B 2ZGXH 3UTUH 1O2JA 3UPEA 1OWJA 4BNRA 4RKOB 2BDGA 2F9VA 1SGCA 1UJUA 1Y59T 1ZR0A 3QUMP 1ACBE 3S9CA 2KQFA 1PPEE 1CT0E 3F6UH 1RIWC 1SGRE 1P11E 3AAUA 3CS7A 1P57B 3PMJA 6CHAB 2GD4B 1DSTA 1G2MA 1HAPH 1KXDA 4XE4A 1SVPA 1W12U 5GIBA 4ZKOU 1K9OE 4MQAA 1F2SE 2DUCA 3TMHA 4OS5A 1ELEE 3SUFA 2H2ZA 1C1OA 1SGFG 1TNJA 4Q6HA 4H6TA 4BXSA 1UTQA 7GCHG 2UUYA 1ELFA 5C5NA 1Y7NA 1S81A 1FV9A 5GCHG 3LKWA 1THSH 1O3AA 4Y7BA 2FEQH 1SQAA 2ZGCA 3SJOA 3A8DA 2L4TA 4YOGA 5EW1H 1ETRH 1FC7A 1VJ6A 1WQVH 2WV4A 2CV3A 2I6QA 1PPZA 4U32A 4K76A 3ZZCA 1BHXF 1TQ7B 2M0TA 1O2QA 3VB3A 2GZVA 5DP8A 5AF9H 1LPZB 2CSSA 2GZ9A 1WH1A 1HAOH 2C93B 1WFGA 1P9UA 1UVPA 2HGAA 3TSWA 3A81A 1C5YB 2QF3A 4YOJA 3L33A 3U1JB 5HEYA 2EJYA 4UFDH 1ZUBA 1ZPBA 3STJA 2OXSA 5EQQA 2A7CA 2M0VA 1EPTA 1V2RT 3V0XA 1SPJA 2DMZA 2I04A 1O2XA 4CREA 3RM0H 1WQSA 3RXOA 3SU4A 3SV6A 1TNLA 5IDKA 1ANEA 4VGCB 2ZFQH 1WF8A 3MMGA 4XSKU 2EGOA 1FY8E 2Y5GA 4B1TA 1VGCC 1S82A 3PYHA 4X2VA 1W14U 1A46H 2FP7B 4HOPB 3OY6U 1K21H 1MTUA 1GJ5H 2L97A 4I8GA 3SNAA 3DORA 1G30B 3MO6A 3ZV8A 2Q3GA 1X8SA 4WXVA 5FPSA 4MPXA 3ZZDA 2BD7A 1TNGA 2SGEE 1UM1A 3SJKA 1SOTA 3I77A 1N8OB 5A09A 5GLJA 5SGAE 3TSVA 1ZMJA 2A32A 2BVXH 1YBOA 3SQEE 1QB6A 2FOGA 4K8YA 3ZZ9A 4A7IB 1BMNH 2KJDA 1GHYH 2DE9A 5FPTA 4BAQB 1Z8RA 3H7TA 1HYLA 1GBBA 5EXMA 3PDZA 3F9HA 1QB9A 3VB7A 4CRDA 1B0FA 2BVRH 2G8TA 5A2PA 4E34A 1S85A 4ISOA 3AW1A 2GKVE 6ESTA 1FCFA 2EHRA 3W94A 1GPZA 2MHOA 1V2UT 1HFDA 1C5NH 1YP9A 2KJKA 1L1NA 5EODA 1O5GH 1FC9A 2FWWA 1HAIH 4ZKRU 1N6EA 1DLKB 4AMHA 1TP3A 3EE0B 4J1YA 2WL7A 1SBWA 1TWXB 2V90A 1UJVA 5FHTA 3RLEA 1DY8A 1GBAA 2YT7A 1K1MA 1HUTH 3MNCA 2EEIA 1QAVB 1C2DA 1J8AA 1E0FD 3SNEA 2BDBA 1VITH 1OYTH 1UVSH 1A0HB 1OBYA 2H9TH 5FXLA 2TGAA 4Y8XA 2FOCA 3GCNA 3CC0A 5JBCS 2HOBA 3BTQE 1H4WA 1P8VC 1DITH 2AMQA 2B9LA 3PWBA 1GGDC 1D6WA 3KQCA 4FUBA 2VJ1A 1SI5H 3QX5H 1BBRH 1D4PB 3SW2B 1P1EA 5HFBA 3LH3A 3SU0A 4AFUA 1LO6A 2Z3DA 4JZEH 3RC6A 1HAHH 2BDAA 2Z9JA 2SNVA 2GP9B 1RXPA 4Q2OA 2F9UA 5ABWA 2VVUA 2OC8A 1OBXA 1TNKA 4CR5A 5DP9A 4CBOA 3ATWA 3A8AA 5DGJA 5EPYA 1RD3B 2AFQB 4GVCA 5EU8A 1YKTA 1IU2A 3HVQC 4LOYH 1O3DA 2PZDA 4Q7ZA 1W8BH 2HPQH 1L1GA 1L4ZA 2BD4A 1PQ5A 4SGBE 2WPKS 2H2BA 1O3HA 4A92A 4ZH8A 1ZGIA 3PMBB 1FIWA 2HVXA 2XYAA 1XZ9A 2HWLB 3GJ9A 4LXBH 1VCWA 4O9VA 2HLCA 1HAGE 1ETSH 1TB6H 1YLDA 1GI0A 2ZDKA 4JZIA 1G36A 4SGAE 5CE1A 5E2PA 2BX4A 1C5TA 1GBIA 2GZ7A 3K6ZA 1IQIA 2Y6TA 2KL1A 1FPHH 1GL0E 2I1NA 1TA2A 1BRUP 2AGEX 3TITA 1GBDA 1SL3A 4FUFA 4X8SH 1GDNA 2ANMH 2GGVB 4CHAB 2ZTYA 2R2MB 5FB8C 1H9HE 1SGPE 1P12E 5LH8A 3VXFH 4ABDA 3HATH 1CGIE 1NY22 3DHKH 1AB9C 4KGAA 1JIRA 2NU3E 4NNLA 1TGCA 4MNWA 4TPYA 1K1IA 5I7ZA 3MI4A 2ZFPH 2CXVA 1A5IA 5F67A 2ZQ1A 1WG6A 2FI3E 3BTKE 2DC2A 4U30A 1UTMA 2BD3A 1HRTH 5D13A 1BDAA 2HNTC 5T6FA 2ZU2A 5G1DA 2VIPA 3P17H 3T25A 4JK6A 4LZ4B 1O5AB 3M7TA 4UEHH 4X1QU 5HF1A 3RXJA 1GHWH 3BTDE 1D9IA 1QL8A 2BD9A 1KLIH 4JZ1A 1LVBA 3RMOH 1O3EA 1SFQB 1BZXE 3IG6B 4R0IA 5AHGH 3SQHE 4Y10E 1DVAH 4JYVH 3TJOA 1TONA 5FPYA 1BITA 3HK3B 8KME2 1YPHE 2A5KA 2TPIZ 1OZIA 4G69A 2PFEA 5AFZH 5GPIB 1BJVA 2VWLA 4R8TB 1Y3YA 1UHBB 1R6JA 2QG1A 1O2GH 1V62A 1A1RA 5EQSA 2X7ZA 3T27A 2ZIQH 1LDTT 2YUBA 3QO6A 4JORA 2UUJB 3TK9A 3BPUA 1FY4A 4X6OA 4Y0ZE 4O3TA 3FZDA 1JMOH 1AE5A 1HJ9A 3HKJB 7KMEH 2VIQA 2SGAA 4Z6AH 1P2KA 3A8BA 3ENSB 4J2YB 1GJ6A 1KTTB 3MNBA 1EASA 5EQRA 1MAYA 1EJAA 1RGQA 3GY7A 3N7OA 2B7DH 1H9IE 1LHCH 4JOPA 4GHTA 2DM8A 1O33A 1Q3XA 3GISB 4CHAC 1TMBH 3LDXH 3ZZ5A 3RL8A 1L1JA 1PPHE 2Q9VA 2ZWLH 1OYQA 2GCTB 1DWCH 3QK1A 1Z86A 2HALA 2M0UA 1GMDF 2FTMA 4MPWA 1NF3C 4Q7XA 1DOJA 1MQ6A 1DX5M 2HNTE 1VITF 1O0DH 4FVDA 4K69A 4L8NA 2R0LA 2V3HH 1IHJA 2H5CA 2IWOA 2EEJA 1BMMH 3R0FA 2H3MA 5E11A 1QAVA 2BXTH 2XXLA 1C9PA 4JK5A 1S0QA 3NPSA 1TRNA 3RXMA 1TX7A 3V7TA 3RXEA 2WPHS 9LPRA 2VPHA 1PPBH 1L0ZA 4X1NU 3SUZA 1NRSH 4B2BA 3TIUA 2J4IA 1AWHB 5F8XA 3SHWA 3UY9A 5HXFA 1C9TA 2FOMB 3RXRA 1ABJH 5F6MA 4K72A 2OUAA 4IMQA 3LJJA 3FP8E 4HTCH 2A7HA 3RXDA 2XNIA 1F0SA 1KEFA 2CF8H 1H8DH 1WAYB 2R2WU 3U9AH 1GI8B 1N6YA 2JH6D 3MU1A 2VH6A 2KA9A 1W10U 2SGDE 3KQEA 3LGIA 3VXEH 4F8KA 1EP5A 2BTCE 2AWUA 8GCHF 2EI7A 3M61U 4WWYA 3V12A 1XUKA 2BYAX 8ESTE 2VVCA 2W5EA 5DPAA 4X8VH 1Z6JH 1XUHA 2ZEBA 3ZVGA 1UVOA 2KJPA 1SGEE 2ZFTA 1MZAA 3O8RA 3V3MA 2OQSA 2FX6A 1HDTH 3S9BA 2V1WA 5C3NA 2G5VA 1VA8A 2QXHA 4WH6A 1MCVA 3GGEA 3TK5A 2ZPQA 2JREA 3K9XB 3ZZ6A 3SOEA 4YTAA 4ZUHA 4GPGA 1V2TT 1SG8B 