3GCOA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyqf omp peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
302
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 59
structure length 302
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA01
1NFUA 3F9EA 2BYAX 1QIXB 5L30H 2EEJA 2FOHA 2FN5A 2BM2A 6LPRA 1TNGA 1FONA 1GBDA 1O0DH 4YM9A 1HJAB 1C2DA 1A7SA 3U1IB 4Y0YE 2GDDA 5C1YA 1BZXE 2O8TA 4FUFA 1DUEA 1CO7E 2CGAA 2GVFA 1AD8H 4LZ4B 2VJ1A 1AI8H 2JILA 4YOJA 4JOFA 2FI3E 1LVMA 4OS2A 1FUJA 1EAXA 2A0QB 2Y6TA 5EXLA 4KTUA 1W7XH 2ZA5A 3MU1A 3A82A 1Z8RA 3MOCA 1MH0A 3KNXA 1GI3A 1BCUH 3I18A 1W3CA 2BDBA 4MNWA 7GCHG 2AERH 1LHEH 2P94A 1HAZB 4Y79A 4X8VH 5EQRA 4K78A 2V0BA 1JOUB 3MH7A 1U6QA 3T5FH 3NCLA 1Q3PA 2KBSA 5T6FA 3BTME 4K72A 5E0HA 3V13A 4D8NA 4AFQA 1K32A 1FLEE 3ZZ8A 2H3LA 4JORA 1GHAG 3RMOH 4X6OA 4B75A 3RLEA 1OBXA 1G9OA 1MC7A 1MTNB 5EW2H 3A8CA 1L1JA 3QO6A 2F9PA 4JYUH 1UCYE 2OC7A 1C5LH 1NZQH 1TNKA 3BTWE 2PTNA 4JZDH 2XBVA 1H9HE 2BHGA 2Q6GA 1O3BA 3MWIU 3QGLA 2W5EA 2GCHF 2FYQA 5F03A 2KJPA 1E0FD 3K50A 3OTPA 2XCNA 2Y5GA 3PDZA 4FU9A 2L4SA 1ZPCA 1MKWK 3BF6H 3PV4A 1XUKA 1Y3VA 1XUFA 1OXGA 4ZKRU 4ABHA 3CENA 4WYUA 1PPBH 5F67A 2XWBI 1GJ8B 4X1SU 3NFKA 2MHOA 3IWMA 2KG2A 2NU4E 4AZ2B 3M7TA 1ZSKA 1SGEE 2VVUA 3WY8A 3OU0A 2AYWA 4FUCA 1IQHA 3RXDA 4Q7ZA 2IPHA 1G32B 3S9BA 3GICB 4Y76A 4OS5A 2WV4A 5EXMA 1HAOH 1IQMA 1GGDB 2R0KA 1O3MA 1C4U2 2XRCA 1SB1H 3M5OA 3MU4A 2IOTA 3K2UA 3BEFB 3STJA 1RJXB 5F8TA 4AG1A 1DLKB 4X8TH 4JOGA 2OMJA 5L6NH 4NA8A 1O2PA 1C1WH 1GI5A 2PWXA 4ABDA 1ORFA 5GCHF 1H4WA 2GMTC 4WYTA 4R8TB 1N6XA 2J94A 5EGMA 1G3CA 1NTPA 1TNHA 2VWOA 4ZXXH 2OGPA 3ATWA 5A0CA 2EV8A 4MNVA 2OSGA 2ANKH 3LGVA 1SLWB 2QY0B 4Q7YA 3ENSB 4NG9H 5F8XA 2Z6BD 4Z0KA 3LJOA 1EAUA 2ALVA 4IN2A 3NFLA 4AB9A 3DFLA 3S0NA 1IHJA 3C1KA 2ENOA 4X6PA 1KTSB 2JKHA 2QKUA 2KOJA 1W14U 3RMLH 3UQVA 4NCYA 4F49A 2PDZA 3SI3H 2ZP0H 1CQQA 4QT8C 5EQQA 1YPMH 4JZEH 1UJVA 2J9NA 1MKXH 3QIKA 1UTMA 1C5RA 5LPFA 1JIMA 1FXYA 4B2AA 2D92A 3V12A 1LHCH 4ZMAH 2CHAC 2BLWA 5HEBA 5A0BA 2GX4A 4XSKU 4A92A 3EQ0H 1PDRA 5IYTA 4LK4A 3ELAH 1V2TT 4NIWA 2REYA 4I8GA 3LH3A 1VGCB 1V2JT 2HNTE 2NU1E 4HGCA 2OC1A 3U69H 1ETTH 1VZQH 3KCGH 5CE1A 5DJ7A 1N7TA 1ZJDA 2BLVA 2LC7A 2JETB 2WINI 1W0YH 1VCWA 1S85A 3MH4A 2XBXA 3GOVB 1A5HA 3HKJB 1GHAF 3TH2H 4TY7A 2CMYA 4U32A 1YPJH 1GQ4A 1O5GH 3AASA 1D3DB 1XZ9A 2DKRA 1VCPA 3RC5A 2R9PA 2TGAA 3OY5U 3QDZB 3R0FA 1S0QA 4NGAH 1UMAH 1IAUA 3B8JA 2Y80A 8GCHG 1E37B 2ZU1A 2BY6X 2W7SA 2W4FA 2K20A 2RA0A 1ELCA 1NPMA 1WCZA 1GHWH 4H11A 1OBZA 1L4DA 3NZIA 1SPJA 1C5NH 1NROH 1LPGB 2P8OB 1OWDA 4YO9A 4THNH 2VNTA 2OQ5A 1GBAA 1V6DA 4MPAA 1LVBA 1U3BA 2FX6A 3LT3A 4TPYA 5LGOA 1SHYA 3V3MA 2L4TA 1RD3B 4IW4E 1N6YA 1QBNA 2UWOA 3CS7A 1KY9A 1V2MT 3AAUA 4CRGA 2PKSC 1IQIA 1UHPA 2C8XB 3Q77A 1SGFG 5K0HA 2IWQA 3RMMH 3LC3A 4CHAB 4NNLA 1P3CA 1UEPA 1GDNA 4BANB 4HOPB 3ITIA 5EG4A 1V2VT 2HE2A 1ANDA 1GVKB 1VAEA 4IC5A 3SUGA 4CRCA 1FZZA 3SNCA 4CRBA 1RGRA 1C9TA 3QX5H 1AY6H 1Q3OA 3B23B 4X8SH 1Q2WA 1KYNA 2FEQH 8ESTE 1A46H 1L2EA 5A09A 1A5GH 2ZC9H 2BDIA 5AF9H 1YCPK 2FWWA 3HPTB 2ANWA 4BXWA 3CH8A 5F3XA 2CF8H 3K65B 1WG6A 2P3FH 3ZZ7A 2M0VA 1GBJA 2Y5HA 1UEWA 2QF3A 3MU8A 1EZUC 2PUQH 2AGGX 1A3EH 2CXVA 1QA0A 3O46A 2EDPA 2G4UA 1BDAA 3HGNA 6GCHG 4XBDA 1T7CA 4YESB 2HALA 3ZZ6A 1VITH 4NMTA 2BD7A 2RCEA 1WFGA 2H1UA 3NK8A 3M5NA 9LPRA 1TBRH 4MQAA 1SLUB 5JBAS 2QAAA 2VIPA 1O3IA 2VGCC 3O8DA 2GT8A 1QURH 3GY8A 3PB1E 3HPKA 1LDTT 5G1EA 2KQFA 3MU5A 1SGCA 2VIOA 3KIDU 1BMAA 2FO9A 1GCTC 2VPHA 1DS2E 4YYXA 2FOBA 5PTPA 1GI1A 1MU8B 4A1TA 3CS0A 2UZCA 1LQDB 1TNIA 2BQ6B 3S7KB 3RXFA 2FNEA 1XVOA 1C2GA 2J38A 1ARCA 1IQJA 3P95A 1FN6A 2OQUA 1CGJE 1NRQH 3AAVA 1PQ7A 4FUGA 1HCGA 3F68H 3M3SA 1X8SA 1WQVH 5DTHA 1P2KA 4YLQH 1GBEA 3GJ9A 1DFPA 5E22A 4AOQA 3FZZA 1SGYE 5ABWA 1UF1A 2AS9A 1OYTH 8GCHF 5DP5A 3RXQA 1ETRH 2B7DH 1O3HA 5ESBA 2Q9VA 3AW0A 2ZU4A 1FCFA 1MZDA 2STAE 2EAQA 2UUKB 2WV5A 1RTLA 1NF3C 1KDQB 2VWMA 1QBOA 1ZMJA 1UTPA 1O3GA 3L6PA 5FPTA 1DWCH 3RXTA 1AKSB 2ZU2A 1F5KU 5AHGH 1MFLA 4FVDA 4IBLH 1AE5A 1PPZA 3URDA 4B2CA 2PSXA 5GJ4B 2FOMB 4NIXA 1Q31A 4JOHA 1GJ6A 3LOXA 1F5LA 3SBKA 4KGAA 3HGPA 3PTNA 1OPHB 1ZUBA 1A0HB 2M5TA 2I6QA 4R0IA 1UJDA 1V2WT 2KA9A 1ZTLA 3EGHC 2YNAA 1C2EA 1BRAA 4VGCB 2VWNA 2HGAA 2CS5A 2GZ7A 4Y71A 1ELDE 1GJ4H 1LPZB 1P0SH 4CRAA 1MTVA 1EP5A 1ETSH 4PROA 3ZZ4A 3EE0B 2ZGXH 1GBCA 4WF8A 1GHXH 2GTBA 3ID2A 1I16A 1O2MA 2A7HA 4H6SB 3I78A 3A86A 3TU7H 1MZAA 4NMQA 3SW2B 1C5SA 1FQ3A 3SJKA 3DD2H 4DG4A 1UJUA 2BD5A 2TGDA 5J4QA 1DXPA 2O8MA 4K60A 1UEZA 5HFCA 1TGNA 6GCHF 1FC6A 3PLKA 3I1EA 1HAYB 1TA6A 1TPAE 1O2QA 3BIUH 1XM1A 4NMOA 3LGUA 9ESTA 3CP7A 3SU5A 1G9IE 1BIOA 3QWCH 4H6TA 1HAVA 1AB9B 1Y5UT 5DK1A 4KELA 3F6UH 2YT8A 4ZH8A 5I25A 4HTCH 2LOBA 3EGGC 4KTCA 1SHHB 2O8UA 1C1UH 3RM2H 1YC0A 1NO9H 1LTOA 1TONA 4UFDH 1A61H 3SV7A 4FUIA 4NXQA 1GVZA 4BAOB 1P2IA 2OC0A 2SNWA 3ZV9A 5A8ZA 2VVVA 2TGTA 4KTSA 4WXVA 4NXPA 2GP9B 4OGYA 3A8AA 4ABFA 5C5NA 2OC8A 4AX9H 1KTTB 1XUHA 3LKWA 2I0LA 1AN1E 2FDAA 1A2CH 3SO3A 1HIAA 3LNXA 2AFQB 4UD9H 5E8EH 1ZSJA 1KXAA 1O2GH 5AFYH 3KF2A 3GGEA 1B5GH 3E1XB 