3GCOA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyqf omp peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
302
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
total genus 59
structure length 302
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA01
3KF2A 2CHAB 2ZPMA 5HJ1A 1GBHA 4CBNA 1PQ5A 2BY7X 2QKTA 1UTJA 2HWLB 3OY6U 1WFGA 4XOJA 3IG6B 2AWUA 1MZDA 5ETXA 3K1RA 2AWXA 1BFEA 5HEYA 4B71A 3MNSA 1FY5A 2UWLA 2W7UA 1NRSH 3LNXA 2ZU3A 5A0BA 4Q6SA 1O34A 2G5MB 2ZPQA 1DS2E 4ZH8A 2VWOA 1TIOA 4K60A 1RIWC 1ZPZA 4IN1A 2AEIH 2AERH 1Q3PA 1UCYH 1JIMA 4CRCA 1EP5A 3LIWA 1QAVB 1Y5AT 1P8VC 2ANYA 5CHAB 2XTTB 1FPHH 2PKAA 2BDBA 2KAIB 2KBSA 4NG9H 4O97A 3GCHC 3AVZA 1TX8A 2ANMH 1NTEA 4WYTA 1B8QA 2A4OA 1LVBA 3F1SB 2EDVA 3EA9A 1RGWA 3V12A 1DSUA 1HAOH 1C5OH 2D8IA 2P3WA 1IQFA 1E37B 4CRFA 1JWTA 1AB9B 4FU7A 6ESTA 1GJCB 2PZDA 1K1MA 1ZOMA 3RL7A 2AIPA 1X7AC 2KA9A 3L6PA 1E0FD 1BBRK 1G3EA 1O2HA 1R6JA 1O3EA 1W12U 1XUIA 1C5WB 2ZFRH 5EODA 1ABJH 4YO9A 1EZXC 1GJ9B 1HYLA 1EX3A 3ODDA 4KP0A 5JBCS 2OPGA 1QB9A 2DE9A 1V1TA 4JOFA 1O3OA 5A2PA 1C5NH 2BOKA 3OX7U 4NMSA 4NWKA 5EQQA 4A1XA 4JYUH 1AIXH 2HNTC 1RXPA 4X8SH 4BXWA 4JK6A 3RC6A 1TRNA 3LT3A 1Z8JB 1GMDG 1C1TA 3U8OH 4I8JA 2Q9VA 4NZLA 1MFGA 4Q2PA 1KTSB 2ASUB 2NU4E 3MYWA 1TAWA 2UUYA 1NFYA 1H1BA 4B75A 1BMMH 1C2KA 1P11E 3SHWA 3DFJA 5C1XA 1MKWK 2YUBA 4YYXA 1QB1A 1TGSZ 4BAQB 4WMFA 2KAWA 5HFFA 1TBRH 1N8OB 1QAVA 4OEOA 5GLJA 4UD9H 1SGQE 2O8TA 4U32A 2KAIA 2RCZA 1WF8A 5HF1A 2K1ZA 2VIPA 4Y71A 4YDPA 2VWNA 3KN2A 4Q80A 4O03A 4Y0YE 2F5YA 1O3IA 1OWIA 4E05H 4YOJA 1O2NA 3O8CA 2BX4A 2PW8H 2ZCHP 2PWXA 3V7TA 1XUHA 4F4OC 1PPCE 3SORA 3PMBB 1MFLA 3QGLA 1LKAA 1S5SA 4AFUA 4X1QU 2AYWA 4SGAE 3ZZ6A 2K1QA 1UEZA 1W7XH 1QRZA 2XC0A 5LPEA 4YT7H 4MQAA 4K5ZA 4MPVA 1LVYA 1C5LH 1ZZZA 1O3LA 2GT7A 4Y79A 5DKMA 3GYLB 2BVSH 4Y11E 1BTZA 1P09A 1C2HA 1C2IA 1LDTT 1T8OA 1INCA 1HV7A 3RXOA 2HPPH 3GDSA 3ZVAA 2H2ZA 2STAE 1CVWH 2GGVB 3SOSA 4O3TA 2JILA 1FXYA 1O2ZA 1O3PB 3NPSA 4E35A 5HFDA 1JBUH 2ZHQH 1PYTC 1BA8B 4A1VA 4Y7AA 4TPYA 3FZZA 1Z86A 2KG2A 4JK5A 1L4ZA 4Y6DA 2FCFA 3U98H 1QIXB 2H2BA 1P02A 3Q3YA 3P70B 1X5RA 5L30H 2ESTE 2ZTXA 4B1TA 4K69A 1W0YH 1NZQH 2UWPA 2EC9H 3KHFA 4GVUA 1UTKA 4OS1A 1SOTA 3STIA 1RTFB 3GY2A 3LONA 3UOUA 1B0EA 2VINA 1SR5C 1P2NA 1SB1H 5GDSH 1J16A 3SNCA 1C2JA 2I6VA 3ID3A 1QL8A 2A7HA 1GI3A 1C1QA 1OXGA 1KXCA 1V2TT 2QIQA 1AWHB 2OSGA 4I8KA 3BTWE 3GICB 2R4HA 1BHXF 2Z17A 3RMNH 3HK6B 1TX7A 2M0TA 3EYDA 4LZ4B 1WH1A 2EGOA 2FI4E 1EZSC 3PB1E 5GCHG 2F9UA 4VGCB 3TIUA 3RXJA 1DUEA 3DORA 1YCPK 4K6YA 2SGQE 1Y3VA 3R0HA 3RXGA 2Y80A 2ZECA 5TJXA 2FOMB 2ODQA 1A2CH 1E35B 3ZZ4A 1WU1A 3ZZ5A 4X8TH 1TWXB 4NIVA 3RXRA 5HFCA 1W7GH 4Y10E 3ODFA 2F83A 1XZ9A 2AH4X 1Q3OA 4ABBA 1EOJA 1A0JA 4F8KA 2Q6GA 4E7RG 1HAIH 4INHA 5F8TA 4ISNA 2Z7FE 2QN5T 1AI8H 1C2EA 3HKJB 5JDUB 1MBQA 2B9LA 1PYTD 1BTYA 1AVWA 1O37A 1O2WA 3TVJB 2XWAA 4HGCA 3GY6A 1XXDA 4U01A 4Q2OA 1WI2A 1C5XB 3EDXB 4IMQA 2XCFA 1IQIA 3AAUA 1IQEA 4CRBA 2HGTH 1TLDA 3IWMA 3CBYA 4INKA 1AVXA 2JH6D 2ZG0H 2VNTA 4MG3A 1TFXA 3HGPA 3ATMA 1QURH 5HF4A 2A32A 1TA6A 2PR3A 1VJ6A 3E16B 4NZQA 4Q6HA 1SLUB 1YCPM 4OS6A 2CF9H 4I8LA 1O2TA 1VJ9U 1C1UH 3ESTA 1T8MA 3KGPA 1EAIA 3PMJA 3QJNA 5EXLA 2M0UA 1TNGA 4MNYA 3S0NA 1HIAB 5EPYA 3NFLA 1SLXB 5DP3A 1NFXA 4X1NU 2Q1JA 2VB0A 5T6DA 2H3LA 1O2OA 3TLOA 4AG2A 1V6BA 2SNVA 1XKAC 5LGOA 2Z9IA 4MLFB 1TMTH 3M3VA 1NRPH 2FX6A 2FO9A 3CYYA 1ARCA 4AFZA 4FU9A 5A0CA 1X5QA 5D13A 1G30B 2PV9B 4NGAH 2ZFFH 2ZU5A 1L4DA 3T2NA 2G4UA 2WUCA 1H9IE 1O3DA 1ZGIA 2QC2A 1I92A 1GBJA 1YPEH 4RI0A 3Q00A 3RXCA 2E7KA 3PV4A 1H8IH 1OYTH 1Z8GA 2GV7A 3SU5A 2QT5A 1TOCB 3RXAA 1O3HA 2ZTZA 2ZIQH 2PKSB 1DUAA 2SNWA 2Y82A 3ATIA 5C2ZA 4K8BA 1GVLA 4KELA 1DICA 1V6DA 2WPKS 1PPEE 3RXSA 4YTAA 3ZVGA 2ZC9H 3PO1B 2J34A 3QDZB 1FONA 3A7ZA 3R3GB 1AE5A 1BTHH 1C5ZB 2LUIA 2KPLA 2R2WU 3AASA 4XBBA 2CGAA 2FEQH 1SGDE 2OQ5A 3QK1A 2DC2A 3ZVFA 4PQWA 1E36B 3MHWU 4I32A 1UM1A 3TK9A 4K76A 