4B73A 3UR6A 2GMTC 3U69H 3A7VA 4MLFB 1GI6A 2AH4X 2KOMA 3L3TA 1FMGA 3TK6A 1N1LA 1FUJA 4NG9H 1HPGA 3RM2H 3DJAA 1ZMLA 2BOKA 1F5LA 4Y8ZA 3BTGE 5HM2A 1MKXK 1DY9A 1K1OA 1UCYK 5EXNA 2WYJA 2KPLA 1O2LA 4O03A 4JL7A 1Z8GA 1O37A 3RU4E 3E90B 1FNIA 1C1RA 1O2SA 4WYTA 3UNSA 1A61H 1PQAA 3DJ1A 2ZPSA 4NA9H 1FN8A 5T3HA 1QNJA 1KLTA 7ESTE 5C1YA 1QRWA 1SLUB 5HDYA 1FN6A 1QAUA 1MD7A 3BTFE 4THNH 1A5GH 2KYLA 3TJNA 2P94A 2FOHA 1CA0B 3ZVCA 1GJ9B 1DWDH 1FY3A 1A4WH 2FO9A 3R69A 2QIQA 4X8TH 2EGNA 1BTUA 4HOPA 3P8OA 1O35A 2O2TA 3VQGA 2OPGA 2IOTA 1SGTA 2MX6A 3HGNA 1MFLA 1EAUA 4OGYA 2EAQA 2QN5T 1XUJA 1SGYE 1DPOA 1Z1JA 2AEIH 3GY2A 2B5TB 1IQMA 1SHYA 2HE2A 2FYRA 1OBZA 1IQGA 6GCHF 4KELA 2Z9IA 2ZHEH 1RZXA 1OWIA 2IJOB 2BDCA 3ZYDA 1AUJA 2A5IA 2LNCA 4JOJA 2FTLE 4AYVB 2VIOA 3LGTA 1QA0A 1QLCA 1TGSZ 4KKDA 1DT2A 1O2RA 5DG6A 3TNSA 2J94A 3NXPA 1N7FA 3PLBA 2Z17A 4N6XA 3TJVA 2XWAA 1ZPCA 4GCHG 1S6FA 2OD3B 3OSYA 4B2AA 2BLQA 3SJ8A 4NMTA 1LVOA 1TMUH 3R3GB 2BM2A 2EEHA 2KBSA 1QHRB 1C2FA 2ODYB 3RXIA 1ESTA 1C1VH 1YBWA 3EA7A 1QB1A 2DLUA 1P2IA 1AVXA 1YPHC 1T8OA 1A2CH 3LT3A 3RXHA 3KL6A 5EYZA 4Y7AA 1Y3WA 1IOEA 1ARCA 5DP7A 4YO9A 1A5HA 3FVFB 3B8JA 5H4IB 3SI3H 2OTVA 2CGAA 4XOJA 1H8IH 1GBKA 5DK1A 1U3BA 1GHVH 1K28D 1NFXA 2H5DA 2XBXA 2BQ6B 2PDZA 2FS9A 2OC0A 1DICA 3RLWH 2FMJA 3MH5A 1QA7A 1TPPA 3K2UA 3BG4C 1V2KT 3VPKA 1W7XH 1V2JT 2AYWA 1ZRBA 5JB8S 2PNTA 3LGYA 1XKBC 1CBWC 3A7YA 6CHAC 1WOFA 2ASUB 1MCTA 1CA8B 4B76A 3WKMA 1SFIA 2FOFA 2CF9H 3RXTA 3UR9A 2GCTC 2JETC 1EJMA 2ESTE 3BIVH 1TGBA 2RDLA 5BPEA 1OXGA 2G81E 4Y79A 3E0PB 3PWCA 2EDZA 4O06A 1EZQA 1C2EA 2CHAC 4X1PU 1SGNE 1HGTH 1HJAC 1BHXB 3A86A 1QQ4A 5G4BA 1TOCB 9ESTA 5HEDA 5FX5A 1V2NT 3E16B 1HJAB 3BEFB 2G51A 5CMXH 2K1QA 3OTPA 4JOEA 3SBKA 5DJ7A 3LONA 1S84A 4MG3A 2BD8A 2PTNA 5FCRA 1P06A 1IQJA 3SV2H 1EZXC 1UMAH 5TCCA 2NU0E 1C2HA 1NRQH 1QIXB 5HJ1A 4UU6A 1HAYB 3MYWA 2GCHF 4JZDH 4KTUA 1LKBA 1MTSA 2R4HA 3URCA 3SHAH 2ZTXA 1DM4B 1LPKB 2VWRA 1DUEA 3MH6A 3RXBA 3RMNH 4JOFA 1O5CB 1UF1A 1ANBA 1OS8A 1CBWB 2ZHFH 2KAIA 1ORFA 1JBUH 1WIFA 1WFVA 1OWHA 3VEQB 1ZTJA 4JMYA 4IS5A 3O8CA 5F8TA 1TP5A 3CBZA 2WINI 2O8WA 4MNVA 1JXPA 3ZRTA 1SGFA 1M5ZA 2P3UB 2UWLA 4OS6A 1UEZA 3RXLA 1BRAA 3UNRA 4GSOA 2I0IA 5DP4A 2Q6GA 2G2LA 3B9FH 3UREA 4A5TS 1GBMA 3A85A 1AB9B 2NWNA 2BLOA 2BDYA 2J95A 4INHA 4INLA 3K6YA 2ZDNA 2L4SA 1HBTH 1C2GA 4NIXA 4AZ2B 3RU4T 3RXPA 4H4FA 1SOZA 1AZ8A 1KWAA 3SUDA 4K8BA 1BTYA 2VVVA 1EJNA 3D49H 2IWNA 4JYUH 1D3TB 1EB1H 1YYY1 3E1XB 1G9IE 1UTJA 4FU7A 4TY6A 1BCUH 2D90A 1MMJN 3C27B 1UEWA 2JINA 1SHHB 3SNBA 1CE5A 2ZU5A 3RXGA 1N6DA 1OOKB 2ZGBH 1QFKH 3CS0A 2CMYA 2ZU3A 2ZCLP 1HAXB 3HKIB 1RY4A 2XBVA 1W9EA 3VGCB 1X5RA 1GDUA 2Q1JA 5C1UA 1GI1A 4D9QA 2P8OB 1BTPA 1JWTA 1BMLA 1O2HA 2F9PA 2GCHG 2QGRA 3UNQA 3PO1C 3AAVA 1B0EA 1MU6B 5AVDA 5B6LA 2FIRH 1IQFA 1Y8TA 1C1NA 1EQ9A 1SQOA 3A88A 1P2MA 3UWIA 1YGCH 4FUHA 1EZSC 4WY3A 3UUZA 1QY6A 1DXWA 1LHFH 1Q31A 3OY5U 1SR5C 1V3XA 4A1TA 4IMZA 2PWXA 5CHAC 4YT7H 1YM0A 1SGDE 1YPKH 2EV8A 1DXPA 1QBOA 2VWOA 3BG4B 1TPAE 3RC4A 3MFJA 4UU5A 1BFEA 4OEOA 2UWPA 1RTKA 2CN0H 3A7TA 1SSXA 1W3CA 1V5QA 5J4QA 1UTLM 2WUBA 3AXAA 2EGKA 1UHPA 1NESE 4F4OC 1O3CA 5HFDA 3I29A 1A3BH 1BTHH 2WV5A 1O2KA 1NRPH 1C5XB 2ZU1A 3OX7U 2FYQA 2AGGX 1NPMA 3UIRA 4Y76A 4F49A 1N6XA 2RCZA 2QKTA 1EP6A 4R2ZA 3NKKA 1FI8A 4Q2QA 3U1IB 1LVMA 5LPFA 1TGNA 2O8LA 1QRZA 5L2YH 1GI3A 1P01A 2SGPE 1NTPA 2V0BA 2THFB 2EDVA 1WTGH 4XBBA 3QLPH 3PB1E 1LQDB 3QE1A 2PUXB 1GBLA 1WYKA 1NFWA 1RJXB 3SU1A 1V2MT 4DIIH 1HXEH 1K1JA 2I0LA 3RU4D 1DE7H 4UFGH 2BX3A 3FANA 4FUGA 2Z6BD 3ESTA 4FVBA 3P92A 4NNMA 4GAWA 1RFNA 1GJ8B 3I4WA 1GBHA 4GCHF 1O2YA 3VQFA 3S9AA 4OAJA 1AWFH 1EOLA 4KFVA 1T31A 4NXPA 1RGRA 3TLOA 1EAXA 4ABBA 2SFAA 4DOQA 1CO7E 4I32A 2QAAA 2GV7A 2XCNA 3EA9A 3LGUA 4RSPA 5GDSH 3NZIA 4D7FA 4ISLA 3UOPA 1HAZB 2FX4A 4DW2U 4E3BA 3ZZAA 1BJUA 1GI2A 2FM2A 3P95A 4NSVA 3K65B 3UOUA 2D92A 3RUOA 4MDSA 2EI6A 2ZC9H 5A2MH 1TQ0B 1VR1H 5DTHA 2HPPH 1C1MA 1GJDB 3EGKH 2FOAA 2VGCB 2H3LA 2XC0A 4LK4A 3QIKA 3CBYA 3JZ1B 3SNCA 2FOBA 2ZDMA 1DSUA 1MTNC 2G00A 3RDZA 2F3CE 2PR3A 4E06H 3Q3XA 1O3GA 2BXUH 1C4U2 3QZRA 1O34A 2RCEA 2ZG0H 3RL7A 2ZFRH 2QKVA 1KYNA 3BSQA 3SGAE 2A7JA 5HGGA 2EEGA 1W9OA 3BTWE 5L2ZH 3NFKA 1LQEA 2WPLS 2A4RA 2XTTB 4IC6A 3TNTA 3SUGA 4NXRA 2SNWA 1TIOA 2Y80A 3SU5A 2A4QA 3KN2A 2PW8H 4LMMA 4AX9H 2DE8A 4I7YH 4NWKA 2ULLA 1OWEA 5GJ4B 2ZNKH 3RP2A 2QT5A 