4JZ1A 5I7ZA 1AHTH 4MPWA 1AMHA 1FY5A 1C2HA 1LKAA 3TITA 1Z87A 1YP9A 2ODPA 1SGQE 2A5AA 4TPIZ 3N7OA 1ELVA 1KLTA 4A7IB 1AVGH 2SNVA 3P17H 4DOQA 4UU6A 4UFFH 1HFDA 2J34A 1T31A 3R3GB 1V2RT 2GKVE 4MPXA 3VQGA 2G52A 1TGSZ 3V7TA 4D9RA 1F0TA 6CHAB 4BOHA 5E2OA 2BY7X 5IDKA 1GVLA 2F9UA 5FPYA 4NMVA 2G5VA 1EAWA 2CV3A 1VITG 2WPMS 2QXJA 5DP4A 4FXGH 1N6EA 4X8UH 3QJMA 2VIDA 2I0IA 1UVSH 2A7JA 1H1BA 7KMEH 2WPJS 1HAHH 4O06A 2PKAB 3P8FA 2DC2A 3SV8A 2PNTA 2ZNKH 3BTHE 1EZXC 3GSLA 3EA8A 1SC8U 2EGNA 2J95A 1AB9C 1L4ZA 1TMBH 1XUGA 3KZDA 1EPTC 2BDAA 3SNAA 5HEDA 1ZRKA 2PLXA 1C2JA 5EYZA 1THSH 4SGAE 3LGIA 2C3SA 1RIWB 2ZG0H 4X2VA 2JINA 5EOKA 3O5NA 1EPTA 2R3YA 1PPFE 3FANA 2R0LA 5FCRA 1E34B 5EW1H 3NXPA 1KXCA 1RTFB 1UTNA 4Y8ZA 1P9UA 3ZVDA 5HFEA 4YDPA 3PO1B 1SQOA 3DJ1A 3TJOA 1PPHE 3UUZA 4DT7B 3L4FD 4J2YB 4FUDA 1D5GA 5JBTA 5A8YA 1QTFA 3VB3A 2OINA 3OX7U 3R69A 1WI2A 1O2SA 3P6ZB 1ELAA 2I6SA 2ZFTA 1AFQC 4Y6DA 1O2LA 1C1QA 4B71A 3M3VA 2QKTA 1MQ6A 1OX1A 1P3EA 1O3AA 1YCPM 4K3JA 2HWLB 1P2MA 3MNBA 3TSWA 4Q2PA 4GVDA 4FGMA 4MTBA 4CBOA 1K1JA 1EXFA 1TE0A 4X2WA 1D9IA 2HPPH 6CHAC 4GVUA 1GPZA 1KXDA 5JXBA 1GG6C 2MX6A 1TX7A 5FAHA 3FZDA 1MU6B 2OUAA 2XYAA 3MU0A 3RXOA 3OSYA 3ODDA 3AVZA 5BPEA 3U1JB 4JOEA 1VJ6A 5C2ZA 2WPLS 1AVWA 1AWFH 1A0JA 2BZAA 4NWLA 1PPGE 4E34A 1KXFA 4FUBA 4DVAU 1DUAA 2ZDNA 1ELBA 1F92A 4DY7B 3T25A 2V3OH 1V6BA 2GDEH 2SGPE 1UITA 2KRGA 1TAWA 2GGVB 1V3XA 2J92A 1TA2A 3VGCB 2Z9KA 1BFEA 3ZVBA 1GJDB 3E0NB 1AFEH 2A1DB 3SUZA 1FDPA 1WAYB 2FIRH 4GLYA 3IG6B 1ZHMA 2ODYB 1NM6A 4GHQA 1VITF 2EA3A 1HDTH 3PV5A 2ZU3A 1PQ5A 2BVXH 2ODQA 1N6DA 2OPGA 1UM7A 2CSSA 1HB0B 2H3MA 2VWRA 1Y5BT 3HK3B 1O32A 3A87A 4MVNA 1IU2A 3E90B 5HETA 1FNIA 3ATIA 5FCKA 3FFGA 1ZGIA 2BY5X 3ZZCA 1WYKA 4JYTA 3QK1A 2A5IA 1CT0E 1TP3A 2BDGA 4E06H 1E36B 1T32A 2VIVA 2V90A 2M0TA 1H9IE 1YPHC 3DJ3A 1WHDA 1Z7KA 2C93B 1UCYH 3E3TA 3SGBE 3LU9B 1S6FA 3T62A 3ZZDA 1TBZH 1YBWA 1HJ9A 2D2DA 2SGDE 1GJ7B 4NNMA 3QGNB 3KQBA 1CT4E 4ZUHA 4L8NA 1O3PB 3DA9B 3RMNH 1ZSLA 3VB4A 3TGKE 2ZFSA 4ISHH 2RRMA 4AYYB 2XXLA 3ATLA 3S7HB 1PYTD 2XNIA 2WPKS 2WUBA 3FP7E 4B73A 5DKMA 1F0UA 2FESH 1DLEA 1UHBB 1SGDE 1E35B 1P2JA 2ZHQH 5JBCS 1WTGH 2EI7A 5HXFA 1YPLH 3SU3A 2FMJA 3UY9A 1NC6A 3ID4A 4XDEA 1GBHA 4FUEA 3TK6A 1GMHG 1YGCH 2J4IA 1RFNA 4DIHH 1HJAC 4I31A 2ZFQH 1V2LT 4SGBE 3BTTE 4WH6A 3BTQE 2O8LA 2CF9H 1KWAA 5C1XA 2HE4A 1AZ8A 1V2QT 3T27A 1BRCE 2R2WU 4Y11E 2HPQH 3ZVGA 1SOTA 4OGXA 4ZAEA 1S5SA 3GCOA 1HAIH 3RU4D 2RDLA 1KSNA 5ETXA 1C1PA 2P3UB 4WH8A 1QRXA 4Q2KA 3VFEA 1Y5AT 1HNEE 3SQEE 1BTZA 3U98H 2QF0A 1ZOKA 4X1RU 2A2XH 3U8OH 4JZIA 1J14A 3C27B 1G2MA 5DP7A 1FY3A 1EJNA 1T2MA 4OS1A 4AFUA 2EDZA 1F0SA 1ZR0A 4K1SA 1GJBB 4GAWA 4BNRA 1C5UA 3SV6A 1YLCA 1S84A 1GI7B 2AMDA 2M0ZA 1C2IA 3E91A 1G30B 1D4PB 4RKOB 1P06A 4TWYA 2BVRH 2V3HH 2XBWA 1SI5H 3P8GA 5C20A 1O39A 3R68A 2G5NA 1C4V2 4GSOA 1TMTH 1W10U 2A4QA 1O2IA 2THFB 3VB6A 3I29A 1SGRE 2H5DA 1O5BB 4BAHB 1GHVH 2A4GA 1UTOA 2QKVA 2LA8A 3FY5A 1GCDA 4ASHA 1GI8B 1MTNC 1TRNA 1YF4A 1EJMA 3A7ZA 1LHFH 3SZNA 3TK9A 2ZTXA 5DP3A 1GMCG 1ZMNA 1VR1H 4TY6A 2H2BA 2ZGHA 1EATA 3F9FA 4GHNA 1OS8A 1TABE 2UUYA 2EGKA 2DE8A 1DXWA 4AGJA 1KXEA 1XMNB 1O5DH 1L0ZA 4O3TA 1DSTA 2GZ9A 2PZDA 1C1OA 7GCHF 2Y82A 1UJ1A 1UTLM 2ANYA 3BTEE 2P3WA 1K1MA 3LDXH 2XC4A 2WUCA 2OCVB 5DPAA 1EQ9A 2KAWA 4Q2QA 1W12U 3QZQA 3P92A 4NFFA 4YT6H 5HFFA 2ZGCA 1VJAU 1C5WB 3SU0A 1ZYOA 3KQDA 4U2WA 4ZKOU 1S6HA 1TX8A 1GHBG 2UWPA 5CMXH 4MNYA 3SHCH 1AE8H 1C5TA 4LOYH 1Y59T 1JRTA 3NWUA 4X2YA 1MKXK 1QL9A 2R3UA 4ZHLU 1ACBE 3SV2H 1W9OA 1QAVB 1DWDH 3PLPA 1GGDC 1O2OA 3LGYA 1SGFA 1JBUH 2PSYA 3BEUA 1GBLA 3T28A 2AINA 1C4Y2 4K2YA 3SGAE 2BVSH 1ANEA 4HFPB 3MI4A 1AQ7A 2GD4B 3QGJA 1SFQB 2YOLA 1O37A 1F0RA 3MNSA 1B0EA 5E0GA 5GWZA 3BEIB 4ISIH 3ZZ3A 4AYVB 2BD8A 2BQWB 1TPSA 2ZDKA 5HJ1A 2DJTA 2Q3GA 4P0CA 2FM2A 1GMHF 2Y7XA 2Q6FA 3DIWA 5C1UA 3ZZBA 1O3CA 5C5OA 1G3BA 1LHGH 2Z3CA 1IOEA 3VEQB 1C2KA 2BZ6H 4BTIB 4CRFA 4CBNA 4IC6A 1BBRH 2Z9IA 3GY4A 3TSZA 2SGAA 1BBRE 1DY8A 2AGEX 2F9VA 2GCTB 3P8OA 2FXRA 1BMNH 3LC5A 3A80A 1QJ6B 2QXGA 3URCA 2QA9E 2DE9A 2ASUB 3GDUA 2HRVA 4ISNA 3TNSA 1H9LB 1WU1A 3RLYH 3D65E 4A5TS 4O3UA 3WKLA 3O8RA 4OEPA 1V2UT 1VGCC 3E17A 5GNDA 1AO5A 1GBIA 3WKMA 2GV6A 8LPRA 2OP9A 1BJVA 2JETC 4XBCA 1YKTA 4RKJB 4A1XA 5CHAB 1ESBA 5J4SA 3VB7A 2FI5E 4INLA 4OS6A 5A0AE 3JZ2B 5FB8C 5T6GA 1OSSA 1GMCF 3LIWA 2VSPA 1XUIA 4BAKB 1OWHA 1F7ZA 2I6VA 1RRKA 1XX9A 2WPHS 4GCHG 1R6JA 2AMPA 1EZSC 2VWLA 2BX3A 3Q00A 1O2HA 5F8ZA 1K22H 3AXAA 2ZQ2A 4ABGA 1XKBC 2A2QH 2ZHWH 1N8OB 1CGIE 1FY4A 2KAIA 2P8OC 1XXDA 1X7AC 1JMOH 2ZPQA 1T4UH 3QJNA 1NU7B 3M61U 1BRUP 1G37A 1O3EA 4WXIA 1GHBF 2BXUH 3DFJA 1Y8TA 1V2ST 1CA0B 1QFKH 1IQNA 3GY5A 1QHRB 4JOKA 2UWLA 1GMDG 3RXVA 3TJNA 3VXFH 3MH6A 1BTPA 2EHRA 2OBQA 2XCFA 1LVOA 1HJ8A 1D3TB 1LHDH 3GY6A 4RSPA 1OZIA 1ABIH 1WUNH 2Y7ZA 4HZHA 5GIBA 3T29A 4CHAC 1X45A 1CHOG 3SFJA 1Y3XA 5FPSA 1S0RA 3A81A 2BY8X 3BIVH 2VB0A 1OYQA 2W7RA 2XWAA 1GJCB 5HFDA 4HOPA 1JXPA 1Z6JH 3I77A 3LH1A 1ELFA 4I8LA 1GJ9B 1DITH 2ZPRA 4X1NU 1OP2A 2K1QA 3ZZAA 3SI4H 3TSVA 2Z17A 3TH4H 2EGOA 1BTXA 1T8OA 2KOHA 3UR6A 1BT7A 4FUHA 5TCAA 2PFEA 