3ZZ8A 2QF3A 4LOYH 1HIAA 2V90A 1AWFH 9LPRA 5JXBA 4AGJA 5CMXH 3RXMA 1UK4A 2A1DB 2A45B 2GDDA 3QWCH 1NRNH 5A8XA 4K78A 1C5PA 1EXFA 1TE0A 4JOJA 1MTUA 1YPHE 3HPTB 3RDZA 1M9UA 1V2LT 4BAMB 1W10U 4AOQA 2WINI 2OZFA 1FN8A 1FY4A 2QXJA 5GIBA 2J94A 1W9OA 2HNTF 1RD3B 3D62A 4OS5A 1D9IA 2Y5FA 5FPTA 1WV7H 1GJ8B 1CHOG 3MNCA 2OC0A 7ESTE 1HPGA 1LPKB 3O8RA 3GDVA 3SGQE 2RG3A 2IWOA 2JKHA 1OP2A 2ZZUH 1C5SA 3QLPH 2KOJA 1ZMLA 3RXDA 1MKWH 3D65E 4ZMAH 3E1XB 5C3NA 3RMMH 2A4QA 3D23A 1O32A 1EUFA 2Y7XA 5C5OA 3PLBA 1A4WH 2ZDAH 2WPIS 1GVKB 1IHJA 4K3JA 1DY9A 2L97A 3DJ3A 4JYVH 2ULLA 1AN1E 2L4TA 1K9OE 2ZF0H 4PROA 2QBWA 1BITA 3RU4T 3PLPA 4Z33A 2R3YA 1FPCH 3EGHC 3LPRA 3F9GA 1VGCB 8GCHF 2ZGCA 2NWNA 4GVCA 5GWZA 3F6UH 2FOFA 2JREA 1BBRE 4NMVA 3BTTE 4I31A 2ZGHA 1ELCA 1LHDH 4JOKA 1QQ4A 1LHEH 2ZDVH 3HPKA 4A6LA 1PQAA 1CA0C 3ZZAA 3F9HA 1ZHPA 1FCFA 8GCHG 2I4SA 3JXTA 1K1IA 5CE1A 1IOEA 1GMHG 3ATWA 3SI4H 4BOHA 4Q2NA 2Y7ZA 2V3HH 2HGAA 3TNTA 3SU0A 1CO7E 4ABIA 1SVPA 1YGCH 2FWWA 2JH5D 3MWIU 4CHAB 1N7FA 2TGTA 1P10A 1GDUA 1B0FA 4GLYA 4ABGA 5F8ZA 3GCTF 1AZ8A 1AVGH 3UTUH 1RFNA 3LGVA 1YYY1 1Y3UA 2RA3A 4B2CA 1QBVH 3AXAA 3UUZA 5HFEA 2BMGB 3KQCA 3DUXH 5JYIA 3A83A 2FZZA 5LPRA 1O2PA 3UNSA 3B76A 1GJ7B 2FYQA 2F9PA 3LC5A 2OMJA 1GJBB 2CHAC 2FIRH 3B8JA 4RKJB 4LMMA 3RU4D 4X6NA 1YF4A 4OS7A 5A09A 3W95A 2GCHF 1GBCA 4DURA 4BAKB 2H9TH 1F92A 4B76A 1C1OA 2I6SA 5EQSA 3A8CA 4YLQH 3ZZ3A 3BV9B 1XKBC 1F0SA 3T27A 2R0KA 3WKMA 1UJVA 2OXSA 2PFEA 3LGTA 1ELVA 4NSVA 1G2MA 3GCNA 4I8HA 1EATA 2PLXA 4NFFA 1WOFA 2GCHG 3K6YA 2QF0A 4KGAA 1MAYA 5CHAC 2Z6BD 2PDZA 5FXLA 4DVAU 3KZDA 1K2I1 3EE0B 1BTUA 3GY7A 1C9TA 1TX6A 1XM1A 1YCPH 2R9PA 3M7QA 1XVOA 3DT0H 4AMHA 2KQFA 1ANDA 1F5LA 4Q7XA 7GCHF 1OWHA 1FC7A 2FLBH 4CRDA 8LPRA 1RY4A 2JETC 4Z0KA 5AF9H 3QTVH 2H9HA 3UIRA 2ZGBH 1AB9C 1ELTA 1MKXK 4THNH 3RXPA 1SFIA 2IPHA 2OGPA 3U9AH 3KZEA 4OGYA 3EA7A 3RXQA 2YTWA 2OD3B 3TH4H 7GCHG 3A8DA 1ZHRA 1UEQA 1AGJA 3TPIZ 1OBYA 2TRMA 2W7RA 1H4WA 1D3DB 1HAYB 1O2KA 2D92A 1K22H 1YLDA 2QKVA 3LDXH 4O9VA 2ZQ1A 4YOGA 4AB9A 1NU9A 2XC5A 2BD2A 1WBGB 2LC7A 2BTCE 2BD5A 1OZIA 1NU7B 2AGEX 2C8XB 4DOQA 1SGEE 4WYUA 1RJXB 3VB3A 2OUAA 4NMTA 3M7UA 4NNLA 4TYDA 3QN7A 5IYTA 5HM2A 2BX3A 4WF8A 1MQ5A 1AUTC 3GY5A 3B9FH 2XBYA 3CC0A 5GJ4B 1WF7A 1S6FA 1H8DH 2OP9A 5FPSA 1N8OC 3QJMA 1D5GA 4GUXA 1TMUH 4Y0ZE 2YOLA 1ZMNA 2GV6A 1AZZA 3ZVBA 4OEPA 1GHWH 1P57B 1F7ZA 2BD7A 2G4TA 4YESB 3QGNB 3LJOA 1AUJA 1NO9H 8ESTE 1NTPA 5GNDA 1HRTH 2P3FH 4N6XA 5F8XA 1Y3XA 4ZXYH 3LGYA 4GVDA 5IDKA 1V2KT 4CH8B 1UK3A 1VITH 1L6OA 1MMJN 1S84A 1P2IA 2BY6X 1Q31A 1GGDB 1SGFA 1O2IA 1KXBA 1D3PB 4O3UA 5JBAS 3T29A 2BQ6B 1BOQA 1LVOA 1SGTA 2ZCLP 4CR9A 1BCUH 3SJ9A 1YPJH 4IN2A 4LK4A 3BTKE 3SOEA 2JETB 2CXVA 1F5RA 4AX9H 2PA1A 3SU2A 2BLOA 3F68H 1J15A 1YP9A 1OS8A 1DWBH 4KTCA 3DD2H 1JOUB 5HM9A 3TSVA 4MNWA 1GHYH 1UTNA 5FBIA 3SBKA 1UVPA 1GMDF 1GI5A 1SGCA 3T26A 1IQLA 3BEUA 5A8YA 2UUFB 1UJDA 3TITA 1SLVB 3SW2B 3RXHA 3BN9A 1P9SA 5C20A 4UU5A 3ITIA 1BT7A 1O2MA 1W0ZU 3GYMA 2NU1E 3DJAA 2O9QA 3PMHB 3RXVA 1V5LA 5C67A 1P12E 2BD8A 1AFQC 2SGFE 5DG6A 1TGNA 4G69A 2CS5A 5B6LA 2ZHWH 4A1TA 4FUFA 4WY3A 2SFAA 2EGNA 1HDTH 1O5BB 3M35A 4JZFH 4NSYA 4ZUHA 3DA9B 4F49A 2FS9A 5I46H 4DT7B 1HFDA 4GHTA 3TH3H 2QKUA 4K75A 4ABAA 2Y5GA 4D9QA 5ESTE 1TNIA 2OS6A 3H7OA 4DW2U 5G4BA 1MH0A 2AMPA 1M5ZA 1TONA 3H5CB 3RMOH 3BTDE 5DP7A 3SQHE 3VFEA 5J4SA 4CBOA 2B0FA 1NFUA 2V35A 2EXGA 3NUMA 1P2MA 1LPZB 1F0UA 3WKLA 3C27B 4VGCC 2JIKA 4E3BA 1GI2A 1ELAA 1UCYE 5DP6A 3SGAE 4SGBE 5GXPA 2OLGA 4Q2QA 4X1SU 2C4FH 1WG6A 5DO4H 4OGXA 3P92A 1A3EH 1P2JA 1T8NA 1T4VH 2VJ1A 1IQGA 1C1MA 1OP8A 4I33A 4P0CA 3ZRTA 2HE2A 4OS2A 1SOZA 5EG4A 2A4RA 2BD9A 1ELFA 2VIDA 4A7IB 1XX9A 1V2ST 2FI3E 3A82A 3LGUA 1Z87A 2QG1A 2FN5A 1V2VT 1Y59T 1UEPA 2M10A 4FUHA 4IGDA 1MU8B 1C4V2 1T7CA 2I0LA 2EEKA 1CU1A 1MTVA 4NXPA 1FNIA 4AFSA 1FC9A 2BHGA 5E21A 2BY5X 2ZU2A 2JH0D 3BTGE 3KQBA 3ZV8A 2WL7A 1GHBF 1RGRA 4K1TA 1MZAA 2FMJA 4X6OA 3NWUA 5JBBS 