1IQLA 3WY8A 3Q3KA 1SGQE 3RXCA 2V35A 1OPHB 1V6DA 1C5PA 1NFUA 1F92A 4FXGH 5GXPA 2ZI2H 1AIXH 4AYYB 2FCFA 1LTOA 1XUFA 2AERH 3ODDA 3ZZ4A 3S7KB 1IU0A 1EPTB 1V2ST 3ZVFA 1LMWB 4CRFA 3SV8A 1Z6EA 1V5LA 2ODPA 2ZF0H 2BB4A 1IQEA 1GHBG 1O2VA 1QTFA 1WV7H 1PQ7A 2KAIB 1THPB 4OS4A 2M10A 1BIOA 1PQ8A 3MH4A 1AU8A 1O30A 1O2MA 8GCHG 3Q00A 1AD8H 1UVTH 1V2LT 2BDIA 4K78A 2EI8A 1GJCB 4UDWH 3RXKA 2OQ5A 4ZKSU 3U8OH 1ZHPA 5J4SA 2I6VA 2Z94A 1Y3UA 4WYUA 1AY6H 3SHUA 1G3DA 3TH3H 4CBNA 1E37B 3KIDU 3SJIA 3NWUA 5LGOA 2EXGA 2ANYA 2OBOA 4DCDA 2YNBA 4GHQA 4YLUA 1F0RA 1YPMH 4CRGA 5A8XA 2ZHDA 2PSXA 2CHAB 3LGWA 3SV7A 1AE8H 1P3EA 1ZZZA 1C5QA 2Y81A 2ENOA 1Y5AT 1G37A 1OX1A 1XUGA 2LA8A 1AKSB 3R0HA 2ZFSA 1BMAA 3A7XA 3TGIE 2BY8X 4YZUA 1IQNA 1TOMH 2PKAB 2A0QB 2Z7FE 1W0ZU 2R0KA 1QR3E 3T29A 3LPRA 4ZKNU 1IHSH 1ABIH 2ZECA 1MAXA 4K60A 3RXUA 1QRXA 4YYXA 1CSOE 2ZCHP 3DT0H 2XWBI 1U38A 4OS1A 5EXLA 4RI0A 1UK3A 3GDSA 2LC6A 3PV2A 2ZDLA 1HAVB 2VGCC 3UWJH 2DAZA 1Q7XA 4X0WU 1HNEE 2ZO3H 4LZ1H 3UQOA 2AMDA 4UONA 1XXDA 1ID5H 3GCTF 1AGJA 3M36A 1LCYA 1GQ4A 4FUJA 1HCGA 2RA0A 4XDEA 2V3OH 3K50A 4XHVA 4PROA 1BRCE 4I33A 4UFFH 3W95A 4FUIA 1GI5A 1TABE 2A2XH 3QTVH 1PFXC 2JH0D 4JCNA 2G5MB 1DS2E 3EDXB 2DKRA 2CS5A 2W3KA 3LIWA 2EA3A 3PDVA 1Y5UT 1C2IA 1UVUH 3S7HB 2BD2A 1NU9A 2KPKA 2A2QH 3QDZB 2J38A 1P2QA 5EOKA 4GVDA 2PKUA 3A84A 1A0JA 1E38B 2AMPA 1FZZA 3GOVB 4AFZA 4ZMAH 5HFCA 1UCYH 3ID3A 1TRMA 4O97A 1N7TA 4U01A 4DIHH 4E35A 1O2PA 4HGCA 1UTOA 4IGDA 3SJ9A 5PTPA 2QY0B 4OS2A 2BHGA 2VH0A 4JOKA 3QGNB 2W26A 1LHDH 1O2OA 4BXWA 1SLXB 1SQTA 3H7OA 3ZZBA 1CU1A 2OS6A 1WBGB 5FAHA 3I78A 3KZEA 1CQQA 3ZVBA 4K1EA 3M5OA 1ELAA 1GHAF 4REYA 1MBQA 2HRVA 5FX6A 4AB8A 2Z3EA 2G4TA 3ATIA 3AASA 2VSPA 5F3XA 4OS7A 5I25A 1HJ8A 5DO4H 3M7UA 4CR9A 1CHOG 1ELDE 1C2KA 4YOIA 1H1BA 5C2ZA 1HB0B 4BTTB 5GWZA 2F0AA 2M0ZA 3T26A 1F0TA 1TX8A 4NMOA 5G1EA 1IQKA 2VZ5A 1O39A 1D6RA 1SB1H 5DP3A 4AOQA 1MKWH 2GX4A 5T6GA 1Q3PA 1IQHA 2TGTA 1VITG 2AIPA 1XVMA 2Z9LA 2FESH 3DIWA 1ZTKA 2VINA 1P1DA 4ABAA 3RLYH 1F5RA 4BOHA 1ELCA 1GVZA 1BT7A 3L6PA 1YPLH 2WUCA 2GV6A 2ZP0H 1O5BB 4MNXA 2ILNA 3KHFA 1D5GA 2PKSC 2YNAA 1B7XB 2SGFE 3MU4A 2PGQB 4MNYA 3FFGA 3QN7A 3O8DA 3F68H 3M5NA 1IHTH 2JXOA 1ZSJA 5F03A 3OTJE 4UD9H 1CGJE 4B75A 2BDHA 1O2TA 3GY8A 1IAUA 2Y82A 3GCOA 1OP2A 2ZHWH 4WMDA 2OCSA 3E6PH 1WF7A 4Q80A 2ZTZA 3SFJA 2GDEH 5BRRE 1CHOF 1KTSB 3A83A 4NFEA 1EX3A 2AIQA 1MD8A 1FAKH 5AFYH 2Y7XA 2EDPA 5C5OA 1J14A 2I4SA 5FCKA 4EDJA 4CRAA 1ZJDA 3KNXA 3BTTE 1W11U 4XFQA 4DURA 1QJ1B 1P05A 2AGIX 3PM3A 5TJXA 1QGFA 1O3PB 3MU8A 3SU6A 4YLQH 1L6OA 4AN7A 4X6NA 1TMTH 4Z8JA 1ELVA 1WSSH 3JZ2B 1KXAA 2JKHA 4IN2A 4A1VA 1V2VT 2Q6FA 3SUEA 5GCHF 1GHZA 1C4Y2 5HFFA 3GCHC 3M5LA 4BAKB 1GVKB 1BQYA 3FAOA 1CVWH 2ZCKP 4OEPA 2DLSA 1VCPA 2F91A 5ESTE 1Z1IA 3M37A 1BA8B 3RXQA 1XKAC 2OGPA 4BTUB 1MU8B 1BB0B 1TAWA 2FLRH 3VFEA 5JXBA 1CHGA 2FNEA 5HETA 1QURH 5DKMA 2FLBH 2KOHA 3KQDA 2OINA 4KP0A 3ZZ7A 1I16A 1WI4A 1O3NA 2PKTA 4Q6SA 4B2CA 4I8LA 1EATA 2UUKB 1T4VH 3ZZ3A 2Z3CA 1TALA 4E7NA 2O8TA 1XXFA 3FY5A 4WJG2 1C1TA 3P8NA 1NU7B 3I18A 1NM6A 2VB0A 1UTPA 2QYIA 3VGCC 1N7EA 2LC7A 3LC5A 2PSYA 4Y6DA 1FJSA 1WU1A 2F9OA 1GCTC 1ANDA 2J34A 1GHAG 4FUDA 1ANCA 3NCLA 1ZRKA 3Q77A 1ZHRA 4Y8YA 1J16A 1D3DB 2TBSA 4FUEA 6LPRA 4I8KA 2CSJA 2G55A 3P70B 4AGKA 5JBTA 4HI3A 1OKXA 1K22H 1K32A 3MWIU 4B71A 1INCA 1P10A 2C4FH 1PPCE 1RTFB 4X1RU 1MKWK 2HE4A 3RMMH 2E7KA 1FQ3A 4NWLA 1GBFA 2A1DB 1UO6A 5HF4A 1C1WH 1Q2WA 1ZOMA 4FU8A 4MTBA 4TYDA 4Y71A 4BAMB 3TGJE 1EAWA 2IWQA 1J17T 2VNTA 3A8CA 1WUNH 3SU2A 2D8IA 4NMQA 2B0FA 4K1SA 2YT8A 1ZLRA 3A89A 1S5SA 2QXGA 3DFLA 3MU0A 1L4DA 1C1PA 4AFQA 3E91A 1JIMA 1V2QT 2UWOA 1Z8IB 2G52A 4ABGA 2K20A 3D65E 1WI2A 1DFPA 1YPEH 1ZYOA 3RMLH 4P0CA 1KSNA 1OWKA 3H5CB 3F9GA 1K1LA 3LU9B 3GY3A 4AG1A 4ZXXH 3A80A 3DJ3A 1XM1A 4UFEH 1I92A 4XBDA 1G3EA 1V2PT 1AZZA 3IWMA 3AW0A 2EEKA 5JBBS 2OMJA 2BOHB 1O3OA 1KIGH 2LPRA 1FPCH 2D2DA 1G3BA 2A45B 5JB9S 2ZA5A 2Z9KA 3F1SB 2A4OA 3V13A 1DWBH 4BAHB 3M3SA 4WH8A 1LPGB 1NC6A 1O31A 5LPRA 1XMNB 1T8LA 3MNSA 5HEBA 1P2JA 2P93A 2BD5A 3MNXA 1TNIA 2JIKA 3QGLA 1O38A 1NS3A 1GBJA 3MHWU 3TU7H 1UCYE 1G2LA 2P59A 2PUQH 1V2OT 4Q3HA 1XUIA 1FXYA 1JRTA 4H11A 2OCVB 2QA9E 3Q3YA 5JPMH 2DJTA 5A0AE 1GBTA 2F9BH 3GYLB 5A8YA 4NA8A
chains in the Genus database with same CATH superfamily