4X6NA 5E11A 1EZQA 1FPCH 2R4HA 1AGJA 1W2KH 2ZHFH 2O8WA 5GPIB 4ZXYH 1FAXA 2ZWLH 3DORA 1WBGB 3JXTA 3I4WA 2OBOA 4Y7AA 1MTSA 3ATMA 2F83A 1K2I1 3ZRTA 4X1PU 1HRTH 2BD2A 2AWXA 1P04A 2PGQB 3RXHA 2OS6A 3QE1A 1O35A 1SFIA 3BG4B 2R2MB 2ALPA 1UEQA 1FMGA 3M35A 3RXRA 1C1NA 3EA7A 4ISOA 1K1PA 2G2LA 3UFAA 4YT7H 3BG8A 2QYIA 1UVPA 1T8NA 2TBSA 1AIXH 1N8OC 1S83A 3SOEA 1FIWA 3ZVAA 3RL8A 2I4SA 1EJAA 1O2ZA 2J2UA 1C1RA 4H42U 1WHAA 4CREA 1Y3WA 3GY2A 1WF8A 4ZHAA 1DOJA 4YZUA 1O38A 3SU6A 1EP6A 2A45B 5HM9A 3PDVA 1EAIA 1N99A 1C1TA 4AFZA 1AU8A 4CR9A 3RLWH 1CA0C 1YYY1 1Z8JB 1CBWB 3SGQE 1ZPBA 1DE7H 3HK6B 3IITA 4FUJA 4Q7XA 2BD4A 4Q6HA 3T2NA 1WFVA 4GCHF 4Z6AH 1IQKA 1CT2E 1O2NA 1Z6EA 5H3JA 2G00A 2ZF0H 4GUXA 1PFXC 2G81E 1LPKB 1SGPE 2DMZA 1ABJH 3UOUA 1NFXA 3A89A 4MDSA 3TGIE 1A1RA 1N1LA 3TJVA 1QLCA 1O2XA 4ISLA 3A7TA 1S82A 3EYDA 4INHA 3KZEA 3LGWA 1NFYA 4LMMA 1VCQA 1IQGA 2RA3A 2V1WA 3RXAA 3GCHB 4I7YH 2HVXA 1SG8B 3D23A 4WMFA 3SV9A 5LH8A 4K6YA 2JREA 1AKSA 1O2TA 1TGCA 4FU8A 1O3OA 1RTKA 3PTBA 1O2JA 1GMDF 2EI6A 4Y8YA 4AMHA 2XW9A 1D3QB 1HAGE 3TJUA 2VH6A 3RXUA 3K6YA 1UTQA 2H9EH 2EC9H 5E6PB 5HDYA 1O2RA 4VGCC 1DY9A 1K28D 1FJSA 1GDQA 1MTUA 3A85A 3HATH 1LVYA 3PMAB 1MTWA 4B74A 2Z3DA 2ZDLA 1V5QA 3PMHB 5EU8A 3RXJA 3SOSA 5TJXA 1A0LA 2QXHA 3W95A 2Z7FE 2ZEBA 2A4RA 1TRMA 4OEOA 1DWEH 2PUXB 4CH2B 1C5YB 2BXTH 1WOFA 1GBFA 1NY22 1ZTKA 1C5OH 4N6XA 2SFAA 2P95A 3RU4T 2V6NA 4JK5A 1F5RA 4E3BA 1HAXB 4TWWA 4JOJA 1BB0B 2C8ZB 1D6RA 1BRBE 3KL6A 1HPGA 2AWUA 3M7QA 2D8WA 5TCCA 1F2SE 1C5XB 3A88A 3K1RA 3H7OA 2HNTF 3MMGA 1QQUA 5H4IB 2VH0A 2C4FH 3SUFA 5EXNA 1JRSA 1EB2A 2FS8A 1B7XB 2KJKA 1YPHE 1MMJN 1DT2A 1V2OT 1GBMA 2FOGA 2G4TA 1TBQH 3QDOA 1N7EA 1GI0A 1O2UA 4K8BA 3D49H 2CN0H 2I04A 1ELGA 3RXBA 1PYTC 3CBXA 6ESTA 3MYWA 1LCYA 1CHGA 1OWKA 3UNRA 2BX4A 4K8YA 1TGBA 5HYOA 5JBBS 4JOPA 3SHWA 1KLJH 4BAMB 1UVUH 1Q3XA 4D7FA 5E2PA 2PV9B 1O2WA 1TQ0B 4X1QU 1MBQA 1W7GH 1ZZZA 1HV7A 1PPEE 2C8YB 2BB4A 5DGJA 1ZMLA 4XOJA 1O3LA 4DW2U 4HI3A 4MPUA 1C9PA 3RP2A 3SQHE 2ZDAH 3MH5A 4Y0ZE 3DJAA 1W0ZU 2OQSA 2LPRA 3QLPH 4OS7A 4K1TA 4ZKNU 1BITA 1OOKB 1YPEH 1HGTH 1TLDA 3A7WA 1UFXA 2JXOA 3UWIA 1GJ5H 3KGPA 2B0FA 1C1SA 1PQ8A 3SJ8A 5B6LA 4CH8B 2AEIH 2BLOA 1O2YA 1IU0A 1QGFA 2FX4A 3K82A 3TLOA 1FC7A 3Q3YA 2HGTH 3TVJB 3GDVA 1W11U 2D26C 3OTJE 1PPCE 2UUFB 2VVCA 2XBYA 4NSYA 5EODA 3RDZA 1UTKA 3SJOA 5SGAE 2ZO3H 1P01A 3E0PB 2AH4X 4X0WU 1WI4A 2NWNA 3A83A 2YUYA 3Q76A 3FAOA 1O31A 4ESTE 4E05H 2OD3B 3H7TA 1O3FA 5K7RA 1MD7A 1TFXA 2ZGJA 2M10A 3DT0H 3TNTA 3BPUA 2OXSA 4BXSA 2BD9A 1NRRH 2PKAA 4Y7BA 3VPKA 1V2KT 2STBE 2JH0D 3GCTG 5L2YH 2F3CE 2BDYA 2BQ7B 5FHTA 3NPSA 5A2MH 2AIPA 1RIWC 2FP7B 2E7KA 1OWEA 4O03A 3TMHA 1C5PA 1G3EA 2IJOB 1EOLA 4J1YA 3SORA 1V5LA 3TH3H 1YBOA 1RS0A 2ILNA 1SOZA 2CSJA 1TPOA 3KHVA 4DGJA 4ABBA 3E16B 1HYLA 3PO1C 2PTCE 1CU1A 2UUJB 2Z9LA 3RL7A 4NWKA 1K9OE 3ATKA 3P8NA 1BJUA 1EX3A 1WH1A 1QL8A 2C90B 2GMTB 2QN5T 2ULLA 3BTFE 4TYDA 2IWPA 2W7UA 3SNEA 3SUDA 1BOQA 4X2XA 3LPRA 1S81A 3Q3XA 1P1EA 5FX6A 1DPOA 4JMYA 1MKWH 3B9FH 4ABIA 3K9XB 5JPMH 2YTWA 1Z8IB 1ZLRA 3SU1A 3ZYDA 2VINA 2Z9GA 3RXIA 2TIOA 4Q3HA 1B0FA 3RXMA 3SU2A 2TRMA 4MPVA 4NXRA 1ELEE 5EPNA 3MO3A 2GZVA 1NS3A 1P2NA 1QB1A 3F1SB 3KQCA 1P12E 2OTVA 1GBKA 1CSOE 3RC4A 1MAYA 1QRZA 2QCYA 2PKUA 1EB1H 4E7NA 1YPGH 1AZZA 3QZRA 1O5AB 1RZXA 1JWTA 2B8OH 1TGTA 4IGDA 7ESTE 2AWWA 2CHAB 1ZHRA 1BQYA 4XBBA 4UE7H 1SR5C 4MG3A 3RXLA 3A7VA 2A32A 4NIYA 4OAJA 8KME2 1UCYK 3OYPA 2H2ZA 4BTTB 1QJ1B 3SUEA 1TNJA 3FP6E 1T8LA 3EDXB 4XFQA 3CC0A 3MO6A 1JIRA 1E38B 3SU4A 3ZVFA 4LZ1H 4WY3A 3VGCC 1HAPH 4EDJA 3ESTA 2LUIA 2BDHA 2H2CA 2D1JA 1WQSA 5JYIA 2FODA 5HM2A 2FPZA 4ABJA 1XVMA 2RCZA 1ANBA 1TRYA 2BOKA 1G2LA 1GHZA 2ZDMA 1U38A 1TP5A 2B9LA 1V1TA 1KEFA 5HF4A 1G36A 4I32A 1LQEA 3A84A 4NMSA 2F0AA 2BOHB 4CRDA 1NRPH 1J17T 1BMLA 5LPEA 1IQEA 3RXKA 4NMRA 1C5ZB 3E8LA 1W9EA 2A31A 1QAUA 2VRFA 1GI4A 4UFEH 4ZROA 2BDCA 2H9TH 3AW1A 2KJDA 2QXIA 4AFSA 3ZZ5A 3GCTF 1TQ7B 1TWXB 1HXFH 2ZKSA 7LPRA 1IHSH 2P93A 3PROA 3CYYA 5DO4H 4AORA 3U8RH 4KKDA 2GZ8A 3UIRA 4Q2NA 3NUMA 4ABEA 4K75A 1Z1JA 3SHUA 2PKSB 3TGJE 1L1NA 4DIIH 4UONA 1BTWA 1J9CH 3EA9A 1GI6A 1BTUA 1VJ9U 3MTYA 2A4OA 1AUTC 1YPKH 1RGQA 3PMBB 3UNQA 2NU0E 2JIKA 1C2FA 4YLUA 4U30A 1P2QA 1RXPA 3NKKA 4JCNA 1AWHB 1UHBA 5HMAA 1EUFA 1Q7XA 2ZFPH 1P05A 1DM4B 1H8IH 1TOMH 1QR3E 5GLJA 2IWNA 5C67A 2OCSA 4GPGA 1NRNH 4PQWA 2D8IA 4YTAA 1GL0E 1OWIA 4AN7A 1Z8GA 1BTYA 3MHWU 2G51A 1P03A 4XE4A 1MD8A 5T3HA 2LNCA 1K1IA 4Y8XA 3UR9A 1U37A 5BRRE 5HF1A 1KIGH 4ZHMU 4BTUB 2FOEA 2TPIZ 3MFJA 4A6LA 4RN6A 3S69A 1X6DA 2PW8H 1UK4A 2WPIS 1ZGVA 1V62A 5EZ0A 1QL7A 4NZLA 1W9QA 3PS4A 1ANCA 3HPMA 2FOFA 2QT5A 2VSVA 2VGCB 2BYGA 2O9QA 2KAIB 2ZPLA 1Y3UA 3R0HA 4DCDA 2VIQA 3MO9A 1P8VC 4E35A 4ABAA 1CGHA 1GCTB 4JL7A 1O3NA 5DP9A 2FCFA 1AUJA 2BY9X 1OBYA 2FLRH 2ZCLP 1X5QA 2YNBA 1DWBH 2M3MA 1KLIH 1V2NT 1ESTA 1Z1IA 3L3TA 3RC6A 1L1GA 1TOCB 2FOCA 2G55A 1MAXA 1XUJA 1YCPH 3MNCA 2IN2A 4NMPA 2P3TB 4IN1A 4NA9H 4U01A 3SNDA 3KHFA 1XXFA 5EPYA 1DDJA 1BHXB 3O8CA 1SGNE 1ZTJA 1Z71A 2KPLA 2DAZA 3FP8E 2W3KA 1MCVA 1EASA 1TX6A 2Y5FA 1WTHD 1GWAA 1X5NA 1Z86A 2V35A 