3RL8A 1S82A 1O3CA 1MAXA 1BE9A 2ODYB 1VR1H 3ZV9A 4K8YA 4DCDA 3BTFE 4JYTA 3Q77A 4X1PU 1V2NT 1SHHB 4Y76A 2LOBA 1AFQB 1EAUA 3M61U 1ZPCA 1ELGA 2V6NA 3ENSB 1TBZH 2IJOB 1C5VA 1KDQB 1SC8U 5DP5A 1XUGA 3ZZBA 3JZ2B 1FIWA 4DIHH 1O33A 1GHBG 2OINA 2WYJA 2ZFPH 1G9OA 3SJ8A 1GHXH 6LPRA 2EEIA 1N6XA 1N6YA 1B5GH 1XUKA 3VQGA 3CS7A 5GCHF 3GGEA 3SUDA 1BRUP 4NIXA 1AHTH 1GBEA 5HFBA 1C4U2 3W94A 4DGJA 1YPHC 1W9QA 2A2QH 3FY5A 2FOAA 4XFQA 1ZHMA 1MCVA 1UO6A 2FI5E 2VVCA 2EDZA 1IQKA 4YT6H 1GPZA 3MOCA 4X0WU 1EJNA 1JRTA 1O2LA 2CV3A 1WQSA 1C2LA 1KIGH 1ZUBA 1UK2A 1FI8A 1OYQA 1ZJDA 4ABFA 2IOTA 5AVDA 3E17A 2IWQA 2THFB 2DMZA 2FDAA 2F9OA 4ASHA 3NCLA 4IMZA 1UTPA 3SU6A 4KFVA 1W3CA 9ESTA 1EAWA 2EI6A 2ZWLH 3TGKE 4X2WA 4X6PA 1UFXA 1TGBA 4JZIA 1UM7A 4ZKNU 2B8OH 2ZHFH 2PKSC 3MH4A 4MPWA 5EXMA 3URCA 1TALA 3M7TA 1CBWC 5ESBA 1FN6A 2ALPA 1C1WH 3ZVDA 3S9CA 3T25A 2UUJB 2FOGA 3M37A 1BMNH 1LTOA 3PO1C 4NFEA 3T5FH 4Z8JA 4WXIA 2O8WA 1KXAA 5JPMH 1DLEA 1O35A 2GKVE 1NRRH 3ZZ9A 1QBNA 1KDQA 5C1UA 1O30A 1KTTB 2YT7A 1RGQA 2BXUH 2NU0E 2AMQA 1H9HE 3JZ1B 3PMAB 1EKBB 2G81E 2NU2E 1GG6C 1MC7A 2ZPLA 3PDZA 4JORA 3SHUA 1ZGVA 2PGQB 4MNXA 4X2YA 1QFKH 1MKXH 1U37A 1ZYOA 4IC5A 1SGIB 2SGAA 2H3MA 2HNTE 2R3UA 1GI7B 3UY9A 1Z8RA 4YLUA 2KPKA 1HXEH 1P0SH 4Q7YA 4B2AA 2BQWB 3DHKH 2FS8A 2A7JA 2DM8A 2QYIA 4AFQA 2OBQA 1X6DA 4X8VH 2FX4A 1C5QA 2VVVA 5JBTA 1TBQH 1Y3WA 4FUEA 3AW1A 2H5DA 1C5UA 4UDWH 4HFPB 2M3MA 4OAJA 3V0XA 1O39A 2WUBA 1AO5A 2ZU4A 3MNBA 1V2JT 4K1EA 1VCPA 4MPUA 1RS0A 3BG4C 3KQDA 4BXSA 2GDEH 1C2FA 1MTSA 2REYA 5F67A 1KEFA 4A92A 1QR3E 2CSSA 2Y5HA 1TPOA 1GBMA 3SV9A 1UJUA 4OS4A 2ZDNA 1IU0A 4MNVA 1EZQA 4D9RA 2G52A 3S69A 2I1NA 1S83A 2G55A 3LKWA 3P8FA 1IQMA 1ARBA 2ZI2H 1TGCA 3RXLA 1E38B 2J95A 4DY7B 3UNRA 1TGTA 1G2LA 1CSOE 3NKKA 4AG1A 3E0NB 1QL9A 1OWKA 1QAUA 2W7SA 2TGPZ 3A8AA 1DXWA 2FE5A 2IN2A 2J92A 4IW4E 2BD3A 1JIRA 4ABEA 2C8WB 1IHSH 2VSPA 4J1YA 1ACBE 1NT1A 1O3AA 2CMYA 3OY5U 1HGTH 1V2MT 1UCYK 3RC5A 1WJLA 1UEWA 2W5EA 3HVQC 2PGBB 2YNBA 4B74A 1O2RA 3UR6A 1CBWB 1Q7XA 1WTHD 2DB5A 4FGMA 1TQ7B 4FUBA 2ILNA 5K7RA 1X45A 1FZZA 4FUCA 1VGCC 1ETSH 2FTLE 1PDRA 4NMOA 2J2UA 1K1OA 1Y5BT 2P59A 4WXVA 5DK1A 4BANB 1HCGA 1F2SE 4X2XA 3RXEA 1MTNC 1SGYE 1YBOA 4AZ2B 1VJAU 1GG6B 3ZZ7A 1VZQH 4NNMA 1GDQA 3D49H 4RKOB 4HI3A 1T31A 2BXTH 3I4WA 2ZEBA 3URDA 1DM4B 3FP6E 4WWYA 1OOKB 3BTEE 2JOAA 1NFWA 1BBRH 4MDSA 3Q3KA 5T3HA 1SMFE 1CHOF 1AKSB 4GCHF 1A61H 1WSSH 1G32B 5ABWA 1D3QB 1QGFA 3S9AA 4CHAC 3BEIB 4R2ZA 2RA0A 1XVMA 1N6EA 4TWWA 1GI1A 1YBWA 1E34B 2GP9B 5DP9A 4P2AB 1DWDH 1LKBA 1O38A 2HOBA 3FP7E 3GDUA 5E22A 4RN6A 3PS4A 2QA9E 1QTFA 1T8LA 3BG4B 3A7YA 3E3TA 1GJAB 4GCHG 4ZKRU 2F9NA 4XE4A 1NROH 3MO6A 1ZJKA 2MHOA 1AQ7A 1DOJA 1ELEE 4WMDA 1NC6A 1EB2A 1F0RA 1BUIA 1ZTLA 3LJJA 2H2CA 2Q6DA 3VQFA 1EQ9A 1Y5UT 2ZDLA 3MO3A 1ELDE 1YLCA 3NZIA 1F5KU 3OYPA 1VCWA 1LPGB 3CBXA 1GQ5A 3ELAH 1O3NA 1BDAA 1K1PA 1CGHA 2QCYA 2VU8E 1AY6H 1GBTA 1O3MA 1GI0A 1U3BA 2LPRA 2UUKB 3LGIA 5HGGA 1AFEH 2BDIA 1P3EA 1KSNA 2FXRA 4DJZB 1BQYA 2G00A 1EZUC 3KCGH 1BMAA 5F03A 5EU8A 4NMQA 1OP0A 1THRH 1P1EA 1ZTJA 2X7ZA 2AGIX 4TPIZ 1O5CB 2B5TB 1GMHF 1W13U 1HAVB 4JOGA 2XBWA 2O2TA 1DVAH 1AKSA 1UITA 2DUCA 3A88A 2Z94A 3PTBA 1MTNB 5E0GA 1GL0E 2VGCC 2ENOA 1XUFA 1Z7KA 1EB1H 4ISIH 5E2PA 2BOHB 3A85A 4UE7H 3FFGA 2GMTB 1EP6A 2BLWA 1KXFA 5FCKA 3NFKA 1QA0A 2C93B 3QZRA 2QY0B 1S0QA 1ELBA 1YPGH 3PDVA 3KEEA 1J17T 1FY3A 3BTME 1PPBH 3BPUA 3VB5A 8KME2 1GBIA 3FVFB 3FZDA 1UVTH 1WFVA 1OPHB 2BVXH 2GD4B 3UR9A 1C1RA 2C90B 1O2QA 3M5LA 5L2YH 2XW9A 2PSYA 1GQ4A 1OKXA 3LOXA 1WHAA 1TMBH 1HAHH 3QO6A 1K1JA 3RXIA 5BPEA 1PFXC 3TJOA 1DXPA 1DY8A 4Y8ZA 1TRMA 3OSYA 2ZDMA 1GL1A 1TRYA 1QA7A 1UMAH 1YPLH 4Q7ZA 2Y6TA 1UTOA 5H3JA 1O3GA 2O8MA 3F9EA 2AINA 1XMNB 1TQ3A 4ABHA 2OC7A 1QHRB 2PHBA 1YPKH 1TQ0B 2BDYA 5E1YA 3QZQA 5HEBA 2BLVA 1V3XA 3VXFH 5FAHA 3PYHA 1O2GH 1ZOKA 1SGPE 2FOBA 3V13A 3RLYH 3DFLA 3M3TA 4ZKOU 2WV5A 1HJAB 1HAVA 2KV8A 1V2PT 2XC4A 5FX6A 3RXBA 3T28A 