1CGHA 2H1UA 1F0UA 1NTEA 1T32A 1AKSA 3SO3A 4ABIA 3PLKA 1O3BA 2FDAA 4JYTA 2JWEA 2PKAA 8LPRA 4YDPA 4I8HA 2IPHA 1A7SA 5L6NH 2Z9GA 4ZAEA 1GMDG 3GYMA 4X2WA 3ODFA 3GY5A 1MTWA 2G4UA 1GHXH 3LOXA 2D26C 1JRSA 5E0JA 1EAIA 3SHCH 1DLEA 1VGCB 1AO5A 5A0CA 3PMHB 1GVLA 4WXIA 1TRYA 4ABHA 1G9OA 3OAAD 1UFXA 2LOBA 4BANB 3NK8A 1O2WA 1GQ5A 1WJLA 1C5VA 2K1ZA 1QL9A 2WYGA 4I8JA 2F4LA 5FBEA 3BN9A 3DD2H 5EZ0A 2PV9B 1C2LA 1X7AC 4NZQA 1ELGA 5C67A 3JXTA 4ABEA 2ALPA 6GCHG 5KEDA 1O3IA 1PDRA 2KOJA 4NMSA 2XOKD 4ZHAA 1O3LA 2ZGJA 4DT4A 2O9QA 2STAE 2Y5FA 1O5DH 2GTBA 1TNHA 1EKBB 1QQUA 2VRFA 2R9PA 1W13U 2OZFA 1QJ6B 1ZJKA 3BTHE 3LNXA 2QBWA 3MU5A 4O3UA 1AFQB 1UM7A 1O2ZA 2OQUA 3LH1A 3EGHC 4CH8B 5L30H 3N7DA 1CT4E 3STIA 5HKKD 1OWDA 1OSSA 1VJ9U 2XC5A 1P2OA 1DUAA 1UK2A 1GCTB 1TX6A 2ZGHA 3SN8A 1THRH 2V6NA 3LC3A 4WMEA 1MTNB 3QTOH 1YPJH 1TYNA 2JILA 1P02A 1TPSA 2ZDAH 1U6QA 1EXFA 3A7WA 3MQKC 1UITA 1VB7A 4MPAA 1KY9A 5C20A 5EIYA 2UZCA 4OGXA 4NIWA 1JOUB 1GI4A 3TSZA 3WKLA 2I6SA 3F9FA 3PROA 1X6DA 1C5OH 5E1YA 1GJ4H 1FDPA 2QF0A 4XBCA 2RRMA 2XC4A 4X2XA 2IWPA 5ESBA 4U2WA 1N6FA 5LPEA 3EGGC 2VSVA 1TBZH 1O3FA 1MTVA 1AHTH 3LNYA 2RG3A 2XBYA 3M5MA 3SGBE 4KTSA 2PTCE 4X1SU 1GHBF 2BZ6H 2OSGA 1N8OC 1A0LA 2YOLA 2BY5X 1AFQC 3MO9A 5C0TA 2NU4E 1V1TA 2FE5A 5E0GA 1P2NA 2BY6X 1C2JA 1UJ1A 1P09A 3KDKA 1CT2E 1DDJA 1MBMA 1GJAB 3NFLA 3BEIB 4DT7B 3L4FD 3BF6H 1P03A 4AORA 1C5UA 1T8NA 4NGAH 5FBIA 5A8ZA 1FY5A 1GMCF 2BLWA 1X45A 3O46A 2A4GA 1GGDB 2GVFA 1XVOA 4CRBA 3P8FA 2AWWA 4K75A 1ZSKA 4DGJA 3CH8A 1HIAA 2FOEA 2WPIS 4Q2KA 3ZVAA 2ZDVH 2WPMS 3D62A 4AG2A 3K82A 4NXQA 3KHVA 3BEUA 3K1RA 3MO3A 1MKXH 4QT8C 3O8BA 4KFWA 4Q2NA 1E34B 3Q76A 1VJAU 2YUYA 2W4FA 3TPIZ 4X6PA 2BQWB 2BZAA 2PHBA 2P3WA 1GG6C 1S6HA 3HPTB 4ISHH 4Z33A 1C5RA 2BVSH 1C1UH 2F5YA 1EOJA 1U39A 1Z8JB 3E0NB 1TFXA 1GMHG 3ID1A 1ELBA 3FKSD 2B8OH 3GICB 2ZPRA 1C1QA 3GDVA 2ZPMA 3ELAH 1KXEA 4F55A 3TJUA 2RA3A 3OU0A 1P9SA 2QXJA 1KDQA 1N99A 1QL7A 1RS0A 1D3QB 2IN2A 2PGBB 1AN1E 2AS9A 2KRGA 4A1XA 4I31A 1TGTA 3BG8A 3PV4A 2R3YA 4NIYA 4DJZB 1Z7KA 4MVNA 3MTYA 4K3JA 1HV7A 3GY6A 2KAWA 2BQ7B 1E35B 1AFEH 1YC0A 5DP6A 2WV9A 3B23B 1GBCA 3D23A 1EZUC 2ALVA 3SOSA 3SZNA 4PQWA 1O2NA 3E8LA 3C1KA 1FC6A 4MPVA 2BMGB 3RXSA 1WHAA 2P3FH 3ZZ8A 1ARBA 3ATMA 4AGJA 2D8WA 2P3TB 5ETXA 3TGKE 4X2YA 1H9LB 2KG2A 3IITA 1RRKA 1OP0A 1OP8A 4INKA 2XW9A 1LKAA 1MZDA 5EG4A 3ZV9A 3TH2H 1MFGA 1A3EH 1AUTC 2C8YB 4D8NA 4VGCC 1BBRK 1U37A 3BTEE 3KGPA 2J5UA 2LELA 2RDEA 4BAOB 1SLVB 5B6OA 1J15A 5T6DA 2W7SA 3LGVA 2A31A 2EC9H 2TIOA 3P8GA 3U8RH 3R68A 1J9CH 1O3JA 2VBCA 4ESTE 1FAXA 2HNTF 4ASHA 1O3MA 1EUFA 3PLPA 4ISNA 1NROH 4IBLH 4DY7B 1B8QA 5HMAA 1WHDA 3MOCA 1YCPH 4Y0YE 1E79D 3S69A 4TY7A 1O2UA 2DB5A 2QCYA 1YCPM 1Q3OA 1K2I1 1ZHMA 3A82A 5E6PB 3GCHB 1W7GH 1HAVA 3SNDA 5F8ZA 2ANWA 2ODQA 3N99A 3SI4H 2GZ8A 3A7ZA 1P0SH 1KDQB 3CENA 3QDOA 1O5FH 2REYA 1TPOA 1EB2A 2W3IA 3GY4A 3CBXA 3M3TA 1GBEA 1ETTH 3U8TH 2HVYB 1YF4A 2YTWA 3QZQA 2FZZA 1G32B 3QJNA 1GI7B 1O36A 3E17A 3GDUA 1T7CA 3LJOA 2C8XB 2JIZD 3GSLA 2NU1E 2VU8E 3GCTG 3CP7A 3DFJA 4K5ZA 1TLDA 4NMVA 1KXBA 4AB9A 4TWWA 4A6LA 3RXVA 2J2UA 4RT1A 5JYIA 1W2KH 4K6YA 1O3KA 1TQ3A 1LHGH 2D1JA 4UE7H 4Y11E 3I1EA 2CJIA 3PTBA 2C90B 1Z71A 3G01A 1W9QA 3VB6A 2VWNA 1KXCA 1SC8U 4ACBA 1QZ8A 2ANKH 1C5MD 4MPUA 2FXRA 4ABJA 1Y3VA 2SGQE 1T2MA 3PTNA 1X5QA 1F7ZA 4Q2PA 1TBRH 1S83A 3ID2A 2ZPLA 4Q7YA 1BOQA 2PKSB 2JETB 3KEEA 1QBVH 3T2NA 4TWYA 3ATLA 3PRBA 3VB4A 2TGDA 4GLYA 2OBQA 1FLEE 1QJ7B 4P00A 2A5AA 1NFYA 1PJPA 2M5TA 1KLJH 4IW4E 3QWCH 1ZSLA 3F9EA 2VIWA 4JOHA 1K1NA 2LUIA 1SGIB 1KXFA 5JDUB 3UQVA 1NN6A 1O32A 2W7RA 4YT6H 1ELTA 1HXFH 2FS8A 1HIAB 3SU3A 5B42A 5HYOA 4ZHLU 2FI5E 5E22A 2M3MA 3EAJA 4ZXYH 4K1TA 2G5NA 4TPIZ 1B5GH 1V2WT 1ZGVA 2P16A 1T4UH 1FIZA 2Q6DA 3FP6E 4NMRA 4RKJB 5EGMA 1GG6B 3HPKA 2AWXA 1TE0A 4M7GA 3WW7A 4IN1A 1NO9H 3TH4H 2O8UA 3URDA 4YM9A 4JOGA 4ZROA 4RN6A 4GUXA 2Y7ZA 3SGQE 3SORA 3HPMA 2TRMA 4ASUD 1LHEH 1UK4A 1O2IA 5DP5A 3T28A 2FN5A 2OLGA 3DUXH 1UJDA 2TGPZ 1E36B 4FOUC 7LPRA 1BBRE 1O5EH 1BTXA 3RXFA 2R3UA 4NIVA 2QC2A 3RXAA 1GJ7B 3OE7D 4Z1MD 1VZQH 1UEPA 4B74A 1P3CA 1PYTD 2PA1A 2STBE 2QV1A 3P6ZB 4KTCA 4NZLA 1G3CA 1AVWA 2FI4E 3SYJA 3T62A 4CRCA 5E2OA 4NA7A 4NFFA 2ZQ2A 3M7QA 1NRRH 1WTHD 1GM1A 2HGTH 2BLVA 4P2AB 2KM0A 1C5WB 1D3PB 4FGMA 3NGHA 1X5NA 2GDDA 1SLWB 3DA9B 4GVUA 1ZOKA 1ZMNA 2H9EH 1BE9A 2ZZUH 1GWAA 2J9NA 3BIUH 3KF2A 5IYTA 1UW7A 2BY9X 3ZVDA 3CYYA 2JH5D 1C5ZB 1WCZA 1Y5BT 1ESAA 4Z0KA 3FP7E 5GNDA 