3GYMA 2QG1A 4H4FA 2ZECA 2LC6A 1N6FA 2YT7A 4IS5A 1A5IA 1C5QA 1O5CB 1SL3A 1GBBA 1X5RA 2EJYA 1OKXA 2H9HA 3UPEA 2IWOA 1MQ5A 1YM0A 3RUOA 1KXBA 1GQ5A 1C5MD 3VB5A 5D13A 1BBRK 2QGRA 1C5VA 4GVCA 1UK2A 1QB6A 3BN9A 3SN8A 4GHTA 1GJAB 1NTEA 1WV7H 4P2AB 5I46H 1LKBA 3UQOA 2PGBB 1QBVH 3W94A 1AVXA 2ANMH 2H6MA 1FY8E 1DVAH 1ID5H 4MNXA 2F9OA 1NU9A 4OS4A 5DP6A 1THPB 1QAVA 1WJLA 3ZYEA 3KQEA 1MBMA 1C1VH 1CVWH 3PWBA 2ZIQH 2ZI2H 2G8TA 2EI8A 4I8KA 5A2PA 1HLTH 1FV9A 1EKBB 2TGPZ 4IMZA 1RGWA 1VB7A 5F6MA 4JZFH 1I92A 3HVQC 1TNLA 2ZDVH 1O2KA 3A7YA 3GYLB 1ARBA 2ZPMA 1GI2A 1RY4A 4UEHH 2FE5A 2EEKA 2HNTC 4BAQB 2AMQA 3M36A 3V0XA 4I33A 2BMGB 5DG6A 1HBTH 4K1EA 1DSUA 2GCTC 3CBYA 5ESTE 2WYJA 1G3DA 2L97A 1HXEH 1IHTH 1SVPA 2OZFA 3TPIZ 2VZ5A 1HAVB 1B8QA 1INCA 2H5CA 3GISB 1C2LA 3ZZ9A 3G01A 2QIQA 3GY7A 1Y7NA 4NZQA 1SGTA 3ID3A 1QB9A 2F91A 5L2ZH 2ZTZA 5AVDA 1TYNA 1K1NA 2SGQE 1FY1A 5T6DA 1OP8A 3BTDE 3RXCA 1ELTA 3MNXA 3LONA 1P10A 2DB5A 1GM1A 2XC0A 3A7XA 1DICA 2WYGA 3LJJA 1QNJA 1CE5A 1SQTA 2P59A 3OY6U 1EOJA 3CBZA 1UVTH 2F9BH 2DLUA 1D6WA 1UM1A 2JWEA 1O3DA 1A3BH 1SQAA 1NESE 2PHBA 2PR3A 4I8HA 3PMJA 5CHAC 5FBIA 2QC2A 2Q1JA 5G1DA 4UU5A 3U9AH 2HLCA 1HIAB 4F4OC 5EQSA 1ZRBA 1BMMH 1P02A 3O8BA 2ZQ1A 2OLGA 1VA8A 2FYRA 4DJZB 1C2MA 2ZFRH 3D62A 3PYHA 4WWYA 2KYLA 1P9SA 1FC9A 1PQAA 2NU3E 1FPHH 2ZHDA 2GV7A 2C8WB 1FAKH 1T4VH 2VU8E 1GL1A 1K1LA 3M37A 1YLDA 2FOAA 3SHAH 3ID1A 4AB8A 2O2TA 3QN7A 1TMUH 2XTTB 3T26A 4D7GA 3FVFB 1CA8B 1GBTA 3E6PH 1ESAA 1TALA 2DUCA 4WMEA 1WF7A 5LPRA 5GXPA 2AIQA 2EXGA 3GDSA 1D3PB 1SMFE 3VXEH 4R2ZA 1QJ7B 3DHKH 1LMWB 1IQLA 4IMQA 1BA8B 3GY3A 2SGFE 3KN2A 2Q6DA 4UDWH 4X6MA 3F9HA 1M9UA 2QBWA 1XKAC 1O5EH 1ZPZA 2D90A 2FZZA 3K6ZA 4ZKSU 4KP0A 3A8BA 4A1VA 2EEHA 2AGIX 4AG2A 1IQFA 3RU4E 2GT7A 1SSXA 4REYA 2A7CA 2PKTA 1FIZA 4K69A 1TIOA 4Q6SA 5A8XA 1GHYH 4FU7A 4F8KA 4NFEA 1SGIB 2DLSA 1SLXB 5DP8A 4YOGA 2EEGA 1EPTB 1KDQA 2FTMA 3M3TA 3BSQA 2XC5A 3GCNA 1W8BH 2VIWA 1NRSH 2CJIA 5FX5A 5G4BA 2BLQA 4CR5A 4NSVA 3RXPA 3UREA 1O30A 2ZFFH 1SLVB 2BTCE 1MFGA 4K76A 3F9GA 4B2BA 3ODFA 1NT1A 1O33A 1U39A 2K1ZA 3PM3A 4INKA 3ZV8A 1K1OA 2ZGBH 3TIUA 1O36A 2Z9JA 1K21H 3RXEA 5HEYA 1CHOF 1GI9B 1J16A 3SNBA 5E1YA 1FN8A 4G69A 3BG4C 2JH5D 4KFWA 2W3IA 1TB6H 3NGHA 4M7GA 1O3JA 1QRWA 2FS9A 4XHVA 1TQ3A 1WSSH 2ZPSA 2WL7A 1HUTH 2W26A 2RG3A 3Q3KA 3EAJA 1OP0A 3HKIB 2M0UA 1DX5M 2BD3A 3B76A 1QQ4A 4WVPE 3H5CB 1AFQB 2KOMA 4K5ZA 4RI0A 3SJ9A 1QA7A 5HFBA 1QCPA 5JB9S 2KPKA 5JB8S 1P09A 2DM8A 1MUEB 3A8DA 3VQFA 1UK3A 2ZCKP 3PLBA 1W13U 3UTUH 1SBWA 4AGKA 1Y3YA 1GG6B 2ESTE 3ZVEA 2Y81A 1CBWC 1UO6A 1O2VA 3RXGA 4B76A 4D9QA 3BTKE 2ZU5A 4WMDA 1NN6A 2G5MB 1DANH 1A4WH 4O97A 3QTVH 4FVBA 4D76A 2FTLE 1NFWA 2PA1A 3JZ1B 1BUIA 1BHXF 3ZVCA 1WIFA 4DURA 1P2OA 3STIA 2B5TB 2HOBA 2FLBH 3M5LA 5B6OA 2F5YA 2Z3EA 3U8TH 1BE9A 2SGEE 4Q2OA 1BTHH 2JOAA 3GCHC 3TK5A 2EEIA 4NA7A 4JYVH 1O3KA 3SJIA 4JK6A 3RM0H 1P57B 1ZOMA 3DUXH 3LNYA 2P16A 5GDSH 2ZTYA 3UWJH 1L6OA 4B1TA 3LGTA 1PJPA 5FBEA 2KL1A 5JDUB 3BTGE 2GCHG 2F9NA 4I8JA 1M5ZA 3QTOH 3S9CA 2JH6D 3QUMP 1FI8A 1OWJA 1GDUA 5AFZH 3UOPA 1N7FA 1MCTA 3S9AA 5C3NA 4Z8JA 3PV2A 2Z94A 3L33A 2ZHEH 4O9VA 1P11E 1J15A 1TPPA 4Q80A 4Y10E 3PWCA 1H8DH 2EDVA 4Z33A 3EGKH 1C1MA 1UTJA 1LO6A 2QV1A 2FI4E 1O5FH 4UFGH 2I1NA 3UNSA 1THRH 1V2PT 4YOIA 4MLFB 4E7RG 1T8MA 2ZCHP 2A5KA 1UVOA 2KV8A 3M5MA 5E21A 5FXLA 4LXBH 1ZHPA 1O34A 5HGGA 3P70B 2ZZUH 3M7UA 1P1DA 1ZJKA 3RXSA 4KFVA 5GCHG 4NIVA 5E0JA 2X7ZA 1J8AA 2NU2E 2YUBA 1QY6A 3BV9B 3KEEA 4WJG2
chains in the Genus database with same CATH superfamily
1NFUA 3F9EA 2BYAX 1QIXB 5L30H 2EEJA 2FOHA 2FN5A 2BM2A 6LPRA 1TNGA 1FONA 1GBDA 1O0DH 4YM9A 1HJAB 1C2DA 1A7SA 3U1IB 2YMSD 3FO8D 4Y0YE 2GDDA 5C1YA 1BZXE 3KYFA 2O8TA 4FUFA 1DUEA 1X9ZA 1CO7E 2CGAA 2GVFA 1AD8H 4LZ4B 2VJ1A 1AI8H 2JILA 4YOJA 4JOFA 2FI3E 1LVMA 4OS2A 1FUJA 1EAXA 2A0QB 2Y6TA 5EXLA 4KTUA 1W7XH 1WDIA 2ZA5A 3MU1A 3A82A 1Z8RA 3MOCA 1MH0A 3KNXA 1GI3A 1BCUH 3I18A 1W3CA 2BDBA 4MNWA 7GCHG 2AERH 1LHEH 2P94A 1HAZB 5CHBA 4Y79A 4X8VH 3NRLA 5EQRA 4K78A 2V0BA 1JOUB 3MH7A 1U6QA 3T5FH 3NCLA 1Q3PA 2KBSA 5T6FA 3BTME 4K72A 5E0HA 5FL7D 3V13A 4D8NA 4AFQA 1K32A 1FLEE 3ZZ8A 2H3LA 1BMFD 3UAIC 4JORA 1GHAG 3RMOH 4X6OA 4B75A 3RLEA 1OBXA 1G9OA 1MC7A 1MTNB 5EW2H 2KCYA 1L1JA 3A8CA 3QO6A 2F9PA 4JYUH 1UCYE 2OC7A 1C5LH 2K8IA 1NZQH 1TNKA 3BTWE 2PTNA 5EJLA 4JZDH 2XBVA 1H9HE 2BHGA 2Q6GA 1O3BA 3MWIU 3QGLA 2W5EA 2GCHF 2FYQA 5F03A 2KJPA 1E0FD 3K50A 3OTPA 2XCNA 2Y5GA 3PDZA 4FU9A 2L4SA 1ZPCA 1MKWK 3BF6H 3PV4A 1XUKA 1Y3VA 1XUFA 1OXGA 4ZKRU 4ABHA 3CENA 4WYUA 1PPBH 5F67A 2XWBI 1GJ8B 4X1SU 3NFKA 2MHOA 3IWMA 2KG2A 2NU4E 4AZ2B 3M7TA 5C17A 1ZSKA 1SGEE 2VVUA 3WY8A 3OU0A 2AYWA 4FUCA 1IQHA 4Q4LA 3RXDA 4Q7ZA 2IPHA 1G32B 3S9BA 5F53A 3GICB 4Y76A 4OS5A 2WV4A 5EXMA 1HAOH 1IQMA 1GGDB 2R0KA 1O3MA 1C4U2 2XRCA 1SB1H 3M5OA 3MU4A 2IOTA 3K2UA 3BEFB 3STJA 1RJXB 5F8TA 4AG1A 1DLKB 4X8TH 4JOGA 2OMJA 5L6NH 4NA8A 1O2PA 1C1WH 1GI5A 2PWXA 4ABDA 1ORFA 5GCHF 1H4WA 2GMTC 4WYTA 4R8TB 3FOAA 1N6XA 2J94A 5EGMA 1G3CA 1NTPA 1TNHA 2VWOA 4ZXXH 2OGPA 3ATWA 5A0CA 2EV8A 4MNVA 2OSGA 2ANKH 3LGVA 1SLWB 2QY0B 4Q7YA 