1V62A 2GZ8A 1LHGH 1ZMJA 1MTWA 4UU6A 3SNDA 2VWRA 4MTBA 2Q3GA 3RP2A 1UVOA 3MMGA 5FPYA 1DLKB 2R0LA 1LHFH 1Z6EA 3GISB 1O3FA 1GGDC 2K20A 2C8YB 3R0FA 3O8BA 3MU8A 1N99A 4AYYB 2ZHDA 3BEFB 3SU4A 1SQOA 1OX1A 2VGCB 3BIUH 2GZVA 3U69H 1P2KA 3RM0H 2KJKA 1T4UH 3U1IB 2V3OH 1GI9B 1BJUA 2A5IA 1N7EA 1WHDA 1A5GH 3M5NA 2ZGXH 1SLWB 3SZNA 3VB7A 2YUYA 2BDCA 3BTQE 5EXNA 2EJYA 2EV8A 1HJ9A 3R69A 1K1LA 2WPMS 3SFJA 1O5FH 1FUJA 1K28D 2QXIA 3RMLH 1RTLA 3PM3A 2LA8A 5GPIB 1UTMA 4YOIA 2OCSA 2KOMA 3RLEA 3RXUA 4JMYA 5BRRE 1FAXA 1GWAA 2Z3CA 4U2WA 1TP5A 1O5DH 4H6TA 2VRFA 2OQSA 1HAXB 2RRMA 1A1RA 1O2YA 1P2QA 1QNJA 4GSOA 2EAQA 5K0HA 1I16A 1Y7NA 1TPPA 2VWLA 4GPGA 4O06A 1Z1JA 2VH0A 2JWEA 3PV2A 2FOHA 2PUXB 3ZYDA 3I1EA 1SSXA 1TP3A 2BLQA 5TCAA 2P95A 3NXPA 1O2SA 1CE5A 4REYA 3MTYA 2F9VA 4FVBA 1V2QT 1BHXB 3NGHA 4X2VA 2VH6A 2TGDA 4HZHA 4ISOA 1JRSA 2NU3E 1EPTC 1TNLA 2QAAA 1VA8A 2F91A 2R2MB 4FUJA 3UQVA 2STBE 3LH3A 1TABE 2GZ9A 1A0HB 5FB8C 4IBLH 4MVNA 3RU4E 5LH8A 5E2OA 1XXFA 1CQQA 2XRCA 3CP7A 1N6DA 3ZVCA 3SO3A 5FCRA 2GX4A 1GI6A 1MD7A 2XBXA 1CT4E 4Y8XA 1T32A 1ESTA 5A8ZA 1P01A 3E91A 1MD8A 1UF1A 3VXEH 1MQ6A 2BB4A 2D26C 5I7ZA 3A7XA 1Q2WA 1C9PA 4CRAA 1G9IE 1BRAA 4XDEA 4Y7BA 4DG4A 1OBXA 5AHGH 2OTVA 5DP8A 2QXGA 1HAPH 2ZHEH 2PSXA 5JB9S 1W2KH 1V2WT 3MU1A 1GBDA 2BZ6H 2P8OC 2EEGA 1ZSJA 4JCNA 2I0IA 1SL3A 5FBEA 5EW2H 4K1SA 1Q3XA 1GBFA 2ALVA 3RUOA 1P9UA 2G5NA 1S6HA 3TU7H 3UREA 3U1JB 2OBOA 3MU0A 1GVZA 5HEDA 3UWJH 4GHNA 2ZFSA 3O5NA 1GBLA 2BDHA 1UHPA 1P05A 2ZNKH 5E11A 4UFEH 3EGGC 1QQUA 2FOCA 1A5HA 4BTIB 1TPSA 3KHVA 1X8SA 1TA2A 2GTBA 4D7FA 3QE1A 4MPXA 2I6QA 2BDGA 1PPGE 3TK5A 2A31A 5AFYH 2GVFA 1BMLA 1KY9A 5L6NH 3V3MA 3RLWH 4BAHB 1ESBA 2WYGA 3QUMP 1IQNA 2ZA5A 2M0ZA 1YM0A 2BVRH 4ZKSU 2BYGA 4ESTE 4ZXXH 4YM9A 2AMDA 6CHAB 1GCTB 1GM1A 4Z6AH 1C5YB 1GHZA 1KLTA 4KTSA 2A2XH 3TNSA 3U8TH 2OQUA 2A7CA 1L0ZA 1DDJA 5EZ0A 4QT8C 1ETRH 3A80A 1CT0E 3I77A 5LPFA 3ATLA 1GJDB 1EPTB 3PLKA 3LGWA 2Z3DA 3MFJA 2DLSA 2P16A 3MH6A 3GOVB 4ZHMU 2ZP0H 1ZPBA 2TBSA 3ATKA 4KTUA 4NA7A 1NPMA 1L2EA 2KYLA 1O0DH 4UFFH 1IQHA 5G1EA 3FAOA 4R0IA 1Z71A 4JZDH 4Q3HA 4CREA 1L1NA 1PQ8A 3GY4A 4X8UH 1SPJA 1RZXA 1K1NA 1S0RA 2PTCE 3PWCA 2PUQH 2W3IA 4UONA 3SN8A 2FM2A 1C2MA 1RIWB 1NF3C 1SG8B 2VVUA 3KNXA 1FJSA 2V1WA 2FP7B 1V2UT 1QLCA 1TNKA 1C1SA 2VIVA 1LVMA 3SU1A 1U6QA 2VIOA 5C1YA 2D2DA 2P8OB 1JMOH 3MI4A 3GSLA 2DLUA 2G5VA 4D76A 1B7XB 1Z8IB 3HATH 3GCHB 5F6MA 3UFAA 3P8GA 1GHAF 3T62A 1P3CA 3STJA 3UWIA 1PPHE 1EAXA 4LZ1H 3A7TA 2D1JA 1UHBB 2Z9JA 4XHVA 2PTNA 2C3SA 1WI4A 2FODA 2OC1A 1V2OT 1W11U 3MO9A 2I04A 1AU8A 1L1GA 1NM6A 4FUIA 1O5EH 5A0AE 3AW0A 4TWYA 2AWWA 3A84A 3EQ0H 1C2DA 3CH8A 1GHAG 2EGKA 4NXRA 2H5CA 4A5TS 2IWPA 1EPTA 1HBTH 1QCPA 3IITA 2XXLA 2BY8X 4GAWA 4JOEA 3F9FA 3TJVA 1PQ7A 2Q6FA 4HTCH 2ZTYA 4ZAEA 3SGBE 3PV5A 2TPIZ 1FIZA 3A7WA 3C1KA 4H4FA 5EOKA 1C4Y2 4NIYA 1RTKA 2PNTA 1SGFG 3OTPA 2J38A 2ODPA 2ZKSA 2HVXA 4ABJA 3SJKA 2A0QB 2ZFTA 4I8GA 3VPKA 4J2YB 1MCTA 2ZO3H 3FANA 3P95A 5DPAA 1MU6B 3L4FD 2A4GA 3SU3A 1KXEA 1H9LB 1WTGH 2HRVA 5B6OA 4HOPB 4FU8A 5EYZA 1O2XA 2AGGX 4ABDA 1FLEE 1GI4A 3LH1A 3UOPA 1QJ7B 4D7GA 1ZR0A 2XCNA 1LHCH 2KRGA 1SQTA 4WH6A 3WY8A 3M5MA 1QRXA 3LNYA 2F9BH 1GJ5H 2TIOA 1GJ4H 3VGCC 3TJUA 3TSWA 1DSTA 2V0BA 2Y81A 3O8DA 1MBMA 2WV4A 2GCTC 4X1RU 1W9EA 1J14A 3SHAH 4UFDH 1BTXA 1AMHA 3UPEA 7LPRA 1KWAA 1SHYA 1C1NA 2BY9X 4M7GA 1VITF 1UHBA 1GDNA 1O2UA 2XNIA 4ISLA 1UVUH 2B7DH 2GT8A 1KLJH 2FLRH 1BB0B 3A7VA 1GBBA 3SV6A 2D90A 4XSKU 1IAUA 1QJ6B 5L2ZH 3SQEE 3TMHA 4R8TB 2L4SA 3GY8A 3I29A 1YC0A 1CGJE 4NMRA 1VITG 1WQVH 3K2UA 3I18A 2XWBI 2KJPA 2A5AA 4JZEH 3QGJA 4AN7A 2P94A 4K72A 1OBZA 2ZCKP 3CS0A 4NIWA 2DAZA 3QX5H 1NN6A 4YZUA 3QIKA 2G2LA 3ID4A 3VB6A 1ID5H 3AAVA 3BTHE 2EEJA 2JINA 2Z9LA 3PROA 2RCEA 4E06H 4IS5A 2G51A 2A5KA 3BSQA 2BQ7B 5E8EH 3ZZDA 1HJ8A 4HOPA 1UTLM 3KIDU 3UNQA 1NRQH 3SNAA 2VIWA 1FY1A 1LMWB 3MU4A 2WPHS 3ZVEA 2KL1A 3SUFA 1A3BH 1NS3A 4I7YH 2AFQB 1G3BA 1LO6A 4WMEA 2DKRA 