2KV8A 2ZFFH 5JBAS 1C5LH 4WF8A 3MH7A 1PPGE 4D76A 7GCHF 1CA0C 1YCPK 3PMAB 5IK2D 4X8UH 2H2CA 1QCPA 3A87A 1F5KU 1PPFE 1VCQA 3NUMA 4WMFA 4DVAU 1P04A 1TA6A 2Y5HA 1FY1A 3PO1B 1HLTH 3ATKA 1K1PA 4NCYA 3ITIA 1C4V2 4H6SB 1TBQH 2W7UA 2BY7X 3AVZA 3O5NA 1T8MA 2QKUA 2PLXA 2KCOA 4CH2B 3F2HA 4E7RG 2UUFB 2OC7A 1MQ5A 4AFSA 2C8WB 2WPJS 2ZHQH 2GT8A 4IC5A 4HFPB 1S0RA 5TCAA 1YPGH 3EA8A 1BTZA 3M3VA 2VWMA 1SMFE 1ZTLA 4FUCA 1ESBA 1MUEB 1C2MA 2KCYA 2XRCA 3H09A 2NU2E 3HK6B 3ID4A 3UFAA 5HM9A 1AMHA 4ZHMU 1RTLA 3ZYEA 2GMTB 1AVGH 3KCGH 1Z87A 1LVYA 3E3TA 2P8OC 5E21A 2FODA 2VIVA 5K0HA 1BTWA 1PYTC 1UEQA 1DANH 3FZZA 4DG4A 2O8MA 2P95A 2H6MA 4H42U 5I46H 3PV5A 4E05H 2GT7A 3B76A 4NSYA 5EPNA 1XX9A 2BYGA 5C0UA 3TVJB 3PS4A 3M35A 5H3JA 1YLCA 4D7GA 4ABFA 3SV9A 1GMHF 1MC7A 2C3SA 1MABB 1DWEH 3EQ0H 1UTKA 5E8EH 1RGWA 1GI9B 2FPZA 4FU9A 1QBNA 4WVPE 1W0YH 2XCFA 3EYDA 1Y3XA 3S0NA 4BTIB 1UTNA 3KQBA 3T5FH 1AQ7A 2ZKSA 1GCDA 4X6MA 4YESB 1NRNH 3KZDA 3ZVEA 4HZHA 2VIDA 2AINA 1C5SA 3BTME 5A0BA 2F83A 3OYPA 1EPTC 1MH0A 2C8ZB 3GS9A 5EW2H 2F9NA 1M9UA 2OC1A 4K2YA 1GL1A 3HGPA 1NZQH 5C1XA 3QJMA 1C1SA 1L2EA 4NMPA 1GJBB 2J92A 1GMCG 1AI8H 1BRBE 5E0HA 1NT1A 1V6BA 1BUIA 3RC5A 1FONA 5CHAB 2JOAA 3U98H 4GHNA 5K7RA 2L74A 1ZPZA 5HFEA 3QGJA 2OP9A 4JZFH 4ISIH 1UHBA 1VAEA 2QXIA 1GDQA 2XBWA 3VB5A 2ZU4A 2H9HA 1RIWB 4D9RA 3BV9B 3KQ5A 2ZGXH 3UTUH 1O2JA 3UPEA 1OWJA 4BNRA 4RKOB 2BDGA 2F9VA 5DN6D 1SGCA 1UJUA 1Y59T 1ZR0A 3QUMP 1ACBE 3S9CA 2KQFA 1PPEE 1CT0E 3F6UH 1RIWC 1SGRE 1P11E 3AAUA 3CS7A 1P57B 3PMJA 6CHAB 2GD4B 3W1EA 1DSTA 1G2MA 1HAPH 1KXDA 4XE4A 1SVPA 1W12U 5GIBA 4ZKOU 1K9OE 4MQAA 1F2SE 2DUCA 3TMHA 4OS5A 1ELEE 3ZIAD 3SUFA 2H2ZA 1C1OA 1SGFG 1TNJA 4Q6HA 4H6TA 4BXSA 1UTQA 7GCHG 2UUYA 1ELFA 5C5NA 1Y7NA 1S81A 1FV9A 5GCHG 3LKWA 1THSH 1O3AA 4Y7BA 2FEQH 1SQAA 2ZGCA 3SJOA 3A8DA 2L4TA 4YOGA 5EW1H 1ETRH 1FC7A 1VJ6A 1WQVH 2WV4A 2CV3A 2I6QA 1PPZA 4U32A 1NBMD 4K76A 3ZZCA 1BHXF 1TQ7B 2M0TA 1O2QA 3VB3A 2GZVA 5DP8A 5AF9H 1LPZB 3NCVA 2CSSA 2GZ9A 1WH1A 1HAOH 2C93B 1WFGA 1P9UA 1UVPA 2HGAA 3TSWA 3A81A 1C5YB 2QF3A 4YOJA 3L33A 3U1JB 5HEYA 2EJYA 4UFDH 1ZUBA 1ZPBA 3STJA 2OXSA 5EQQA 2A7CA 2M0VA 1EPTA 2JJ2D 1V2RT 3V0XA 1SPJA 2DMZA 2I04A 1O2XA 4CREA 3RM0H 1WQSA 3RXOA 3SU4A 3SV6A 1TNLA 5IDKA 1ANEA 4VGCB 2ZFQH 1WF8A 3MMGA 4XSKU 3CNRA 2EGOA 1FY8E 2Y5GA 4B1TA 1VGCC 1S82A 3PYHA 4X2VA 1W14U 1A46H 2FP7B 4HOPB 3OY6U 1K21H 1MTUA 1GJ5H 2L97A 4I8GA 3SNAA 3DORA 1G30B 3MO6A 3ZV8A 2Q3GA 1BMFD 1X8SA 4WXVA 5FPSA 4MPXA 3ZZDA 2BD7A 1TNGA 2SGEE 1UM1A 3SJKA 1SOTA 3I77A 1N8OB 5A09A 5EJ1A 5GLJA 5SGAE 3TSVA 1ZMJA 2A32A 2BVXH 1YBOA 3SQEE 1QB6A 2FOGA 1COWD 4K8YA 4Q4LA 3ZZ9A 4A7IB 1BMNH 2KJDA 1GHYH 2DE9A 5FPTA 4BAQB 1Z8RA 3H7TA 1HYLA 1GBBA 5EXMA 3PDZA 3F9HA 1QB9A 3VB7A 4CRDA 1B0FA 2BVRH 2G8TA 5A2PA 4E34A 1S85A 4ISOA 3AW1A 2GKVE 6ESTA 1FCFA 2EHRA 3W94A 1GPZA 2MHOA 1V2UT 1HFDA 1C5NH 1YP9A 2V7QD 2KJKA 1L1NA 5EODA 1O5GH 1FC9A 2FWWA 1HAIH 2GEFA 4ZKRU 4ACAA 1N6EA 1DLKB 4AMHA 1TP3A 3EE0B 4J1YA 2WL7A 3NRLA 1SBWA 1TWXB 2KX4A 2V90A 1X9ZA 1UJVA 5FHTA 3RLEA 1DY8A 1GBAA 2YT7A 1K1MA 1HUTH 3MNCA 2EEIA 1QAVB 1C2DA 1J8AA 1E0FD 3SNEA 2BDBA 1VITH 1OYTH 1UVSH 1A0HB 1OBYA 1FX0B 2H9TH 5FXLA 2TGAA 4Y8XA 2FOCA 3GCNA 3CC0A 5JBCS 2HOBA 3BTQE 1H4WA 1P8VC 1DITH 4JJ0A 2AMQA 2B9LA 3PWBA 1GGDC 1D6WA 3KQCA 4FUBA 2VJ1A 1SI5H 3QX5H 1BBRH 1D4PB 3SW2B 1P1EA 5HFBA 3LH3A 3SU0A 4AFUA 1LO6A 2K0QA 1E1QD 2Z3DA 4JZEH 1HAHH 3RC6A 2BDAA 2Z9JA 2SNVA 2GP9B 1RXPA 4Q2OA 2F9UA 5ABWA 2VVUA 2OC8A 1OBXA 1TNKA 4CR5A 5DP9A 4CBOA 2KCAA 3ATWA 3A8AA 5DGJA 5EPYA 1RD3B 2AFQB 4GVCA 5EU8A 1YKTA 1IU2A 3HVQC 4LOYH 1O3DA 2PZDA 4Q7ZA 1W8BH 2HPQH 1L1GA 1L4ZA 2BD4A 1PQ5A 4SGBE 2WPKS 2H2BA 1O3HA 4A92A 4ZH8A 1ZGIA 3PMBB 1FIWA 2HVXA 2XYAA 1XZ9A 2HWLB 3GJ9A 4LXBH 1VCWA 4O9VA 2HLCA 1HAGE 1ETSH 1TB6H 1YLDA 1GI0A 2ZDKA 4JZIA 1G36A 4SGAE 5CE1A 5E2PA 2BX4A 1C5TA 1GBIA 2GZ7A 3K6ZA 1IQIA 2Y6TA 2KL1A 1FPHH 1GL0E 2I1NA 1TA2A 1BRUP 2AGEX 3TITA 1GBDA 1SL3A 4FUFA 4X8SH 1GDNA 2ANMH 2GGVB 4CHAB 2QF4A 2ZTYA 2R2MB 5FB8C 1H9HE 1SGPE 1P12E 5LH8A 3VXFH 4ABDA 3HATH 1CGIE 1NY22 3DHKH 1AB9C 4KGAA 1JIRA 2NU3E 4NNLA 1TGCA 4MNWA 4TPYA 1K1IA 5I7ZA 3MI4A 2ZFPH 2CXVA 4FETA 1A5IA 5F67A 2ZQ1A 1WG6A 3FO8D 2FI3E 3BTKE 2DC2A 1S6LA 4U30A 1UTMA 2BD3A 1HRTH 5D13A 1BDAA 2HNTC 5T6FA 2ZU2A 5G1DA 2VIPA 3P17H 3T25A 4JK6A 4LZ4B 1O5AB 3M7TA 4UEHH 4X1QU 5HF1A 3RXJA 1GHWH 3BTDE 