3ENSB 4NG9H 5F8XA 2Z6BD 4Z0KA 1SQRA 3LJOA 1EAUA 2ALVA 2F4LA 4IN2A 3NFLA 4AB9A 3DFLA 3S0NA 1IHJA 3C1KA 2LP6A 2ENOA 4X6PA 1KTSB 2JKHA 2QKUA 2KOJA 2RDEA 1W14U 3RMLH 3UQVA 3PRDA 4NCYA 4F49A 2PDZA 3SI3H 2ZP0H 1CQQA 4QT8C 5EQQA 1YPMH 4JZEH 1UJVA 2J9NA 1MKXH 3QIKA 1UTMA 1C5RA 5LPFA 1JIMA 1FXYA 4B2AA 2D92A 3V12A 1LHCH 4ZMAH 2CHAC 2BLWA 1SKYE 5HEBA 5A0BA 2GX4A 4XSKU 4A92A 3EQ0H 1PDRA 5IYTA 4LK4A 3ELAH 1V2TT 4NIWA 2REYA 4I8GA 3LH3A 1VGCB 1V2JT 2HNTE 2NU1E 4HGCA 2OC1A 3U69H 1ETTH 1VZQH 4FLNA 3KCGH 5CE1A 5DJ7A 1N7TA 1ZJDA 2BLVA 3F2FA 2LC7A 2JETB 2WINI 1W0YH 1VCWA 1S85A 3MH4A 2XBXA 3GOVB 1A5HA 3HKJB 1GHAF 3TH2H 4TY7A 2CMYA 4U32A 1YPJH 1GQ4A 1O5GH 3AASA 1D3DB 1XZ9A 2DKRA 1VCPA 3RC5A 2R9PA 2TGAA 3OY5U 3QDZB 3R0FA 1S0QA 4NGAH 1UMAH 1IAUA 3B8JA 2Y80A 8GCHG 1E37B 2ZU1A 5B42A 2BY6X 4B6FA 2W7SA 2W4FA 2K20A 2RA0A 1ELCA 1NPMA 1WCZA 1GHWH 4H11A 1OBZA 1L4DA 3NZIA 1SPJA 1C5NH 1NROH 1LPGB 2P8OB 1OWDA 4YO9A 4THNH 2VNTA 2OQ5A 2M2AA 1GBAA 1V6DA 4MPAA 1LVBA 1U3BA 2FX6A 3LT3A 4TPYA 5LGOA 1SHYA 3V3MA 2GJGA 2KFWA 2L4TA 1RD3B 4IW4E 1N6YA 1QBNA 2UWOA 3CS7A 1KY9A 1V2MT 3AAUA 4CRGA 2PKSC 1IQIA 2V7QD 1UHPA 2C8XB 3Q77A 1SGFG 5K0HA 2IWQA 3RMMH 3LC3A 4CHAB 4NNLA 1P3CA 2KM0A 1UEPA 1GDNA 4BANB 4HOPB 3ITIA 5EG4A 1V2VT 2HE2A 1ANDA 1GVKB 1VAEA 4IC5A 3SUGA 4CRCA 1FZZA 3SNCA 4CRBA 1RGRA 1C9TA 3QX5H 1AY6H 1Q3OA 3B23B 4X8SH 1Q2WA 1KYNA 2FEQH 8ESTE 1A46H 1L2EA 5A09A 1A5GH 2ZC9H 2OK5A 2BDIA 5AF9H 2IJD1 1YCPK 2FWWA 3HPTB 2ANWA 2W6JD 2HVYB 4BXWA 3CH8A 5F3XA 2CF8H 3K65B 1WG6A 2P3FH 3ZZ7A 2M0VA 1GBJA 2Y5HA 4JJ3A 1UEWA 2QF3A 3MU8A 1EZUC 2PUQH 2AGGX 1A3EH 2CXVA 1QA0A 3O46A 2EDPA 2G4UA 1BDAA 3HGNA 6GCHG 4XBDA 1T7CA 4YESB 2HALA 3ZZ6A 1VITH 4NMTA 2BD7A 2RCEA 1WFGA 2H1UA 3NK8A 3M5NA 9LPRA 1TBRH 4MQAA 1SLUB 5JBAS 2QAAA 2VIPA 1O3IA 2VGCC 3O8DA 2GT8A 1QURH 3GY8A 3PB1E 3HPKA 1LDTT 2LELA 5G1EA 2KQFA 3MU5A 1SGCA 2VIOA 3KIDU 1BMAA 2FO9A 1GCTC 2VPHA 1DS2E 4YYXA 2FOBA 5PTPA 1GI1A 1MU8B 4A1TA 3CS0A 4RT1A 2UZCA 1LQDB 1TNIA 2BQ6B 3S7KB 3RXFA 2FNEA 1XVOA 1C2GA 2KR7A 2J38A 1ARCA 1IQJA 3P95A 1FN6A 2OQUA 1CGJE 1NRQH 3AAVA 1PQ7A 4FUGA 1HCGA 3F68H 3M3SA 1X8SA 1WQVH 5DTHA 1P2KA 4YLQH 2QF4A 1GBEA 3GJ9A 1DFPA 5E22A 3UB0A 4AOQA 3FZZA 1SGYE 5ABWA 1UF1A 2AS9A 1OYTH 8GCHF 5DP5A 3RXQA 1ETRH 2B7DH 1O3HA 4XD7D 3ZIAD 5ESBA 2Q9VA 3AW0A 2ZU4A 1FCFA 1MZDA 2STAE 2EAQA 2UUKB 2WV5A 2RFKC 1RTLA 1NF3C 1KDQB 2VWMA 1QBOA 1ZMJA 1UTPA 1O3GA 3L6PA 5FPTA 1DWCH 3OEHD 1AKSB 2ZU2A 1F5KU 3RXTA 5AHGH 1MFLA 4FVDA 4IBLH 1AE5A 1PPZA 3URDA 4B2CA 2PSXA 5GJ4B 2FOMB 4NIXA 1Q31A 4JOHA 1GJ6A 3LOXA 1F5LA 3SBKA 4KGAA 3HGPA 3PTNA 1OPHB 1ZUBA 1A0HB 3KYGA 2M5TA 2I6QA 4R0IA 1UJDA 1V2WT 2KA9A 1ZTLA 2JSNA 5IL9A 3EGHC 2YNAA 1C2EA 1BRAA 4VGCB 2VWNA 5KEDA 2HGAA 2CS5A 2GZ7A 3FKSD 4Y71A 1ELDE 1GJ4H 1LPZB 1P0SH 4CRAA 3N7EA 1MTVA 1EP5A 1ETSH 4PROA 3ZZ4A 3EE0B 4F48B 2ZGXH 1GBCA 4WF8A 1GHXH 2GTBA 3ID2A 1I16A 1O2MA 2A7HA 4H6SB 3I78A 3A86A 3TU7H 1MZAA 4NMQA 3SW2B 1C5SA 1FQ3A 3SJKA 3DD2H 4DG4A 2L74A 1UJUA 2BD5A 2TGDA 5J4QA 1DXPA 2O8MA 4K60A 1UEZA 5HFCA 1TGNA 6GCHF 1FC6A 3PLKA 3I1EA 1HAYB 1TA6A 1TPAE 1O2QA 3BIUH 1H8HD 1XM1A 4NMOA 3LGUA 4ASUD 9ESTA 3CP7A 3SU5A 1G9IE 1BIOA 3QWCH 4H6TA 1HAVA 1AB9B 1Y5UT 5DK1A 4KELA 3F6UH 2YT8A 1VKYA 3F0OA 4ZH8A 5I25A 4HTCH 2LOBA 3EGGC 4KTCA 1SHHB 2O8UA 4Q63A 1C1UH 3RM2H 1YC0A 1NO9H 1LTOA 1TONA 4UFDH 4ZCNA 1A61H 3SV7A 4FUIA 4NXQA 1GVZA 4BAOB 1P2IA 2OC0A 2SNWA 3ZV9A 5A8ZA 2VVVA 2TGTA 4KTSA 4WXVA 4NXPA 2GP9B 4OGYA 3A8AA 4ABFA 5C5NA 2OC8A 4AX9H 1KTTB 2F43B 1XUHA 3LKWA 2I0LA 1AN1E 1YWUA 2FDAA 1A2CH 3SO3A 1HIAA 3LNXA 2AFQB 4UD9H 5E8EH 1ZSJA 4M9FA 1KXAA 1O2GH 5AFYH 3KF2A 2YMSC 3GGEA 1B5GH 3E1XB 4JZ1A 5I7ZA 1AHTH 4MPWA 1AMHA 1FY5A 1C2HA 1LKAA 3TITA 1Z87A 1YP9A 2ODPA 1SGQE 2A5AA 4TPIZ 3N7OA 1ELVA 1KLTA 4A7IB 1AVGH 2SNVA 3P17H 4DOQA 4UU6A 4UFFH 1HFDA 2J34A 1T31A 3R3GB 1V2RT 2GKVE 4MPXA 3VQGA 2G52A 1TGSZ 3V7TA 3MQKC 4D9RA 1F0TA 6CHAB 4BOHA 5E2OA 2BY7X 5IDKA 1GVLA 2F9UA 5FPYA 4NMVA 2G5VA 1EAWA 2CV3A 1VITG 2WPMS 2QXJA 5DP4A 4FXGH 1N6EA 4X8UH 3QJMA 2VIDA 2I0IA 1UVSH 2A7JA 1H1BA 7KMEH 2WPJS 1HAHH 4O06A 2PKAB 1FX0B 3P8FA 3OFND 2DC2A 4OM9A 3SV8A 2PNTA 2ZNKH 3BTHE 1EZXC 3GSLA 3EA8A 1SC8U 2EGNA 2J95A 1AB9C 1L4ZA 1TMBH 1XUGA 3KZDA 1NBMD 1EPTC 2BDAA 3SNAA 5HEDA 1ZRKA 2PLXA 1C2JA 5EYZA 1THSH 4SGAE 3LGIA 2C3SA 1RIWB 2ZG0H 4X2VA 2JINA 5EOKA 3O5NA 1EPTA 2R3YA 1PPFE 3FANA 2R0LA 5FCRA 1QZ8A 1E34B 5EW1H 3NXPA 1KXCA 1RTFB 1UTNA 4Y8ZA 1P9UA 3ZVDA 5HFEA 4YDPA 3PO1B 1SQOA 3DJ1A 3TJOA 1PPHE 3UUZA 4DT7B 3L4FD 4J2YB 2PP6A 4FUDA 1D5GA 5JBTA 5A8YA 1QTFA 3VB3A 2OINA 3OX7U 3R69A 1WI2A 1O2SA 3P6ZB 1ELAA 2I6SA 2ZFTA 1AFQC 4Y6DA 1O2LA 1C1QA 4B71A 3M3VA 2QKTA 1MQ6A 1OX1A 1P3EA 1O3AA 1YCPM 4K3JA 2HWLB 1P2MA 3MNBA 3TSWA 4Q2PA 4GVDA 4FGMA 4MTBA 4JJ0A 4CBOA 1K1JA 1EXFA 1TE0A 4X2WA 1D9IA 4DT4A 2XNDD 2HPPH 6CHAC 4GVUA 1GPZA 1KXDA 5JXBA 1GG6C 2MX6A 1TX7A 5FAHA 3FZDA 1MU6B 2OUAA 2XYAA 3MU0A 3RXOA 3OSYA 3ODDA 3AVZA 5BPEA 2JIZD 3U1JB 4JOEA 1VJ6A 3N7DA 5C2ZA 2WPLS 1AVWA 1AWFH 1A0JA 2BZAA 4NWLA 1PPGE 4E34A 1KXFA 4FUBA 4DVAU 1H8ED 1DUAA 2ZDNA 1ELBA 1F92A 