1CGIE 2EEHA 1TNHA 4GHQA 2VSVA 1F0TA 2KOHA 5F3XA 4IC6A 1C2GA 3A86A 4FVDA 2EDPA 4H42U 1P03A 5DTHA 1SGRE 1EJMA 1OWJA 5HXFA 1XUJA 1WCZA 2CJIA 3VEQB 2HPQH 3I78A 2C8ZB 3EA8A 2FOEA 1N1LA 1O2JA 3VGCB 2TGAA 1ETTH 2EHRA 2VZ5A 3CBZA 2FESH 2OC8A 5DGJA 2GCTB 5E0HA 3ZYEA 3A8BA 4KKDA 4CH2B 2P93A 1KLIH 2XYAA 1K32A 1ABIH 2P3UB 1D3TB 3G01A 1Z1IA 4UFGH 4U30A 1PPZA 1O3KA 1SBWA 2CSJA 4ISHH 1V2RT 5DJ7A 1QY6A 2BM2A 2CF8H 1G3CA 4AB8A 4ZHAA 3U8RH 1DFPA 1A0LA 2F3CE 1NY22 1W8BH 4LXBH 2UWOA 4NA9H 1BRCE 1HUTH 1TOMH 1QBOA 1P1DA 1TYNA 4CRGA 2LC6A 3SNEA 1N6FA 1GJ6A 1SI5H 1PPFE 4X6MA 5PTPA 2GMTC 1BZXE 1LQDB 4H6SB 1GHVH 1HLTH 1DE7H 3ZZCA 1KYNA 1UVSH 1HNEE 3TGIE 1RRKA 1BTWA 3GCOA 1AD8H 3VB4A 3SHCH 3A87A 3E8LA 3SI3H 1DITH 4AYVB 2IWNA 1V5QA 4NCYA 2WPJS 5EGMA 3NK8A 4ZHLU 5TCCA 2QV1A 2WPLS 4Q2KA 1C1VH 1GCDA 1THSH 5HYOA 1ORFA 2LNCA 2ZPRA 2ZQ2A 5E6PB 3MNXA 1DWCH 4DIIH 5I25A 4FUDA 1C1PA 1DT2A 2FNEA 3K82A 2AIQA 1QJ1B 3SUEA 2KJDA 4XBDA 2DJTA 3S9BA 3SJIA 3SUGA 5J4QA 2BYAX 3PWBA 5EQRA 2J9NA 2M0VA 1O3JA 3HK3B 2D8WA 1X5NA 2ZGJA 1TB6H 1P06A 3KQEA 4H11A 2Z3EA 2PKTA 2JXOA 2MX6A 1O36A 3SUZA 6GCHF 3MU5A 3HGNA 1D6RA 3K9XB 5HMAA 1HJAC 3FP8E 2Z9KA 4Y8YA 4RSPA 4NWLA 1TPAE 4JOHA 1J9CH 3A89A 3K50A 2SGEE 4WH8A 2W4FA 3QDOA 4TY7A 5HETA 1ZSLA 5AFZH 1T2MA 3OU0A 1S81A 2EA3A 3EGKH 4XBCA 1EJAA 5E0JA 6GCHG 1DANH 5HDYA 1FY8E 5FHTA 1U38A 1YPMH 1ANBA 2VIQA 1IU2A 1FAKH 3E90B 1O31A 2SGDE 1ZSKA 2P3TB 2QXHA 5EW1H 3K6ZA 1WAYB 1NESE 1GBKA 2W26A 2EI8A 1ANEA 2Z9GA 3KL6A 4JZ1A 3RXTA 3TSZA 4WJG2 1HB0B 1BRBE 2HALA 1G36A 3EAJA 2VWMA 4AGKA 1LCYA 3DIWA 1GI8B 1WYKA 3RC4A 4BTTB 5SGAE 4AORA 1N7TA 1IHTH 1PJPA 3UQOA 3S7KB 1FV9A 1UTQA 4FXGH 1C5TA 1G3DA 3R68A 3P8NA 1HXFH 5T6GA 2YT8A 5FX5A 1U39A 2ZFQH 4B73A 2H1UA 3RXFA 2SGPE 2M5TA 4UEHH 1A7SA 4E7NA 3ID1A 1A5IA 1W14U 4K2YA 1D4PB 2BD4A 1AE8H 3RXKA 1FQ3A 2BDAA 1OWEA 3LC3A 3SV2H 4BTUB 1VCQA 2RDLA 1Y3YA 2HLCA 3M3SA 3Q3XA 3B23B 3M36A 1D6WA 1WIFA 2BZAA 4JL7A 1EOLA 1Z6JH 3TK6A 1A46H 1O5GH 1P04A 3SJOA 2XBVA 4EDJA 3S7HB 1THPB 1O5AB 2ZDKA 3Q76A 3N7OA 2CN0H 3TGJE 2HE4A 4KFWA 1DWEH 1DX5M 2O8LA 1BTPA 3GCTG 4E34A 1ZRBA 1BJVA 1CA8B 4NXQA 1ESAA 1KXDA 1VB7A 3TH2H 5T6FA 5A2MH 4D8NA 4ZROA 1LQEA 2AS9A 3CENA 2DE8A 1JXPA 3QTOH 1SFQB 3L3TA 2H6MA 4INLA 1OWDA 1SGNE 3SV7A 3O46A 1K21H 1GBAA 1VAEA 2QGRA 3L33A 3P8OA 3RM2H 1SQAA 1CHGA 1QL7A 1GMCF 3BIVH 2OCVB 1HAZB 4JOPA 1C5MD 1O2VA 4CR5A 5C5NA 4BAOB 2G8TA 1J8AA 1HAGE 5G1DA 2F0AA 4NA8A 1TNJA 4BNRA 3E6PH 3M5OA 3K65B 3A81A 3BG8A 3OTJE 1FC6A 3PTNA 3E0PB 3MH7A 3H7TA 4WVPE 3TJNA 1GMCG 1QRWA 3MH5A 4TY6A 4B2BA 1QB6A 5EPNA 3ID2A 5JB8S 1CA0B 4FUGA 3GJ9A 1S85A 1YKTA 1P2OA 2ANKH 2PKAB 1ZTKA 5DP4A 3SNBA 1BIOA 1C5RA 2VPHA 3LU9B 2PKUA 1O3BA 1ZLRA 2FYRA 1WUNH 2J4IA 3BF6H 2ANWA 1FDPA 1ZRKA 2GZ7A 1MUEB 4MPAA 1ANCA 1CT2E 3P17H 3DJ1A 6CHAC 1UJ1A 1GCTC 1EASA 2FPZA 2ZU1A 3HPMA 2UZCA 1FMGA 3GY3A 5H4IB 7KMEH 1Y8TA 1L1JA 1IQJA 1OSSA 2EI7A 2ZPSA 2H9EH 4NMPA 2O8UA 1DPOA 2YNAA 2W3KA 4L8NA 3SV8A 2FTMA 3P6ZB 3HKIB 1G37A
chains in the Genus database with same CATH superfamily
3KF2A 2KCPA 2CHAB 2ZPMA 5HJ1A 1GBHA 4CBNA 4FLNA 1PQ5A 2BY7X 2QKTA 1UTJA 2HWLB 3OY6U 3PRBA 1WFGA 4XOJA 3IG6B 2AWUA 1MZDA 5ETXA 3K1RA 2AWXA 1BFEA 5HEYA 4B71A 3MNSA 1FY5A 2UWLA 2W7UA 1NRSH 3LNXA 2ZU3A 5A0BA 4Q6SA 1O34A 2G5MB 2ZPQA 1DS2E 4ZH8A 2VWOA 1TIOA 4K60A 1RIWC 1ZPZA 4IN1A 2AEIH 2AERH 1E79D 1Q3PA 1UCYH 1JIMA 4CRCA 1EP5A 2KZ4A 3LIWA 1QAVB 1Y5AT 1P8VC 2ANYA 5CHAB 3OEHD 2XTTB 1FPHH 2PKAA 2BDBA 2KAIB 2KBSA 4NG9H 4O97A 3GCHC 3AVZA 1TX8A 2ANMH 1NTEA 4WYTA 1B8QA 2A4OA 1LVBA 3F1SB 2EDVA 3EA9A 1RGWA 3V12A 1DSUA 1HAOH 1C5OH 2D8IA 2P3WA 1IQFA 1E37B 4CRFA 1JWTA 1AB9B 4FU7A 6ESTA 1GJCB 2PZDA 1K1MA 3GABA 1ZOMA 3RL7A 2AIPA 1X7AC 2KA9A 3L6PA 1E0FD 1BBRK 1G3EA 1O2HA 1R6JA 1O3EA 1W12U 1XUIA 1C5WB 2ZFRH 5EODA 1ABJH 4YO9A 1EZXC 1GJ9B 1HYLA 1EX3A 3ODDA 4KP0A 5JBCS 2OPGA 1QB9A 2DE9A 1V1TA 4JOFA 1O3OA 5A2PA 1C5NH 2BOKA 3OX7U 4NMSA 4NWKA 