1D9IA 1QL8A 2BD9A 1KLIH 4JZ1A 1LVBA 3RMOH 1O3EA 2V3MA 1SFQB 1SQRA 1BZXE 3IG6B 4R0IA 5AHGH 3SQHE 4Y10E 1DVAH 4JYVH 3TJOA 1TONA 5FPYA 1BITA 3HK3B 8KME2 1YPHE 2A5KA 2TPIZ 1OZIA 4G69A 2PFEA 5AFZH 5GPIB 1BJVA 2VWLA 4R8TB 1Y3YA 1UHBB 1R6JA 2QG1A 1O2GH 1V62A 1A1RA 5EQSA 2X7ZA 3T27A 2ZIQH 1LDTT 2YUBA 3QO6A 4JORA 2UUJB 3TK9A 3BPUA 1FY4A 4X6OA 4Y0ZE 4O3TA 3FZDA 1JMOH 1AE5A 1HJ9A 3HKJB 2KZ4A 7KMEH 5EJLA 1W0KD 2SGAA 2VIQA 4Z6AH 1P2KA 3A8BA 3ENSB 4J2YB 1GJ6A 1KTTB 3MNBA 1EASA 5EQRA 1MAYA 1EJAA 1RGQA 3GY7A 3N7OA 2B7DH 1H9IE 1LHCH 4JOPA 4GHTA 2DM8A 1O33A 1Q3XA 3GISB 4CHAC 1TMBH 3LDXH 3ZZ5A 3RL8A 1L1JA 1PPHE 2Q9VA 2ZWLH 1K0HA 1OYQA 2GCTB 1DWCH 3QK1A 1Z86A 2HALA 2M0UA 1GMDF 2FTMA 4MPWA 1NF3C 4Q7XA 1DOJA 1MQ6A 1DX5M 2HNTE 1VITF 3KDGA 1O0DH 4FVDA 4K69A 4L8NA 2R0LA 2V3HH 1IHJA 2H5CA 2IWOA 2EEJA 1BMMH 3R0FA 2H3MA 5E11A 1QAVA 1EFRD 2BXTH 2XXLA 1C9PA 4JK5A 1S0QA 3NPSA 1TRNA 3RXMA 1TX7A 3V7TA 3RXEA 2WPHS 9LPRA 2VPHA 1PPBH 1L0ZA 4X1NU 3SUZA 1NRSH 4B2BA 3TIUA 2J4IA 1AWHB 5F8XA 3SHWA 3UY9A 1W0JD 1C9TA 5HXFA 2FOMB 3RXRA 1ABJH 5F6MA 4K72A 2OUAA 4IMQA 3LJJA 3FP8E 4HTCH 2A7HA 3RXDA 2XNIA 1F0SA 1KEFA 4F48B 2CF8H 1H8DH 1WAYB 2R2WU 3U9AH 2PP6A 1GI8B 1N6YA 2JH6D 3MU1A 2K8IA 2VH6A 2KA9A 1W10U 2SGDE 3KQEA 3LGIA 4HG6A 3VXEH 4F8KA 1EP5A 2YMSD 2BTCE 2AWUA 8GCHF 2EI7A 3M61U 4WWYA 3V12A 1XUKA 2WZQA 2BYAX 8ESTE 2VVCA 2W5EA 4XD7D 5DPAA 4X8VH 1Z6JH 1XUHA 2ZEBA 3ZVGA 1UVOA 2KJPA 1SGEE 2ZFTA 1MZAA 3O8RA 3V3MA 2OQSA 2FX6A 1HDTH 3S9BA 2V1WA 5C3NA 2G5VA 1VA8A 2QXHA 4WH6A 1MCVA 3GGEA 3TK5A 2ZPQA 2JREA 3K9XB 3ZZ6A 3SOEA 1H8HD 4YTAA 4ZUHA 4GPGA 1V2TT 1SG8B 4B73A 3UR6A 2GMTC 3U69H 3A7VA 4MLFB 1GI6A 2AH4X 2KOMA 3L3TA 1FMGA 3TK6A 1N1LA 1FUJA 2WPDD 4NG9H 1HPGA 3RM2H 3DJAA 4P02A 1ZMLA 2BOKA 2JSNA 1F5LA 4Y8ZA 3BTGE 5HM2A 1MKXK 1DY9A 1K1OA 1UCYK 5EXNA 2WYJA 2KPLA 1O2LA 4O03A 4JL7A 1Z8GA 1O37A 3RU4E 3E90B 1FNIA 1C1RA 1O2SA 4WYTA 3UNSA 1A61H 1PQAA 3DJ1A 2ZPSA 4NA9H 1FN8A 5T3HA 1QNJA 1KLTA 7ESTE 5C1YA 1QRWA 1SLUB 5HDYA 1FN6A 1QAUA 1MD7A 3BTFE 4THNH 1A5GH 2KYLA 3TJNA 2P94A 2FOHA 1CA0B 1NBME 3ZVCA 1GJ9B 1DWDH 1FY3A 1A4WH 2FO9A 3R69A 2QIQA 4X8TH 2EGNA 1BTUA 4HOPA 3P8OA 1O35A 2O2TA 3VQGA 2OPGA 2IOTA 1SGTA 2MX6A 3HGNA 1MFLA 1EAUA 4OGYA 2EAQA 2QE7D 2QN5T 1XUJA 1SGYE 1DPOA 1Z1JA 2AEIH 3GY2A 2B5TB 5DSFA 1IQMA 1SHYA 2HE2A 2FYRA 1OBZA 1IQGA 6GCHF 4KELA 2Z9IA 2ZHEH 1RZXA 1OWIA 2IJOB 2BDCA 3ZYDA 1AUJA 3F0PA 2A5IA 2LNCA 4JOJA 2FTLE 4AYVB 2VIOA 3AK5A 3LGTA 1QA0A 1QLCA 1TGSZ 4KKDA 1DT2A 1O2RA 5DG6A 3TNSA 2J94A 3NXPA 1N7FA 3PLBA 2Z17A 4N6XA 3TJVA 2XWAA 1ZPCA 4GCHG 1S6FA 2M2AA 2OD3B 3OSYA 4B2AA 2BLQA 3SJ8A 4NMTA 1LVOA 1TMUH 3R3GB 2BM2A 2EEHA 2KBSA 1QHRB 1C2FA 2ODYB 3RXIA 1ESTA 1C1VH 1YBWA 3EA7A 1QB1A 2DLUA 1P2IA 1AVXA 1YPHC 1T8OA 1A2CH 3LT3A 3RXHA 3KL6A 5EYZA 4Y7AA 1Y3WA 1IOEA 1ARCA 5DP7A 4YO9A 1A5HA 3FVFB 3B8JA 5H4IB 3SI3H 2OTVA 2CGAA 4XOJA 3OEHD 1H8IH 1GBKA 2XNDD 1U3BA 5DK1A 3UB0A 1GHVH 1K28D 1NFXA 2H5DA 2XBXA 2BQ6B 2PDZA 2FS9A 2OC0A 2QF5A 1WXRA 1DICA 3RLWH 2FMJA 3MH5A 1QA7A 1TPPA 3K2UA 3BG4C 1V2KT 3VPKA 1W7XH 1V2JT 2AYWA 1ZRBA 5JB8S 2PNTA 3LGYA 1XKBC 1CBWC 3A7YA 1YWUA 6CHAC 1WOFA 2ASUB 1MCTA 1CA8B 2CK3D 4B76A 3DCLA 3WKMA 1SFIA 2FOFA 2CF9H 3RXTA 3UR9A 2GCTC 2JETC 1EJMA 2ESTE 3BIVH 1TGBA 2RDLA 5BPEA 1OXGA 2EY4C 2G81E 4Y79A 1WDIA 3E0PB 3PWCA 2EDZA 4O06A 1EZQA 1C2EA 2CHAC 3KYGA 4X1PU 1SGNE 1HGTH 1HJAC 1BHXB 3A86A 1VKYA 3F3BA 1QQ4A 5G4BA 5HIYA 1TOCB 9ESTA 5HEDA 1KMHB 5FX5A 1V2NT 3E16B 1HJAB 2AHME 3BEFB 2G51A 5CMXH 2K1QA 3OTPA 4JOEA 3SBKA 5DJ7A 3LONA 1S84A 4MG3A 2BD8A 2PTNA 5FCRA 1P06A 1IQJA 3SV2H 1EZXC 1UMAH 5TCCA 2NU0E 1C2HA 1NRQH 1QIXB 5HJ1A 4UU6A 1HAYB 3MYWA 2GCHF 4JZDH 4KTUA 1LKBA 1MTSA 2R4HA 4Q63A 3URCA 3SHAH 2ZTXA 4B6FA 1DM4B 1LPKB 2VWRA 1DUEA 3MH6A 3RXBA 3RMNH 4JOFA 1O5CB 1UF1A 1ANBA 1OS8A 1CBWB 2ZHFH 4TT3D 5CHBA 2KAIA 1ORFA 1JBUH 1WIFA 1WFVA 1OWHA 3VEQB 1ZTJA 4JMYA 4IS5A 3O8CA 5F8TA 1TP5A 3CBZA 2WINI 2O8WA 4MNVA 1JXPA 3ZRTA 1SGFA 1M5ZA 5EJZA 2P3UB 2UWLA 4OS6A 1UEZA 3RXLA 1BRAA 3UNRA 4GSOA 2I0IA 5DP4A 2Q6GA 3F2FA 2G2LA 3B9FH 3UREA 4A5TS 1GBMA 3A85A 1AB9B 2NWNA 2BLOA 2BDYA 2J95A 4INHA 4INLA 3K6YA 2ZDNA 2L4SA 1HBTH 1C2GA 4NIXA 4AZ2B 3RU4T 3RXPA 5C94A 4H4FA 1SOZA 1AZ8A 1KWAA 3SUDA 4K8BA 1BTYA 2VVVA 1EJNA 3D49H 2IWNA 4JYUH 1D3TB 1EB1H 1YYY1 3E1XB 1G9IE 1UTJA 4FU7A 4TY6A 1BCUH 2D90A 1MMJN 3C27B 1UEWA 2JINA 