4DY7B 3T25A 2V3OH 1V6BA 2GDEH 2SGPE 1UITA 2KRGA 1TAWA 2GGVB 1V3XA 2J92A 1TA2A 3VGCB 2Z9KA 1BFEA 3ZVBA 1GJDB 3E0NB 1AFEH 2A1DB 3SUZA 1FDPA 1WAYB 1COWD 2FIRH 4GLYA 3IG6B 1ZHMA 2ODYB 1NM6A 4GHQA 1VITF 2EA3A 1HDTH 3PV5A 2ZU3A 1PQ5A 2BVXH 2ODQA 1N6DA 2OPGA 1UM7A 2CSSA 1HB0B 2H3MA 2VWRA 1Y5BT 3HK3B 1O32A 3A87A 4MVNA 1IU2A 3E90B 5HETA 1FNIA 3ATIA 5FCKA 3FFGA 1ZGIA 2BY5X 3ZZCA 1WYKA 4JYTA 3QK1A 2A5IA 1CT0E 2JJ2D 1TP3A 2BDGA 4E06H 1E36B 1T32A 2VIVA 2V90A 2M0TA 1H9IE 1YPHC 3DJ3A 1WHDA 1Z7KA 2C93B 1UCYH 3E3TA 3SGBE 3GS9A 3LU9B 1S6FA 3T62A 3ZZDA 1TBZH 1YBWA 1HJ9A 2D2DA 2SGDE 1E79D 1GJ7B 4NNMA 3QGNB 3KQBA 1CT4E 4ZUHA 4L8NA 1O3PB 3DA9B 3RMNH 1ZSLA 3VB4A 3TGKE 2ZFSA 4ISHH 2RRMA 4AYYB 2XXLA 3ATLA 3S7HB 1PYTD 2XNIA 2WPKS 2WUBA 3FP7E 4B73A 5DKMA 1F0UA 2FESH 1DLEA 1UHBB 1SGDE 1E35B 1P2JA 2ZHQH 5JBCS 1WTGH 2EI7A 5HXFA 1YPLH 3SU3A 2FMJA 3UY9A 1NC6A 3ID4A 4XDEA 1GBHA 4FUEA 3TK6A 1GMHG 1YGCH 3SZEA 2V3MA 2J4IA 1RFNA 4DIHH 1HJAC 4I31A 2ZFQH 1V2LT 4SGBE 3BTTE 4WH6A 3BTQE 2O8LA 2CF9H 1KWAA 5C1XA 2HE4A 1AZ8A 1V2QT 3T27A 1BRCE 4TT3D 2R2WU 4Y11E 2HPQH 3ZVGA 1SOTA 4OGXA 4ZAEA 1S5SA 3GCOA 1HAIH 3RU4D 2RDLA 1KSNA 5ETXA 1C1PA 2WSSD 2P3UB 4WH8A 3CNRA 1QRXA 4Q2KA 3VFEA 1Y5AT 1HNEE 3SQEE 1BTZA 5EJ1A 3U98H 2QF0A 1ZOKA 4X1RU 2A2XH 3U8OH 4AC9A 4JZIA 1J14A 3C27B 1G2MA 5DP7A 1FY3A 1EJNA 1T2MA 4OS1A 4AFUA 2EDZA 1F0SA 1ZR0A 4K1SA 5IK2D 1GJBB 4GAWA 4BNRA 1C5UA 3SV6A 1YLCA 1S84A 1GI7B 2AMDA 2M0ZA 1C2IA 3E91A 1G30B 1D4PB 4RKOB 1P06A 4TWYA 2BVRH 2V3HH 2XBWA 1SI5H 3P8GA 5C20A 1O39A 3R68A 2G5NA 1C4V2 4GSOA 1TMTH 1W10U 2A4QA 1O2IA 2THFB 4YXWD 3VB6A 3I29A 1SGRE 2H5DA 1O5BB 4BAHB 1GHVH 2A4GA 1UTOA 2QKVA 2LA8A 1E1QD 3FY5A 1GCDA 4ASHA 1GI8B 1MTNC 1TRNA 1YF4A 1EJMA 3A7ZA 1LHFH 3SZNA 3TK9A 2ZTXA 5DP3A 1GMCG 1ZMNA 1VR1H 4TY6A 2H2BA 2ZGHA 1EATA 3F9FA 3GABA 4GHNA 1OS8A 1TABE 2EGKA 2DE8A 2UUYA 4AGJA 1KXEA 1XMNB 1O5DH 1L0ZA 4O3TA 1DSTA 2GZ9A 2PZDA 1C1OA 7GCHF 2Y82A 1UJ1A 1UTLM 2ANYA 3BTEE 2P3WA 1K1MA 3LDXH 2XC4A 2WUCA 2OCVB 5DPAA 1EQ9A 2KAWA 4Q2QA 1W12U 3QZQA 3P92A 4NFFA 4YT6H 5HFFA 2ZGCA 1VJAU 1C5WB 3SU0A 1ZYOA 3KQDA 4U2WA 4ZKOU 1S6HA 1TX8A 1GHBG 2UWPA 5CMXH 4MNYA 1YY3A 1AE8H 1C5TA 3SHCH 4LOYH 1Y59T 1JRTA 3NWUA 4X2YA 1MKXK 1QL9A 2R3UA 4ZHLU 1ACBE 3SV2H 1W9OA 1QAVB 1DWDH 3PLPA 1GGDC 1O2OA 3LGYA 1SGFA 1JBUH 2PSYA 3WW7A 3BEUA 1GBLA 3T28A 2AINA 1C4Y2 4K2YA 3NCVA 3SGAE 2BVSH 1ANEA 4HFPB 3MI4A 1AQ7A 2GD4B 3OEED 3QGJA 1SFQB 2YOLA 1O37A 1F0RA 3MNSA 1B0EA 5E0GA 5GWZA 3BEIB 4ISIH 3ZZ3A 4AYVB 2BD8A 2BQWB 1TPSA 2ZDKA 5HJ1A 2DJTA 2Q3GA 4P0CA 2FM2A 1GMHF 2Y7XA 2Q6FA 3DIWA 5C1UA 3ZZBA 1O3CA 5C5OA 1G3BA 1LHGH 2Z3CA 1IOEA 3VEQB 1C2KA 2BZ6H 4BTIB 4CRFA 4CBNA 4IC6A 1BBRH 2Z9IA 3GY4A 3TSZA 2SGAA 1BBRE 1DY8A 2AGEX 2F9VA 2GCTB 3P8OA 2FXRA 1BMNH 3LC5A 3A80A 1QJ6B 2QXGA 3URCA 2IPQX 2QA9E 2DE9A 2ASUB 3GDUA 2HRVA 4ISNA 3TNSA 1H9LB 5HIZA 1WU1A 3RLYH 3D65E 1WXRA 4A5TS 4O3UA 3WKLA 3O8RA 4OEPA 1V2UT 1VGCC 3E17A 5GNDA 1AO5A 2J98B 1GBIA 3WKMA 2GV6A 8LPRA 2OP9A 1BJVA 2JETC 4XBCA 1YKTA 4RKJB 4A1XA 3VG8A 4ACBA 5CHAB 1ESBA 5J4SA 3VB7A 2FI5E 1DXWA 4INLA 4OS6A 5A0AE 3JZ2B 5FB8C 5T6GA 1OSSA 2K0QA 1GMCF 3LIWA 2VSPA 1XUIA 4BAKB 1OWHA 1F7ZA 2I6VA 1RRKA 1XX9A 2WPHS 4GCHG 1R6JA 2AMPA 1EZSC 2VWLA 2BX3A 3Q00A 1O2HA 5F8ZA 1K22H 3AXAA 2ZQ2A 4ABGA 1XKBC 2A2QH 2ZHWH 1N8OB 1CGIE 1FY4A 1UW7A 2KAIA 2P8OC 1XXDA 1X7AC 1JMOH 2ZPQA 1T4UH 5DN6D 3QJNA 1NU7B 3M61U 1BRUP 1G37A 1O3EA 4WXIA 1GHBF 2BXUH 3DFJA 1Y8TA 1V2ST 1CA0B 1QFKH 1IQNA 3GY5A 1QHRB 2WV9A 4JOKA 2UWLA 1GMDG 3RXVA 3TJNA 3VXFH 3MH6A 1BTPA 3N99A 2EHRA 2OBQA 2XCFA 1LVOA 4TSFD 1HJ8A 3SYJA 1D3TB 1LHDH 3GY6A 4RSPA 1OZIA 1ABIH 1WUNH 2Y7ZA 4HZHA 5GIBA 3T29A 4CHAC 1X45A 1CHOG 3SFJA 1Y3XA 5FPSA 1K0HA 1S0RA 3A81A 2BY8X 3BIVH 2VB0A 1OYQA 5KGOA 2W7RA 2XWAA 1GJCB 5HFDA 4HOPA 1JXPA 1Z6JH 3I77A 3LH1A 1ELFA 4I8LA 1GJ9B 1DITH 2ZPRA 4X1NU 1OP2A 2K1QA 3ZZAA 3SI4H 3TSVA 2Z17A 3TH4H 2EGOA 1BTXA 1T8OA 2KOHA 3UR6A 1BT7A 4FUHA 5TCAA 2PFEA 4X6NA 5E11A 1EZQA 1FPCH 2R4HA 1AGJA 1W2KH 2ZHFH 2O8WA 5GPIB 4ZXYH 1FAXA 2ZWLH 3DSPA 3DORA 1WBGB 3JXTA 3I4WA 2OBOA 4Y7AA 1MTSA 3ATMA 2F83A 1K2I1 3ZRTA 4X1PU 1HRTH 2BD2A 2AWXA 1P04A 2PGQB 3RXHA 2OS6A 3QE1A 1O35A 1SFIA 3BG4B 2R2MB 2ALPA 1UEQA 1FMGA 3M35A 3RXRA 1C1NA 3EA7A 4ISOA 1K1PA 2G2LA 2EQNA 4HG6A 3BG8A 2QYIA 4RT0A 3UFAA 1UVPA 1T8NA 2TBSA 1AIXH 3KQ5A 1N8OC 1S83A 3SOEA 1FIWA 3ZVAA 3RL8A 2I4SA 1EJAA 1O2ZA 2J2UA 1C1RA 4H42U 1WHAA 2WZQA 4CREA 1Y3WA 3GY2A 1WF8A 4ZHAA 1DOJA 4YZUA 1O38A 3SU6A 1EP6A 2A45B 5HM9A 3PDVA 1EAIA 1N99A 1C1TA 4AFZA 1AU8A 4CR9A 3RLWH 1CA0C 1YYY1 1Z8JB 1CBWB 3SGQE 1ZPBA 1DE7H 3HK6B 3IITA 4FUJA 4Q7XA 2BD4A 4Q6HA 3T2NA 1WFVA 4GCHF 4Z6AH 1IQKA 5KECA 1CT2E 1O2NA 1Z6EA 5H3JA 2G00A 2ZF0H 4GUXA 1PFXC 2G81E 1LPKB 1SGPE 2DMZA 1ABJH 3UOUA 1NFXA 3A89A 4MDSA 2HLDD 3TGIE 1A1RA 1N1LA 3TJVA 1QLCA 1O2XA 4ISLA 3A7TA 3WWBA 1S82A 3EYDA 4INHA 3KZEA 5C0TA 3LGWA 1NFYA 4LMMA 1VCQA 1IQGA 2RA3A 2V1WA 3RXAA 3GCHB 4I7YH 2HVXA 1SG8B 3D23A 4WMFA 2CK3D 3SV9A 5LH8A 4K6YA 4F55A 4XRNA 2JREA 1AKSA 1O2TA 1TGCA 4FU8A 1O3OA 1RTKA 3PTBA 1O2JA 1GMDF 2EI6A 4Y8YA 