5EQQA 4A1XA 4JYUH 1AIXH 2HNTC 1RXPA 4X8SH 4BXWA 4JK6A 3RC6A 1TRNA 3LT3A 1Z8JB 1GMDG 1C1TA 3U8OH 4I8JA 2Q9VA 4NZLA 1MFGA 4Q2PA 1KTSB 2ASUB 2NU4E 3MYWA 1TAWA 2UUYA 1NFYA 1H1BA 1H8ED 4B75A 1BMMH 1C2KA 1P11E 3SHWA 3DFJA 5C1XA 1MKWK 5IK2D 2YUBA 4YYXA 1QB1A 1TGSZ 4BAQB 5C94A 4WMFA 2KAWA 5HFFA 1TBRH 1N8OB 1QAVA 4OEOA 5GLJA 4UD9H 1SGQE 2O8TA 4U32A 2KAIA 2KX4A 2RCZA 2RFKC 1WF8A 5HF1A 2K1ZA 3SZEA 2VIPA 4Y71A 4YDPA 2VWNA 3KN2A 2KCAA 4Q80A 4O03A 4Y0YE 2F5YA 1O3IA 1OWIA 4E05H 4YOJA 1O2NA 3O8CA 2BX4A 2PW8H 2JDID 2ZCHP 2PWXA 3V7TA 1XUHA 4F4OC 1PPCE 3SORA 3PMBB 1MFLA 3QGLA 1LKAA 1S5SA 4AFUA 4X1QU 2AYWA 4SGAE 3ZZ6A 2K1QA 2QE7D 1UEZA 1W7XH 1QRZA 2XC0A 5LPEA 4YT7H 4MQAA 4K5ZA 4MPVA 1LVYA 1C5LH 1ZZZA 3FO8D 1O3LA 2GT7A 4Y79A 5DKMA 3GYLB 2BVSH 4Y11E 1BTZA 1P09A 1C2HA 1C2IA 1LDTT 1T8OA 1INCA 1HV7A 3RXOA 2HPPH 3GDSA 3ZVAA 2H2ZA 2STAE 1CVWH 2GGVB 3SOSA 4O3TA 2JILA 1FXYA 1O2ZA 1O3PB 3NPSA 4E35A 5HFDA 1JBUH 2ZHQH 1PYTC 1BA8B 4A1VA 4Y7AA 4TPYA 3FZZA 1Z86A 2KG2A 4JK5A 1L4ZA 4TT3D 4Y6DA 2FCFA 5HIYA 3U98H 1QIXB 2H2BA 1P02A 3Q3YA 3P70B 1X5RA 5L30H 2ESTE 2ZTXA 4B1TA 4K69A 1W0YH 1NZQH 2UWPA 2EC9H 3KHFA 4GVUA 1UTKA 4OS1A 1SOTA 3STIA 5B42A 1RTFB 3GY2A 3LONA 3UOUA 1B0EA 2VINA 1SR5C 1P2NA 1SB1H 5GDSH 1J16A 3F3BA 3SNCA 1C2JA 2I6VA 3ID3A 1QL8A 2A7HA 1GI3A 1C1QA 1OXGA 1KXCA 1V2TT 2QIQA 1AWHB 2OSGA 4I8KA 3BTWE 3GICB 2R4HA 1BHXF 2Z17A 3RMNH 3HK6B 1TX7A 2M0TA 3EYDA 4LZ4B 1WH1A 2EGOA 2FI4E 1EZSC 3PB1E 5GCHG 2F9UA 4VGCB 3TIUA 3RXJA 3H09A 1DUEA 3DORA 1YCPK 4K6YA 2SGQE 1Y3VA 3R0HA 3RXGA 4F55A 2Y80A 2ZECA 5TJXA 2FOMB 2ODQA 1A2CH 1E35B 3ZZ4A 1WU1A 5FL7D 4X8TH 1TWXB 2F43B 4NIVA 3ZZ5A 3RXRA 5HFCA 1W7GH 4Y10E 3ODFA 2F83A 1XZ9A 2AH4X 1Q3OA 4ABBA 1EOJA 1A0JA 4F8KA 2Q6GA 4E7RG 1HAIH 4INHA 5F8TA 4ISNA 2Z7FE 2QN5T 5C0UA 1AI8H 1C2EA 3HKJB 5JDUB 1MBQA 2B9LA 1PYTD 1BTYA 3WWFA 1AVWA 1O37A 1O2WA 3TVJB 2XWAA 4HGCA 3GY6A 1XXDA 4U01A 4Q2OA 1WI2A 1C5XB 3EDXB 4IMQA 2XCFA 1IQIA 3AAUA 1IQEA 4CRBA 2HGTH 1TLDA 3IWMA 3CBYA 4INKA 1AVXA 2JH6D 2ZG0H 2VNTA 4MG3A 1TFXA 3HGPA 3ATMA 1QURH 2V3MA 5HF4A 2A32A 2J5UA 3NCVA 1TA6A 2PR3A 1VJ6A 3E16B 4FOUC 4Q6HA 1SLUB 1YCPM 4NZQA 4OS6A 2CF9H 4I8LA 1O2TA 1VJ9U 1C1UH 3ESTA 1T8MA 3KGPA 1EAIA 3PMJA 3QJNA 5EXLA 2M0UA 1TNGA 4MNYA 3S0NA 1HIAB 5EPYA 3NFLA 1SLXB 5DP3A 1NFXA 4X1NU 2Q1JA 2VB0A 5T6DA 2H3LA 1O2OA 3TLOA 1W0JD 1V6BA 2SNVA 4AG2A 1XKAC 5LGOA 2Z9IA 4MLFB 1TMTH 3M3VA 1NRPH 2FX6A 2FO9A 3CYYA 2W6ID 2YMSD 1ARCA 4AFZA 4FU9A 5A0CA 1X5QA 5D13A 1G30B 2PV9B 3N99A 4NGAH 2ZFFH 2AHME 2ZU5A 1L4DA 3T2NA 2G4UA 2WUCA 1H9IE 1O3DA 1ZGIA 2QC2A 1I92A 1GBJA 1YPEH 4RI0A 3Q00A 4Q4LA 3RXCA 2E7KA 3PV4A 1H8IH 1OYTH 1Z8GA 2GV7A 4TSFD 3SU5A 2QT5A 1TOCB 3RXAA 1O3HA 2ZTZA 2ZIQH 2PKSB 1DUAA 2SNWA 2Y82A 3ATIA 5C2ZA 4K8BA 1GVLA 4KELA 1DICA 1V6DA 2WPKS 1PPEE 3RXSA 4YTAA 3ZVGA 2ZC9H 3PO1B 2J34A 3QDZB 1FONA 3A7ZA 2EY4C 3R3GB 1AE5A 1BTHH 1C5ZB 3ZIAD 2LUIA 2KPLA 2R2WU 3AASA 4XBBA 2CGAA 2OK5A 2FEQH 1SGDE 2OQ5A 3QK1A 2DC2A 3ZVFA 4PQWA 1E36B 3MHWU 4I32A 1UM1A 3TK9A 4K76A 3ZZ8A 2QF3A 4LOYH 1HIAA 2V90A 1AWFH 9LPRA 5JXBA 4AGJA 3U28C 5CMXH 3RXMA 1UK4A 2A1DB 5DN6D 2A45B 2GDDA 3QWCH 1NRNH 5A8XA 4K78A 1C5PA 1EXFA 1TE0A 4JOJA 1MTUA 1YPHE 2KR7A 3HPTB 1M9UA 1V2LT 3RDZA 4BAMB 1W10U 4AOQA 2WINI 2OZFA 1FN8A 1FY4A 2QXJA 5GIBA 2J94A 2GEFA 1W9OA 2HNTF 1RD3B 3D62A 4OS5A 1D9IA 2Y5FA 5FPTA 1WV7H 1GJ8B 1CHOG 3MNCA 2OC0A 7ESTE 1HPGA 1LPKB 3O8RA 3GDVA 3SGQE 2RG3A 2IWOA 2JKHA 1OP2A 2ZZUH 1C5SA 3QLPH 2KOJA 1ZMLA 3RXDA 1MKWH 3D65E 4ZMAH 3E1XB 5C3NA 3F0PA 3RMMH 2A4QA 3D23A 1O32A 1EUFA 2Y7XA 5C5OA 3PLBA 1A4WH 2ZDAH 2WPIS 1GVKB 1IHJA 5KGOA 4K3JA 1DY9A 2L97A 3DJ3A 4JYVH 2ULLA 1AN1E 2L4TA 1K9OE 2ZF0H 4PROA 2QBWA 1BITA 3RU4T 3PLPA 4Z33A 2R3YA 1FPCH 3EGHC 3LPRA 3F9GA 1VGCB 8GCHF 2ZGCA 4HG6A 2NWNA 4GVCA 5GWZA 3F6UH 2JJ2D 2FOFA 2JREA 1BBRE 4NMVA 3BTTE 4I31A 2ZGHA 1ELCA 1LHDH 4JOKA 1QQ4A 1LHEH 2ZDVH 3HPKA 4A6LA 1PQAA 1CA0C 3ZZAA 3F9HA 1ZHPA 1FCFA 