1SHHB 3SNBA 1CE5A 2ZU5A 3RXGA 1N6DA 1OOKB 4M9FA 2ZGBH 1QFKH 3CS0A 2CMYA 2ZU3A 2ZCLP 1HAXB 3HKIB 1RY4A 2XBVA 1W9EA 3VGCB 1X5RA 1GDUA 2Q1JA 5C1UA 1GI1A 4D9QA 2P8OB 1BTPA 1JWTA 1BMLA 1O2HA 2F9PA 2GCHG 2QGRA 3UNQA 3PO1C 3AAVA 1B0EA 1MU6B 5AVDA 5B6LA 2FIRH 1IQFA 1Y8TA 4FLNA 1C1NA 1EQ9A 1SQOA 3A88A 3WWFA 1P2MA 3UWIA 3OEED 1YGCH 4FUHA 1EZSC 4WY3A 3UUZA 1QY6A 1DXWA 1LHFH 1Q31A 3OY5U 1SR5C 1V3XA 4A1TA 2IJD1 3EE7A 4IMZA 2PWXA 5CHAC 4YT7H 1YM0A 1SGDE 1YPKH 2EV8A 1DXPA 1QBOA 2VWOA 3BG4B 3FN8A 1TPAE 3RC4A 3MFJA 4UU5A 5IL9A 1BFEA 4OEOA 2UWPA 3KYFA 1RTKA 2CN0H 3A7TA 1SSXA 1W3CA 1V5QA 5J4QA 1UTLM 2YMSC 2WUBA 3AXAA 2EGKA 1UHPA 1NESE 4F4OC 1O3CA 5HFDA 1E1RD 3I29A 1A3BH 2KFWA 1BTHH 2WV5A 1O2KA 1NRPH 1C5XB 2J97A 2ZU1A 3OX7U 2FYQA 1H8ED 2AGGX 1NPMA 3UIRA 4Y76A 4F49A 1N6XA 2RCZA 2QKTA 1EP6A 2F43B 4R2ZA 3NKKA 1FI8A 4Q2QA 3U1IB 1LVMA 5LPFA 1TGNA 2O8LA 1QRZA 5L2YH 3U28C 1GI3A 1P01A 5FL7D 2SGPE 1NTPA 2V0BA 2THFB 2EDVA 1WTGH 3DSPA 4XBBA 3QLPH 3PB1E 1LQDB 3QE1A 2PUXB 1GBLA 1WYKA 1NFWA 1RJXB 3SU1A 1V2MT 4DIIH 1HXEH 1K1JA 2I0LA 1OHHD 2J98A 3RU4D 1DE7H 3GABA 2BX3A 3FANA 4FUGA 4UFGH 2Z6BD 3ESTA 4FVBA 3P92A 4NNMA 4GAWA 1RFNA 1GJ8B 3I4WA 1GBHA 4GCHF 1O2YA 3VQFA 3S9AA 4OAJA 1AWFH 1EOLA 2WHXA 4KFVA 1T31A 4NXPA 1RGRA 3TLOA 1EAXA 4ABBA 2SFAA 4DOQA 1CO7E 4I32A 2QAAA 2GV7A 2XCNA 3EA9A 3LGUA 4RSPA 5GDSH 3NZIA 4D7FA 4ISLA 3UOPA 1HAZB 2FX4A 4DW2U 4E3BA 3ZZAA 1BJUA 1GI2A 2FM2A 3P95A 4NSVA 3DSGA 3K65B 3UOUA 2D92A 3RUOA 4MDSA 2EI6A 2ZC9H 5A2MH 1TQ0B 1VR1H 5DTHA 2HPPH 1C1MA 1GJDB 3EGKH 2FOAA 2VGCB 3F0OA 2H3LA 2XC0A 4LK4A 3QIKA 3CBYA 3JZ1B 3SNCA 2FOBA 2ZDMA 1DSUA 1MTNC 2G00A 3RDZA 2F3CE 5F53A 2GJGA 2PR3A 4E06H 3Q3XA 1O3GA 2BXUH 1C4U2 3QZRA 1O34A 2RCEA 2ZG0H 3RL7A 2ZFRH 2QKVA 1KYNA 4B6EA 3BSQA 3SGAE 2A7JA 5HGGA 4TSFD 2EEGA 1W9OA 3BTWE 5L2ZH 3NFKA 3UAIC 1LQEA 2WPLS 2A4RA 2XTTB 4IC6A 3TNTA 3SUGA 4NXRA 2SNWA 1TIOA 2Y80A 2KCPA 3SU5A 2A4QA 3KN2A 2PW8H 4LMMA 4AX9H 2DE8A 4I7YH 4NWKA 3VG8A 2ULLA 1OWEA 5GJ4B 2ZNKH 3RP2A 2QT5A 1IQLA 3WY8A 3Q3KA 5C17A 1SGQE 3RXCA 2V35A 1OPHB 1V6DA 1C5PA 1NFUA 1F92A 4FXGH 5GXPA 2ZI2H 1AIXH 4AYYB 2FCFA 1LTOA 1XUFA 2AERH 3ODDA 3ZZ4A 3S7KB 1IU0A 1EPTB 1V2ST 3ZVFA 1LMWB 4CRFA 3SV8A 1Z6EA 1V5LA 2ODPA 2ZF0H 2BB4A 1IQEA 1GHBG 1O2VA 1QTFA 1WV7H 1PQ7A 2KAIB 1THPB 4OS4A 2M10A 1BIOA 1PQ8A 3MH4A 1AU8A 1O30A 1O2MA 8GCHG 3Q00A 1AD8H 1UVTH 1V2LT 2BDIA 4K78A 2EI8A 1GJCB 4UDWH 3RXKA 2OQ5A 4ZKSU 3U8OH 1ZHPA 5J4SA 2I6VA 2Z94A 1Y3UA 4WYUA 1AY6H 3SHUA 1G3DA 3TH3H 4CBNA 1E37B 3KIDU 3SJIA 3NWUA 5LGOA 2EXGA 2ANYA 2OBOA 4DCDA 2YNBA 4GHQA 4YLUA 1F0RA 1YPMH 4CRGA 5A8XA 2ZHDA 2PSXA 2CHAB 3LGWA 3SV7A 1AE8H 1P3EA 1ZZZA 1C5QA 2Y81A 2ENOA 1Y5AT 1G37A 1OX1A 1XUGA 2LA8A 4YXWD 1AKSB 3R0HA 2ZFSA 1BMAA 3A7XA 3TGIE 2BY8X 4YZUA 1IQNA 1TOMH 2PKAB 2A0QB 2Z7FE 1W0ZU 3PRDA 2R0KA 1QR3E 3T29A 3LPRA 4ZKNU 1IHSH 1ABIH 2ZECA 1MAXA 4K60A 3RXUA 1QRXA 4YYXA 1CSOE 2ZCHP 3DT0H 2XWBI 1U38A 4OS1A 5EXLA 4RI0A 1UK3A 3GDSA 2LC6A 3PV2A 2ZDLA 1HAVB 2VGCC 3UWJH 2DAZA 1Q7XA 4X0WU 1HNEE 2ZO3H 4LZ1H 1SKYE 2AMDA 3UQOA 4UONA 1XXDA 1ID5H 3GCTF 1AGJA 3M36A 1LCYA 1GQ4A 4FUJA 1HCGA 2RA0A 4XDEA 2V3OH 3K50A 4XHVA 2KR7A 4PROA 5ILBA 1BRCE 2W6ID 4I33A 4UFFH 3W95A 4FUIA 1GI5A 1TABE 2A2XH 3QTVH 1PFXC 2JH0D 4JCNA 2G5MB 1DS2E 3EDXB 2DKRA 2CS5A 2W3KA 3LIWA 2EA3A 3PDVA 1Y5UT 1C2IA 1UVUH 3S7HB 2BD2A 1NU9A 2KPKA 2A2QH 3QDZB 2J38A 1P2QA 5EOKA 4GVDA 2PKUA 3A84A 2WSSD 1A0JA 1E38B 2AMPA 1FZZA 3GOVB 4AFZA 4ZMAH 5HFCA 1UCYH 3ID3A 1YY3A 1TRMA 4OM9A 2EQNA 4O97A 1N7TA 4U01A 4DIHH 4E35A 1O2PA 4HGCA 1UTOA 4IGDA 3SJ9A 5PTPA 2QY0B 4OS2A 2BHGA 2VH0A 4JOKA 3QGNB 2W26A 1LHDH 1O2OA 4BXWA 1SLXB 1SQTA 3H7OA 3ZZBA 4RT0A 1CU1A 2OS6A 1WBGB 5FAHA 3I78A 3KZEA 1CQQA 3ZVBA 4K1EA 3M5OA 1ELAA 1GHAF 4REYA 1MBQA 2HRVA 5FX6A 4AB8A 2Z3EA 2G4TA 3ATIA 3N7EA 3AASA 2VSPA 5F3XA 4OS7A 5I25A 1HJ8A 4ZCNA 5DO4H 3M7UA 4CR9A 1CHOG 1ELDE 1C2KA 2YMSB 4YOIA 1H1BA 5C2ZA 1HB0B 4BTTB 5GWZA 2F0AA 2M0ZA 3T26A 1F0TA 1TX8A 3DSOA 4NMOA 5G1EA 1IQKA 2VZ5A 1O39A 1D6RA 1SB1H 5DP3A 4AOQA 1MKWH 2GX4A 5T6GA 1Q3PA 1IQHA 2TGTA 1VITG 2AIPA 1XVMA 2Z9LA 2FESH 3DIWA 1ZTKA 2VINA 5KECA 1P1DA 4ABAA 3RLYH 1F5RA 4BOHA 2HLDD 1ELCA 1GVZA 1BT7A 3L6PA 1YPLH 2WUCA 2GV6A 2ZP0H 1O5BB 4MNXA 2ILNA 3KHFA 1D5GA 2PKSC 2YNAA 3OFND 2OK5A 1B7XB 2SGFE 3MU4A 2PGQB 4MNYA 3FFGA 3QN7A 3O8DA 3F68H 3M5NA 1IHTH 2JXOA 1ZSJA 5F03A 