4AMHA 2XW9A 1D3QB 1HAGE 3TJUA 2VH6A 3RXUA 3K6YA 1UTQA 2H9EH 2EC9H 5E6PB 5HDYA 1O2RA 4VGCC 1DY9A 1K28D 1FJSA 1GDQA 1MTUA 3A85A 3HATH 1LVYA 3PMAB 1MTWA 4B74A 2GEFA 3F0PA 2Z3DA 2ZDLA 1V5QA 2QE7D 3PMHB 5EU8A 3W1EA 3RXJA 3SOSA 5TJXA 1A0LA 2QXHA 3W95A 2Z7FE 2ZEBA 2A4RA 1TRMA 4OEOA 1DWEH 2PUXB 4CH2B 1C5YB 2BXTH 1WOFA 1GBFA 1NY22 1ZTKA 1C5OH 4N6XA 2SFAA 2P95A 3RU4T 2V6NA 4JK5A 1F5RA 4E3BA 1HAXB 4TWWA 4JOJA 1BB0B 2C8ZB 1D6RA 1BRBE 3KL6A 1HPGA 2AWUA 3M7QA 2D8WA 5TCCA 1F2SE 1C5XB 3A88A 3K1RA 3H7OA 2HNTF 3MMGA 1QQUA 5H4IB 2VH0A 2C4FH 3SUFA 5EXNA 1JRSA 1EB2A 2FS8A 1B7XB 2KJKA 1YPHE 1MMJN 1DT2A 1V2OT 1GBMA 2FOGA 2G4TA 1TBQH 2EY4C 3QDOA 1N7EA 1GI0A 1O2UA 4K8BA 3D49H 2CN0H 2I04A 1ELGA 3RXBA 1PYTC 3CBXA 6ESTA 3MYWA 1LCYA 1CHGA 1OWKA 3UNRA 2BX4A 4K8YA 1TGBA 5HYOA 5JBBS 4JOPA 3SHWA 1KLJH 4BAMB 1UVUH 1Q3XA 4D7FA 5E2PA 2PV9B 1O2WA 1TQ0B 4X1QU 1MBQA 1W7GH 1ZZZA 1HV7A 1PPEE 2C8YB 2BB4A 5DGJA 1ZMLA 4XOJA 1O3LA 4DW2U 4HI3A 4MPUA 1C9PA 3RP2A 3SQHE 3PRBA 2ZDAH 3MH5A 4Y0ZE 3DJAA 1W0ZU 2OQSA 2LPRA 3QLPH 2J97A 4OS7A 4K1TA 4ZKNU 1BITA 1OOKB 1YPEH 1HGTH 1TLDA 1OHHD 3A7WA 1UFXA 2JXOA 3UWIA 1GJ5H 3KGPA 2B0FA 1C1SA 1PQ8A 3SJ8A 5B6LA 4CH8B 2AEIH 2BLOA 1O2YA 1IU0A 1QGFA 2FX4A 3K82A 3TLOA 1FC7A 3Q3YA 2HGTH 3TVJB 3GDVA 1W11U 2D26C 3OTJE 1PPCE 2UUFB 2VVCA 3KDKA 2XBYA 4NSYA 5EODA 3RDZA 1UTKA 3WWFA 3SJOA 5SGAE 2ZO3H 1P01A 3E0PB 2AH4X 4X0WU 1WI4A 2NWNA 3A83A 2YUYA 3Q76A 2WPDD 3FAOA 1O31A 4ESTE 4E05H 2OD3B 3H7TA 1O3FA 5K7RA 1MD7A 1TFXA 2ZGJA 2M10A 2KCPA 3DT0H 3TNTA 3BPUA 2OXSA 4BXSA 2BD9A 1NRRH 2PKAA 4Y7BA 3VPKA 1V2KT 2STBE 2JH0D 3GCTG 5L2YH 2F3CE 2BDYA 2BQ7B 5FHTA 3NPSA 5A2MH 2AIPA 1RIWC 2FP7B 2E7KA 1OWEA 4O03A 3TMHA 1C5PA 1G3EA 2IJOB 1EOLA 4J1YA 3SORA 1V5LA 3TH3H 1YBOA 1RS0A 2ILNA 1SOZA 2CSJA 1TPOA 1W0KD 3KHVA 4DGJA 4ABBA 2KCAA 1HYLA 3E16B 3PO1C 2KZ4A 2PTCE 1CU1A 2UUJB 2Z9LA 3RL7A 4NWKA 1K9OE 3ATKA 3P8NA 1BJUA 1EX3A 1WH1A 1QL8A 2C90B 2GMTB 2QN5T 2ULLA 3BTFE 4TYDA 2IWPA 2W7UA 3SNEA 3SUDA 1BOQA 4X2XA 3LPRA 1S81A 3Q3XA 1P1EA 5FX6A 1DPOA 4JMYA 1MKWH 3B9FH 4ABIA 3K9XB 5JPMH 2YTWA 1Z8IB 1ZLRA 3SU1A 3ZYDA 2VINA 2Z9GA 3RXIA 2TIOA 4Q3HA 1B0FA 3RXMA 3SU2A 2TRMA 4MPVA 4NXRA 1ELEE 5EPNA 3MO3A 2GZVA 1NS3A 1P2NA 1QB1A 3F1SB 3KQCA 1P12E 2WHXA 2OTVA 1GBKA 1CSOE 3RC4A 1MAYA 1QRZA 2QCYA 2PKUA 1EB1H 4E7NA 4FETA 1YPGH 1AZZA 3QZRA 1O5AB 1RZXA 1JWTA 2B8OH 1TGTA 4IGDA 7ESTE 2AWWA 2CHAB 1ZHRA 1BQYA 4XBBA 4UE7H 1SR5C 4MG3A 3RXLA 3A7VA 1KMHB 2A32A 4NIYA 4OAJA 8KME2 1UCYK 3KDGA 2H2ZA 3OYPA 4BTTB 1QJ1B 3SUEA 1TNJA 3FP6E 1T8LA 3EDXB 4XFQA 3CC0A 3MO6A 1JIRA 1E38B 2KCOA 3SU4A 3ZVFA 4LZ1H 4WY3A 3VGCC 1HAPH 4EDJA 5EIYA 3ESTA 2LUIA 2BDHA 2H2CA 2D1JA 1WQSA 5JYIA 2FODA 5HM2A 2FPZA 4ABJA 4P02A 1XVMA 5DSFA 2RCZA 1ANBA 1TRYA 2BOKA 1G2LA 1GHZA 2ZDMA 3F3BA 1U38A 1TP5A 2B9LA 1V1TA 4B6EA 1KEFA 5HF4A 1G36A 4I32A 1LQEA 3A84A 4NMSA 2F0AA 2BOHB 4CRDA 1NRPH 1J17T 1BMLA 5LPEA 5ILBA 1IQEA 3RXKA 4NMRA 1C5ZB 3E8LA 1W9EA 2A31A 1QAUA 2VRFA 1GI4A 4UFEH 4ZROA 2BDCA 2H9TH 3AW1A 2KJDA 2QXIA 4AFSA 3ZZ5A 3GCTF 1TQ7B 1TWXB 1HXFH 2ZKSA 7LPRA 1IHSH 2P93A 3PROA 3CYYA 5DO4H 4AORA 3U8RH 4KKDA 2GZ8A 3UIRA 4Q2NA 3NUMA 4ABEA 4K75A 1Z1JA 3SHUA 2PKSB 3TGJE 1L1NA 4DIIH 4UONA 1BTWA 1J9CH 3OAAD 3EA9A 1GI6A 5HKKD 1BTUA 1VJ9U 3MTYA 2A4OA 5C94A 1AUTC 1YPKH 1RGQA 1S6LA 3PMBB 3UNQA 1YLNA 2NU0E 2JIKA 1C2FA 4YLUA 4U30A 1P2QA 1RXPA 3NKKA 4JCNA 4ACAA 1AWHB 1UHBA 5HMAA 1EUFA 1Q7XA 2ZFPH 1P05A 1DM4B 3U28C 1H8IH 1TOMH 1QR3E 5GLJA 2IWNA 3AK5A 5C67A 2OCSA 4GPGA 1NRNH 4PQWA 2D8IA 4YT7H 4YTAA 1GL0E 1OWIA 4AN7A 1Z8GA 1BTYA 3MHWU 2G51A 1P03A 4XE4A 1MD8A 5T3HA 2LNCA 1K1IA 4Y8XA 3UR9A 1U37A 5BRRE 5HF1A 1KIGH 4ZHMU 2AHME 4BTUB 2FOEA 2TPIZ 3MFJA 4A6LA 4RN6A 3S69A 1X6DA 2PW8H 1UK4A 2WPIS 1ZGVA 1V62A 5EZ0A 1QL7A 4NZLA 1W9QA 3PS4A 1ANCA 3HPMA 2FOFA 2QT5A 2VSVA 2VGCB 2BYGA 2O9QA 2KAIB 2ZPLA 1Y3UA 3R0HA 4DCDA 2VIQA 3MO9A 1P8VC 4E35A 4ABAA 1CGHA 1GCTB 3EE7A 4JL7A 1O3NA 5DP9A 2FCFA 1AUJA 2BY9X 1OBYA 2FLRH 2ZCLP 1X5QA 2YNBA 1DWBH 2M3MA 1KLIH 1V2NT 1ESTA 3H09A 1Z1IA 3L3TA 3RC6A 1L1GA 1TOCB 2KX4A 2FOCA 2G55A 1MAXA 1XUJA 1YCPH 3MNCA 2IN2A 4NMPA 2P3TB 4IN1A 4NA9H 4U01A 3SNDA 3KHFA 1XXFA 5EPYA 4I86A 1DDJA 1BHXB 1NBME 3O8CA 1SGNE 1W0JD 1Z71A 1ZTJA 2KPLA 2DAZA 3FP8E 2W3KA 1MCVA 1EASA 1TX6A 2Y5FA 1WTHD 1GWAA 1X5NA 1Z86A 2V35A 3GYMA 2QG1A 4H4FA 2ZECA 2LC6A 1N6FA 2YT7A 4IS5A 1A5IA 1C5QA 1O5CB 1SL3A 1GBBA 1X5RA 4Z1MD 2EJYA 1OKXA 2H9HA 3UPEA 2IWOA 1MQ5A 1YM0A 3RUOA 1KXBA 1GQ5A 1C5MD 3VB5A 5D13A 1BBRK 2QGRA 1C5VA 4GVCA 1UK2A 5EJZA 1QB6A 3BN9A 3SN8A 4GHTA 1GJAB 1NTEA 1WV7H 4P2AB 5I46H 1LKBA 3UQOA 2PGBB 1QBVH 3F2GA 3W94A 1AVXA 2ANMH 2H6MA 1FY8E 1DVAH 1ID5H 4MNXA 2F9OA 1NU9A 4OS4A 5DP6A 1THPB 1QAVA 1WJLA 3ZYEA 3KQEA 1MBMA 1C1VH 1CVWH 3PWBA 2ZIQH 2ZI2H 2G8TA 2EI8A 4I8KA 5A2PA 1HLTH 1FV9A 1EKBB 2TGPZ 4IMZA 1RGWA 1VB7A 5F6MA 4JZFH 1EFRD 1I92A 3HVQC 1TNLA 2ZDVH 1O2KA 3A7YA 3GYLB 1ARBA 2ZPMA 1GI2A 1RY4A 5HIYA 4UEHH 2FE5A 2EEKA 2HNTC 4BAQB 2AMQA 3M36A 3V0XA 4I33A 2BMGB 2JJ1D 5DG6A 1HBTH 4K1EA 1DSUA 2GCTC 3CBYA 5ESTE 2WYJA 1G3DA 2L97A 1HXEH 1IHTH 5C0UA 1SVPA 