8GCHG 2I4SA 1MABB 3JXTA 1K1IA 5IL9A 5CE1A 1IOEA 1GMHG 3ATWA 3SI4H 4BOHA 4Q2NA 2Y7ZA 2V3HH 2HGAA 3TNTA 3SU0A 1CO7E 4ABIA 1SVPA 1YGCH 2FWWA 2JH5D 3MWIU 4CHAB 1N7FA 2TGTA 1P10A 1GDUA 1B0FA 4GLYA 4ABGA 5F8ZA 3GCTF 1AZ8A 1AVGH 3UTUH 1RFNA 3LGVA 1YYY1 1Y3UA 2RA3A 4B2CA 1QBVH 3AXAA 3UUZA 5HFEA 2BMGB 3KQCA 3F2GA 3DUXH 5JYIA 3A83A 2FZZA 5LPRA 1O2PA 3UNSA 3B76A 1GJ7B 2FYQA 2F9PA 3LC5A 2OMJA 1GJBB 2CHAC 2FIRH 3B8JA 4RKJB 4LMMA 3RU4D 4X6NA 1YF4A 4OS7A 5A09A 3W95A 2GCHF 1GBCA 4DURA 4BAKB 2H9TH 1F92A 4B76A 1C1OA 2I6SA 5EQSA 3A8CA 4YLQH 3KYGA 3ZZ3A 3BV9B 1XKBC 1F0SA 3T27A 2R0KA 3WKMA 1UJVA 2OXSA 2PFEA 3LGTA 1ELVA 4NSVA 1G2MA 3GCNA 4I8HA 1EATA 2PLXA 4NFFA 1WOFA 2GCHG 3K6YA 2QF0A 4KGAA 1MAYA 5CHAC 2Z6BD 2PDZA 5FXLA 4DVAU 3KZDA 1K2I1 3EE0B 1BTUA 3GY7A 1C9TA 1TX6A 3OAAD 1XM1A 1YCPH 2R9PA 3M7QA 1XVOA 3DT0H 4AMHA 4JJ0A 2KQFA 1ANDA 1F5LA 4Q7XA 7GCHF 1OWHA 1FC7A 2FLBH 4CRDA 8LPRA 1RY4A 2JETC 4Z0KA 5AF9H 3QTVH 2H9HA 3UIRA 2ZGBH 1AB9C 1ELTA 1MKXK 4ZCNA 4THNH 3RXPA 1SFIA 2IPHA 2OGPA 3OFND 3U9AH 3KZEA 4OGYA 3EA7A 3RXQA 2YTWA 2OD3B 3TH4H 7GCHG 1QZ8A 3A8DA 1ZHRA 1UEQA 1AGJA 3TPIZ 1OBYA 2TRMA 2W7RA 3KDKA 2QF4A 1H4WA 1D3DB 1HAYB 1O2KA 2D92A 1K22H 1YLDA 3WW7A 2QKVA 3LDXH 4O9VA 2ZQ1A 4YOGA 4AB9A 1NU9A 2XC5A 2BD2A 4B6FA 1WBGB 2LC7A 2BTCE 2BD5A 1OZIA 1NU7B 2AGEX 2C8XB 4DOQA 1SGEE 4WYUA 1RJXB 3VB3A 2OUAA 4NMTA 3M7UA 4NNLA 4TYDA 1EFRD 3QN7A 5IYTA 5HM2A 2BX3A 4WF8A 1MQ5A 1AUTC 3GY5A 3B9FH 2XBYA 3CC0A 5GJ4B 1WF7A 1S6FA 1H8DH 2OP9A 5FPSA 1N8OC 3QJMA 1D5GA 4P00A 5EJZA 4GUXA 1TMUH 4Y0ZE 2YOLA 1ZMNA 2GV6A 1AZZA 3ZVBA 4OEPA 1GHWH 1P57B 1F7ZA 2BD7A 2G4TA 4YESB 3QGNB 3LJOA 1AUJA 1NO9H 8ESTE 1NTPA 5GNDA 1HRTH 2P3FH 4N6XA 5F8XA 1Y3XA 4ZXYH 3LGYA 4GVDA 5IDKA 1V2KT 4CH8B 1UK3A 2KM0A 1VITH 1L6OA 1MMJN 1S84A 1P2IA 2BY6X 1Q31A 1GGDB 1SGFA 1O2IA 4ACAA 1KXBA 1D3PB 4O3UA 5JBAS 3T29A 2BQ6B 1BOQA 1LVOA 1SGTA 2ZCLP 4CR9A 1BCUH 3SJ9A 2LP6A 1YPJH 4IN2A 4LK4A 3BTKE 3SOEA 2JETB 2CXVA 1F5RA 4AX9H 2PA1A 3SU2A 2BLOA 3F68H 1J15A 1YP9A 1OS8A 1DWBH 4KTCA 3DD2H 1JOUB 5HM9A 3TSVA 4MNWA 1GHYH 1UTNA 5FBIA 3SBKA 1UVPA 1GMDF 1GI5A 1SGCA 3T26A 1IQLA 3BEUA 5A8YA 2UUFB 1UJDA 3TITA 1SLVB 3SW2B 3RXHA 3BN9A 1P9SA 5C20A 4UU5A 3ITIA 1BT7A 1O2MA 1W0ZU 3GYMA 5ILBA 2NU1E 3DJAA 2KFWA 2O9QA 3PMHB 3RXVA 1V5LA 5C67A 2WPDD 1P12E 2BD8A 5C0TA 1AFQC 2SGFE 5DG6A 1TGNA 4G69A 2CS5A 5B6LA 2ZHWH 4A1TA 4FUFA 4WY3A 2SFAA 2EGNA 1HDTH 1O5BB 3M35A 4JZFH 4NSYA 4ZUHA 3DA9B 4F49A 2FS9A 5I46H 4DT7B 1HFDA 4GHTA 3TH3H 2QKUA 4K75A 4ABAA 2Y5GA 4D9QA 5ESTE 1TNIA 2L6OA 2OS6A 3H7OA 4DW2U 5G4BA 1MH0A 2AMPA 1M5ZA 1TONA 3H5CB 3RMOH 3BTDE 5DP7A 3SQHE 3VFEA 5J4SA 4CBOA 2B0FA 1NFUA 2V35A 2EXGA 3NUMA 1P2MA 1LPZB 1F0UA 3WKLA 2XOKD 3C27B 4VGCC 2JIKA 4E3BA 1GI2A 1ELAA 1UCYE 5DP6A 3SGAE 4SGBE 5GXPA 2OLGA 4Q2QA 4X1SU 2C4FH 1WG6A 4ACBA 5DO4H 4OGXA 3P92A 1A3EH 1P2JA 1T8NA 1T4VH 2VJ1A 1IQGA 1C1MA 1OP8A 4I33A 4P0CA 3ZRTA 2HE2A 4OS2A 1SOZA 5EG4A 2A4RA 2BD9A 1ELFA 2VIDA 4A7IB 1XX9A 1V2ST 2FI3E 3A82A 3LGUA 1Z87A 2QG1A 2FN5A 1V2VT 1Y59T 2V7QD 1UEPA 2M10A 4FUHA 4IGDA 1MU8B 1C4V2 1T7CA 2I0LA 2EEKA 1CU1A 1MTVA 4NXPA 1FNIA 4DT4A 4AFSA 1FC9A 2BHGA 5E21A 2BY5X 2ZU2A 5CHBA 1W0KD 2JH0D 3BTGE 3KQBA 3ZV8A 2WL7A 1GHBF 1RGRA 4K1TA 1MZAA 2FMJA 2W6JD 3NWUA 4X6OA 5JBBS 3RL8A 1S82A 1O3CA 1MAXA 1BE9A 2ODYB 1VR1H 3ZV9A 4K8YA 4DCDA 3BTFE 4JYTA 3Q77A 4X1PU 1V2NT 1SHHB 4Y76A 2LOBA 1AFQB 1EAUA 3M61U 1ZPCA 1ELGA 2V6NA 3ENSB 1TBZH 2IJOB 1C5VA 1KDQB 1SC8U 5DP5A 1XUGA 3ZZBA 3JZ2B 1FIWA 4DIHH 1O33A 1GHBG 2VBCA 2OINA 2WYJA 2ZFPH 1G9OA 3SJ8A 1GHXH 6LPRA 2EEIA 1N6XA 1N6YA 1B5GH 2WV9A 1XUKA 3VQGA 3CS7A 5GCHF 3GGEA 3SUDA 1BRUP 4NIXA 1AHTH 1GBEA 5HFBA 1C4U2 3W94A 4DGJA 1YPHC 1W9QA 2A2QH 3FY5A 2FOAA 4XFQA 1ZHMA 1MCVA 1UO6A 2FI5E 2VVCA 2EDZA 1IQKA 4YT6H 1GPZA 3MOCA 4X0WU 1EJNA 1JRTA 1O2LA 2CV3A 1WQSA 1C2LA 1KIGH 1ZUBA 1UK2A 1FI8A 1OYQA 1ZJDA 4ABFA 2IOTA 5AVDA 3E17A 2IWQA 2THFB 2DMZA 2FDAA 2F9OA 4ASHA 