1YLNA 3OTJE 4UD9H 1CGJE 4B75A 2BDHA 1O2TA 3GY8A 1IAUA 4I86A 2Y82A 3GCOA 1OP2A 2ZHWH 4WMDA 2OCSA 3E6PH 1WF7A 2W6JD 4Q80A 2ZTZA 3SFJA 2GDEH 5BRRE 1CHOF 1KTSB 3A83A 4NFEA 3SZEA 1EX3A 2AIQA 1MD8A 1FAKH 5AFYH 2Y7XA 2EDPA 5C5OA 1J14A 2I4SA 5FCKA 4EDJA 4CRAA 1ZJDA 3KNXA 2J98B 3BTTE 1W11U 4XFQA 4DURA 2JDID 1QJ1B 1P05A 2AGIX 3PM3A 5TJXA 1QGFA 1O3PB 3MU8A 3SU6A 2IPQX 4YLQH 1L6OA 3WWBA 4AN7A 4X6NA 1TMTH 4Z8JA 1ELVA 1WSSH 3JZ2B 1KXAA 2JKHA 4IN2A 4A1VA 1V2VT 2Q6FA 3SUEA 5GCHF 1GHZA 1C4Y2 5HFFA 3GCHC 3M5LA 4BAKB 1GVKB 1BQYA 3FAOA 1CVWH 2ZCKP 4OEPA 2DLSA 1VCPA 2F91A 5ESTE 1Z1IA 3M37A 1BA8B 3RXQA 1XKAC 2OGPA 4BTUB 1MU8B 5T1VA 1BB0B 1TAWA 2FLRH 3VFEA 5JXBA 1CHGA 2FNEA 5HETA 1QURH 5DKMA 2FLBH 2KOHA 3KQDA 2OINA 4KP0A 3ZZ7A 1I16A 1WI4A 1O3NA 4JJ3A 2PKTA 4Q6SA 4B2CA 4I8LA 1EATA 2UUKB 1T4VH 3ZZ3A 2Z3CA 1TALA 4E7NA 2O8TA 1XXFA 3FY5A 4WJG2 1C1TA 3P8NA 1NU7B 3I18A 1NM6A 2VB0A 1UTPA 2QYIA 3VGCC 1N7EA 2LC7A 3LC5A 2PSYA 4Y6DA 1FJSA 1WU1A 2F9OA 1GCTC 1ANDA 2J34A 1GHAG 4FUDA 1ANCA 3NCLA 1ZRKA 3Q77A 1ZHRA 4Y8YA 1J16A 1D3DB 2TBSA 4FUEA 6LPRA 4I8KA 2CSJA 2G55A 3P70B 4AGKA 5JBTA 5HIZA 4HI3A 1OKXA 1K22H 1K32A 3MWIU 4B71A 2RFKC 1INCA 1P10A 2C4FH 1PPCE 1RTFB 4X1RU 1MKWK 2HE4A 3RMMH 2E7KA 1FQ3A 4NWLA 1GBFA 2A1DB 1UO6A 5HF4A 1C1WH 1Q2WA 1ZOMA 4FU8A 4MTBA 4TYDA 4Y71A 4BAMB 3TGJE 1EAWA 2IWQA 1J17T 2VNTA 3A8CA 1WUNH 3SU2A 2D8IA 4NMQA 2B0FA 4K1SA 2YT8A 1ZLRA 3A89A 1S5SA 2QXGA 3DFLA 3MU0A 1L4DA 1C1PA 4AFQA 3E91A 1JIMA 1V2QT 2UWOA 1Z8IB 2G52A 4ABGA 2K20A 3D65E 1WI2A 1DFPA 1YPEH 1ZYOA 3RMLH 4P0CA 1KSNA 1OWKA 3H5CB 3F9GA 1K1LA 3LU9B 4XRNA 5CDFE 3GY3A 4AG1A 4ZXXH 3A80A 3DJ3A 1XM1A 4UFEH 1I92A 4XBDA 1G3EA 1V2PT 1AZZA 3IWMA 2LP6A 3AW0A 2EEKA 5JBBS 2L6OA 2OMJA 2BOHB 1O3OA 1KIGH 2LPRA 1FPCH 2D2DA 1G3BA 3FOAA 2A45B 5JB9S 2ZA5A 2Z9KA 3F1SB 2A4OA 3V13A 1DWBH 4BAHB 4AC9A 3M3SA 4WH8A 1LPGB 1NC6A 1O31A 2JJ1D 5LPRA 1XMNB 1T8LA 3MNSA 5HEBA 1P2JA 2P93A 2BD5A 3MNXA 1TNIA 2JIKA 3QGLA 1O38A 1NS3A 1GBJA 3MHWU 3TU7H 1UCYE 1G2LA 2P59A 2PUQH 1V2OT 4Q3HA 1XUIA 1FXYA 1JRTA 4H11A 2OCVB 2QA9E 3Q3YA 5JPMH 2DJTA 5A0AE 1GBTA 2F9BH 3GYLB 5A8YA 5KGOA 3F2GA 4NA8A
chains in the Genus database with same CATH topology
1CGHA 2H1UA 1F0UA 1NTEA 1T32A 1AKSA 3SO3A 4ABIA 3PLKA 1O3BA 2FDAA 4JYTA 2JWEA 2PKAA 8LPRA 4YDPA 4I8HA 2IPHA 1A7SA 5L6NH 2Z9GA 4ZAEA 1GMDG 3GYMA 4X2WA 3ODFA 3GY5A 1MTWA 2G4UA 1GHXH 3LOXA 2D26C 1JRSA 5E0JA 1EAIA 3SHCH 1DLEA 1VGCB 1AO5A 5A0CA 3PMHB 1GVLA 4WXIA 1TRYA 4ABHA 1G9OA 1UFXA 2LOBA 4BANB 3NK8A 1O2WA 1GQ5A 1WJLA 1C5VA 2K1ZA 1QL9A 2WYGA 4I8JA 5FBEA 3BN9A 3DD2H 5EZ0A 2PV9B 1C2LA 1X7AC 4NZQA 1ELGA 5C67A 3JXTA 4ABEA 2ALPA 6GCHG 1O3IA 1PDRA 2KOJA 4NMSA 4ZHAA 1O3LA 2ZGJA 2O9QA 2STAE 2Y5FA 1O5DH 2GTBA 1TNHA 1EKBB 1QQUA 2VRFA 2R9PA 1W13U 2OZFA 1QJ6B 1ZJKA 3BTHE 3LNXA 2QBWA 3MU5A 4O3UA 1AFQB 1UM7A 1O2ZA 2OQUA 3LH1A 3EGHC 4CH8B 5L30H 1CT4E 3STIA 1OWDA 1OSSA 1VJ9U 2XC5A 1P2OA 1DUAA 1UK2A 1GCTB 1TX6A 2ZGHA 3SN8A 1THRH 2V6NA 3LC3A 4WMEA 1MTNB 3QTOH 1YPJH 1TYNA 2JILA 1P02A 1TPSA 2ZDAH 1U6QA 1EXFA 3A7WA 1UITA 1VB7A 4MPAA 1KY9A 5C20A 2UZCA 4OGXA 4NIWA 1JOUB 1GI4A 3TSZA 3WKLA 2I6SA 3F9FA 3PROA 1X6DA 1C5OH 5E1YA 1GJ4H 1FDPA 2QF0A 4XBCA 2RRMA 2XC4A 4X2XA 2IWPA 5ESBA 4U2WA 1N6FA 5LPEA 3EGGC 2VSVA 1TBZH 1O3FA 1MTVA 1AHTH 3LNYA 2RG3A 2XBYA 3M5MA 3SGBE 4KTSA 2PTCE 4X1SU 1GHBF 2BZ6H 2OSGA 1N8OC 1A0LA 2YOLA 2BY5X 1AFQC 3MO9A 2NU4E 1V1TA 2FE5A 5E0GA 1P2NA 2BY6X 1C2JA 1UJ1A 1P09A 3KDKA 1CT2E 1DDJA 1MBMA 1GJAB 3NFLA 3BEIB 4DT7B 3L4FD 3BF6H 1P03A 4AORA 1C5UA 1T8NA 4NGAH 5FBIA 5A8ZA 1FY5A 1GMCF 2BLWA 1X45A 3O46A 2A4GA 1GGDB 2GVFA 1XVOA 4CRBA 3P8FA 2AWWA 4K75A 1ZSKA 4DGJA 3CH8A 1HIAA 2FOEA 2WPIS 4Q2KA 3ZVAA 2ZDVH 2WPMS 3D62A 4AG2A 3K82A 4NXQA 3KHVA 3BEUA 3K1RA 3MO3A 1MKXH 4QT8C 3O8BA 4KFWA 4Q2NA 1E34B 3Q76A 1VJAU 2YUYA 2W4FA 3TPIZ 4X6PA 2BQWB 2BZAA 2PHBA 2P3WA 1GG6C 1S6HA 3HPTB 4ISHH 4Z33A 1C5RA 2BVSH 1C1UH 2F5YA 1EOJA 1U39A 1Z8JB 3E0NB 1TFXA 1GMHG 3ID1A 1ELBA 2B8OH 3GICB 2ZPRA 1C1QA 3GDVA 2ZPMA 3ELAH 1KXEA 3TJUA 2RA3A 3OU0A 1P9SA 2QXJA 1KDQA 1N99A 1QL7A 1RS0A 1D3QB 2IN2A 2PGBB 1AN1E 2AS9A 2KRGA 4A1XA 4I31A 1TGTA 3BG8A 3PV4A 2R3YA 4NIYA 4DJZB 1Z7KA 4MVNA 3MTYA 4K3JA 1HV7A 3GY6A 2KAWA 2BQ7B 1E35B 1AFEH 1YC0A 5DP6A 3B23B 1GBCA 3D23A 1EZUC 2ALVA 3SOSA 3SZNA 4PQWA 1O2NA 3E8LA 3C1KA 1FC6A 4MPVA 2BMGB 3RXSA 1WHAA 2P3FH 3ZZ8A