2OZFA 3TPIZ 2VZ5A 1HAVB 1B8QA 1INCA 2H5CA 3GISB 1C2LA 3ZZ9A 3G01A 2QIQA 3GY7A 1Y7NA 4NZQA 1SGTA 3ID3A 1QB9A 2F91A 5L2ZH 2ZTZA 5T1VA 5AVDA 1TYNA 1K1NA 2SGQE 1FY1A 4P00A 5T6DA 1OP8A 3BTDE 3RXCA 1ELTA 3MNXA 3LONA 1P10A 2DB5A 1GM1A 2XC0A 3A7XA 1DICA 2WYGA 3LJJA 1QNJA 1CE5A 1SQTA 2P59A 3OY6U 1EOJA 3CBZA 1UVTH 2F9BH 2DLUA 1D6WA 1UM1A 2JWEA 1O3DA 1A3BH 1SQAA 1NESE 2PHBA 2PR3A 4I8HA 3PMJA 5CHAC 5FBIA 2QC2A 2Q1JA 2J98A 5G1DA 4UU5A 3U9AH 2HLCA 1HIAB 4F4OC 5EQSA 1ZRBA 1BMMH 1P02A 3O8BA 2ZQ1A 2OLGA 1VA8A 2FYRA 4DJZB 1C2MA 2ZFRH 3D62A 3PYHA 4WWYA 2KYLA 1P9SA 1FC9A 1PQAA 2L6OA 2NU3E 1FPHH 2ZHDA 2GV7A 2C8WB 1FAKH 1T4VH 2VU8E 1GL1A 1K1LA 2YMSB 3M37A 1YLDA 2FOAA 3SHAH 3ID1A 4AB8A 2O2TA 3QN7A 1TMUH 2XTTB 3T26A 4D7GA 3FVFB 1CA8B 1GBTA 3E6PH 2VBCA 1ESAA 2QF5A 1TALA 2DUCA 3DSOA 3F2HA 4WMEA 1WF7A 5LPRA 5GXPA 2AIQA 2EXGA 3GDSA 1D3PB 1SMFE 3VXEH 4R2ZA 1QJ7B 3DHKH 1LMWB 1IQLA 4IMQA 1BA8B 5CDFE 3GY3A 2SGFE 3KN2A 2Q6DA 3DSGA 4UDWH 4X6MA 3F9HA 1M9UA 2QBWA 1XKAC 1O5EH 1ZPZA 2D90A 2FZZA 3K6ZA 4ZKSU 4KP0A 3A8BA 4A1VA 2EEHA 2AGIX 4AG2A 1IQFA 3RU4E 2GT7A 1SSXA 4REYA 2A7CA 2PKTA 1FIZA 4K69A 1TIOA 4Q6SA 5A8XA 1GHYH 4FU7A 4F8KA 4NFEA 1SGIB 2DLSA 1SLXB 5DP8A 4YOGA 2EEGA 1EPTB 1KDQA 2FTMA 3M3TA 3BSQA 2XC5A 3GCNA 1W8BH 2VIWA 1NRSH 2CJIA 5FX5A 5G4BA 2BLQA 4CR5A 4NSVA 3RXPA 3UREA 1O30A 2ZFFH 1SLVB 2BTCE 1MFGA 4K76A 3F9GA 1E1RD 4B2BA 3ODFA 1NT1A 1O33A 1U39A 2K1ZA 3PM3A 4INKA 3ZV8A 1K1OA 2ZGBH 3TIUA 1O36A 2Z9JA 1K21H 3RXEA 5HEYA 1CHOF 1GI9B 1J16A 3SNBA 5E1YA 1FN8A 4G69A 3BG4C 2JH5D 4KFWA 3DCLA 2W3IA 1TB6H 3NGHA 4M7GA 1O3JA 1QRWA 2FS9A 4XHVA 1TQ3A 1WSSH 2ZPSA 2WL7A 1HUTH 2W26A 2RG3A 3Q3KA 3EAJA 1OP0A 3HKIB 2M0UA 1DX5M 2BD3A 3B76A 1QQ4A 4WVPE 3H5CB 1AFQB 2KOMA 1MABB 4K5ZA 4RI0A 3SJ9A 1QA7A 3OE7D 2JDID 5HFBA 1QCPA 5JB9S 2KPKA 5JB8S 1P09A 2DM8A 1MUEB 3A8DA 3VQFA 1UK3A 2ZCKP 3PLBA 1W13U 3UTUH 1SBWA 2W6ID 4AGKA 1Y3YA 1GG6B 2ESTE 3ZVEA 2Y81A 1CBWC 1UO6A 1O2VA 3RXGA 4B76A 4D9QA 3BTKE 2ZU5A 4WMDA 1NN6A 2G5MB 1DANH 1A4WH 4O97A 3QTVH 4FVBA 4D76A 2FTLE 1NFWA 2PA1A 3JZ1B 1BUIA 1BHXF 3ZVCA 1WIFA 4DURA 1P2OA 3STIA 2B5TB 2HOBA 2FLBH 2J5UA 3M5LA 5B6OA 2F5YA 2Z3EA 3U8TH 1BE9A 2SGEE 4Q2OA 1BTHH 2JOAA 3GCHC 3TK5A 2EEIA 4NA7A 4JYVH 1O3KA 3SJIA 4JK6A 3RM0H 1P57B 1ZOMA 3DUXH 3LNYA 2P16A 5GDSH 2ZTYA 3UWJH 1L6OA 4B1TA 3LGTA 1PJPA 5FBEA 2KL1A 5JDUB 3BTGE 2GCHG 2F9NA 4I8JA 1M5ZA 3QTOH 3S9CA 2JH6D 3QUMP 1FI8A 1OWJA 1GDUA 5AFZH 3UOPA 1N7FA 1MCTA 3S9AA 5C3NA 4Z8JA 3PV2A 2Z94A 3L33A 2ZHEH 4O9VA 1P11E 1J15A 1TPPA 4Q80A 4Y10E 3PWCA 1H8DH 2EDVA 4Z33A 3EGKH 1C1MA 3FN8A 1UTJA 1LO6A 2QV1A 2FI4E 4FOUC 1O5FH 4UFGH 2I1NA 3UNSA 1THRH 1V2PT 4YOIA 4MLFB 4E7RG 1T8MA 2ZCHP 2A5KA 1UVOA 2KV8A 3M5MA 5E21A 5FXLA 4LXBH 1ZHPA 1O34A 5HGGA 3P70B 2ZZUH 3M7UA 1P1DA 1ZJKA 3RXSA 2XOKD 4KFVA 5GCHG 4NIVA 5E0JA 2X7ZA 1J8AA 2NU2E 2YUBA 1QY6A 3BV9B 3KEEA 4WJG2
chains in the Genus database with same CATH topology
1NFUA 3F9EA 2BYAX 1QIXB 5L30H 2EEJA 2FOHA 2FN5A 2BM2A 6LPRA 1TNGA 1FONA 1GBDA 1O0DH 4YM9A 1HJAB 1C2DA 1A7SA 3U1IB 4Y0YE 2GDDA 5C1YA 1BZXE 2O8TA 4FUFA 1DUEA 1X9ZA 1CO7E 2CGAA 2GVFA 1AD8H 4LZ4B 2VJ1A 1AI8H 2JILA 4YOJA 4JOFA 2FI3E 1LVMA 4OS2A 1FUJA 1EAXA 2A0QB 2Y6TA 5EXLA 4KTUA 1W7XH 2ZA5A 3MU1A 3A82A 1Z8RA 3MOCA 1MH0A 3KNXA 1GI3A 1BCUH 3I18A 1W3CA 2BDBA 4MNWA 7GCHG 2AERH 1LHEH 2P94A 1HAZB 4Y79A 4X8VH 5EQRA 4K78A 2V0BA 1JOUB 3MH7A 1U6QA 3T5FH 3NCLA 1Q3PA 2KBSA 5T6FA 3BTME 4K72A 5E0HA 3V13A 4D8NA 4AFQA 1K32A 1FLEE 3ZZ8A 2H3LA 4JORA 1GHAG 3RMOH 4X6OA 4B75A 3RLEA 1OBXA 1G9OA 1MC7A 1MTNB 5EW2H 3A8CA 1L1JA 3QO6A 2F9PA 4JYUH 1UCYE 2OC7A 1C5LH 1NZQH 1TNKA 3BTWE 2PTNA 4JZDH 2XBVA 1H9HE 2BHGA 2Q6GA 1O3BA 3MWIU 3QGLA 2W5EA 2GCHF 2FYQA 5F03A 2KJPA 1E0FD 3K50A 3OTPA 2XCNA 2Y5GA 3PDZA 4FU9A 2L4SA 1ZPCA 1MKWK 3BF6H 3PV4A 1XUKA 1Y3VA 1XUFA 1OXGA 4ZKRU 4ABHA 3CENA 4WYUA 1PPBH 5F67A 2XWBI 1GJ8B 4X1SU 3NFKA 2MHOA 3IWMA 2KG2A 2NU4E 4AZ2B 3M7TA 1ZSKA 1SGEE 2VVUA 3WY8A 3OU0A 2AYWA 4FUCA 1IQHA 3RXDA 4Q7ZA 2IPHA 1G32B 3S9BA 3GICB 4Y76A 4OS5A 2WV4A 5EXMA 1HAOH 1IQMA 1GGDB 2R0KA 1O3MA 1C4U2 2XRCA 1SB1H 3M5OA 3MU4A 2IOTA 3K2UA 3BEFB 3STJA 1RJXB 5F8TA 4AG1A 1DLKB 4X8TH 4JOGA 2OMJA 5L6NH 4NA8A 1O2PA 1C1WH 1GI5A 2PWXA 4ABDA 1ORFA 5GCHF 1H4WA 2GMTC 4WYTA 4R8TB 1N6XA 2J94A 5EGMA 1G3CA 1NTPA 1TNHA 2VWOA 4ZXXH 2OGPA 3ATWA 5A0CA 2EV8A 4MNVA 2OSGA 2ANKH 3LGVA 1SLWB 2QY0B 4Q7YA 3ENSB 4NG9H 5F8XA 2Z6BD 4Z0KA 3LJOA 1EAUA 2ALVA 4IN2A 3NFLA 4AB9A 3DFLA 3S0NA 1IHJA 3C1KA 2ENOA 4X6PA 1KTSB 2JKHA 2QKUA 2KOJA 1W14U 3RMLH 3UQVA 4NCYA 4F49A 2PDZA 3SI3H 2ZP0H 1CQQA 4QT8C 5EQQA 1YPMH 4JZEH 1UJVA 2J9NA 1MKXH 3QIKA 1UTMA 1C5RA 5LPFA 1JIMA 1FXYA 4B2AA 2D92A 3V12A 1LHCH 4ZMAH 2CHAC 2BLWA 5HEBA 5A0BA 2GX4A 4XSKU 4A92A 3EQ0H 1PDRA 5IYTA 4LK4A 3ELAH 1V2TT 4NIWA 2REYA 4I8GA 3LH3A 1VGCB 1V2JT 2HNTE 2NU1E 4HGCA 2OC1A 3U69H 1ETTH 1VZQH 4FLNA 3KCGH 5CE1A 5DJ7A 1N7TA 1ZJDA 2BLVA 2LC7A 2JETB 2WINI 1W0YH 1VCWA 1S85A 3MH4A 2XBXA 3GOVB 1A5HA 3HKJB 1GHAF 3TH2H 4TY7A 2CMYA 4U32A 1YPJH 1GQ4A 1O5GH 3AASA 1D3DB 1XZ9A 2DKRA 1VCPA 3RC5A 2R9PA 2TGAA 3OY5U 3QDZB </