3NCLA 4IMZA 1UTPA 3SU6A 4KFVA 1W3CA 9ESTA 1EAWA 2EI6A 2ZWLH 3TGKE 4X2WA 4X6PA 1UFXA 1TGBA 4JZIA 1UM7A 4ZKNU 2B8OH 2ZHFH 2PKSC 3MH4A 4MPWA 5EXMA 3URCA 1TALA 3M7TA 1CBWC 5ESBA 1FN6A 2ALPA 3PRDA 1C1WH 3ZVDA 3S9CA 3T25A 2UUJB 2FOGA 3M37A 1BMNH 1LTOA 3PO1C 4NFEA 3T5FH 4Z8JA 4WXIA 2O8WA 1KXAA 1YLNA 5JPMH 1DLEA 1O35A 2GKVE 1NRRH 3ZZ9A 1QBNA 1KDQA 5C1UA 1O30A 1KTTB 2YT7A 1RGQA 2BXUH 2NU0E 2AMQA 1H9HE 3JZ1B 3PMAB 1EKBB 2G81E 2KCOA 2NU2E 1GG6C 1MC7A 2ZPLA 3PDZA 4JORA 3SHUA 1ZGVA 2PGQB 4MNXA 4X2YA 1QFKH 1MKXH 1U37A 1ZYOA 4IC5A 1SGIB 2JJ1D 2SGAA 2H3MA 2HNTE 2R3UA 1GI7B 3UY9A 1Z8RA 4YLUA 4ASUD 3KQ5A 2KPKA 1HXEH 1P0SH 4Q7YA 1X9ZA 4B2AA 2BQWB 3DHKH 2FS8A 2A7JA 2DM8A 2J98B 2QYIA 4AFQA 2OBQA 1X6DA 4X8VH 2FX4A 1C5QA 2VVVA 5JBTA 1TBQH 1Y3WA 4FUEA 3AW1A 2H5DA 1C5UA 4UDWH 4HFPB 2M3MA 4OAJA 3V0XA 5HGGA 1O39A 2WUBA 1AO5A 2ZU4A 3MNBA 1V2JT 4K1EA 1VCPA 4MPUA 1RS0A 3BG4C 3KQDA 4BXSA 2GDEH 1C2FA 1MTSA 2REYA 5F67A 1KEFA 4A92A 1QR3E 2CSSA 2Y5HA 1TPOA 1GBMA 3SV9A 1UJUA 1E1QD 4OS4A 2ZDNA 1IU0A 4MNVA 1EZQA 4D9RA 2G52A 3S69A 2I1NA 1S83A 2G55A 3LKWA 3P8FA 1IQMA 5EJLA 1ARBA 2ZI2H 1TGCA 3RXLA 1E38B 2J95A 4DY7B 3UNRA 1TGTA 1G2LA 1CSOE 3NKKA 5HIZA 3E0NB 1QL9A 4AG1A 1OWKA 1QAUA 2W7SA 2TGPZ 3A8AA 1DXWA 2FE5A 2IN2A 2J92A 4IW4E 2BD3A 1JIRA 4ABEA 2C8WB 1IHSH 2VSPA 4J1YA 1ACBE 1NT1A 1O3AA 2CMYA 3OY5U 1HGTH 1V2MT 1UCYK 3RC5A 1WJLA 1UEWA 2W5EA 3HVQC 2PGBB 2YNBA 4B74A 1O2RA 3UR6A 1CBWB 1Q7XA 1WTHD 2DB5A 4FGMA 2LELA 1TQ7B 4FUBA 2ILNA 5K7RA 1X45A 1FZZA 4FUCA 1VGCC 1ETSH 2FTLE 1PDRA 2IJD1 4NMOA 2J2UA 1K1OA 1Y5BT 2P59A 3DSPA 4WXVA 3N7DA 5DK1A 4BANB 1HCGA 1F2SE 4X2XA 3RXEA 1MTNC 2J98A 1SGYE 1YBOA 4AZ2B 1VJAU 1GG6B 3ZZ7A 1VZQH 4NNMA 1GDQA 3D49H 4RKOB 4HI3A 1T31A 2BXTH 3I4WA 2ZEBA 3URDA 1DM4B 3FP6E 4WWYA 1OOKB 3BTEE 2JOAA 1NFWA 1BBRH 4MDSA 3Q3KA 5T3HA 1SMFE 1CHOF 2L74A 1AKSB 4GCHF 1A61H 1WSSH 1G32B 5ABWA 1D3QB 1QGFA 3S9AA 4CHAC 3BEIB 4R2ZA 2RA0A 1XVMA 1N6EA 4TWWA 1GI1A 1YBWA 1E34B 2GP9B 5DP9A 4P2AB 1DWDH 1LKBA 1O38A 2HOBA 3FP7E 3GDUA 5E22A 3F2FA 4RN6A 3PS4A 2QA9E 3KYFA 1QTFA 1T8LA 3BG4B 3A7YA 3E3TA 3DSGA 1GJAB 4GCHG 4ZKRU 2F9NA 4XE4A 1NROH 3MO6A 1ZJKA 2MHOA 1AQ7A 1YY3A 1DOJA 1ELEE 4WMDA 1NC6A 1EB2A 1F0RA 1BUIA 1ZTLA 3LJJA 2H2CA 2Q6DA 3VQFA 1EQ9A 1Y5UT 2ZDLA 3MO3A 1ELDE 1YLCA 3NZIA 1F5KU 3OYPA 1VCWA 1LPGB 3CBXA 1GQ5A 1OHHD 3ELAH 1O3NA 1BDAA 1K1PA 1CGHA 2QCYA 1NBMD 1AY6H 1GBTA 1O3MA 1GI0A 1U3BA 2LPRA 2UUKB 2VU8E 3LGIA 1AFEH 2BDIA 4FETA 1P3EA 1KSNA 2FXRA 4DJZB 1BQYA 2G00A 1EZUC 3KCGH 1BMAA 5F03A 5EU8A 4NMQA 1OP0A 1THRH 1P1EA 1ZTJA 2X7ZA 2AGIX 4TPIZ 1O5CB 2B5TB 1GMHF 1W13U 1HAVB 4JOGA 2XBWA 4I86A 2O2TA 1DVAH 1AKSA 1UITA 2DUCA 3A88A 2Z94A 3PTBA 1MTNB 5E0GA 1GL0E 2VGCC 2ENOA 1XUFA 1Z7KA 1EB1H 4ISIH 5E2PA 2BOHB 3A85A 4UE7H 3FFGA 2GMTB 1EP6A 2BLWA 1KXFA 5FCKA 3NFKA 1QA0A 2C93B 3QZRA 2QY0B 1S0QA 1ELBA 1YPGH 3PDVA 3KEEA 1J17T 1FY3A 3BTME 1PPBH 3BPUA 3VB5A 8KME2 1GBIA 3FVFB 3FZDA 1UVTH 1WFVA 1OPHB 2BVXH 2GD4B 3N7EA 1C1RA 2C90B 3UR9A 1O2QA 3M5LA 5L2YH 2XW9A 2PSYA 1GQ4A 1OKXA 3LOXA 1WHAA 3W1EA 1TMBH 1HAHH 3QO6A 1K1JA 3RXIA 5BPEA 1PFXC 3TJOA 1DXPA 1DY8A 4Y8ZA 1TRMA 1BMFD 3OSYA 2ZDMA 3FN8A 1GL1A 1TRYA 1QA7A 1UMAH 1YPLH 4Q7ZA 2Y6TA 1UTOA 5H3JA 1O3GA 2O8MA 3F9EA 2AINA 1XMNB 1TQ3A 4ABHA 2OC7A 1QHRB 2PHBA 1YPKH 1TQ0B 2BDYA 2IPQX 5E1YA 3QZQA 5HEBA 2BLVA 1V3XA 3VXFH 5FAHA 5KECA 3PYHA 2KCYA 1O2GH 1ZOKA 1SGPE 2FOBA 3V13A 3RLYH 3DFLA 3M3TA 4ZKOU 2WV5A 1HJAB 1HAVA 2KV8A 1V2PT 2XC4A 5FX6A 3RXBA 3T28A 1V62A 2GZ8A 1LHGH 1ZMJA 1MTWA 4UU6A 3SNDA 2VWRA 4MTBA 2Q3GA 3RP2A 4P02A 1UVOA 3MMGA 5FPYA 1DLKB 2R0LA 1LHFH 1Z6EA 3GISB 1O3FA 1GGDC 2K20A 2C8YB 3R0FA 5C17A 3O8BA 3MU8A 1N99A 4AYYB 2ZHDA 3BEFB 3SU4A 1SQOA 2JSNA 1KMHB 1OX1A 2VGCB 3BIUH 2GZVA 3U69H 1P2KA 3RM0H 2KJKA 1T4UH 3U1IB 2V3OH 1GI9B 1BJUA 2A5IA 1N7EA 1WHDA 1A5GH 3M5NA 2ZGXH 1SLWB 3SZNA 3VB7A 2YUYA 2BDCA 3BTQE 5EXNA 2EJYA 3MQKC 2EV8A 1HJ9A 3R69A 1K1LA 2WPMS 3SFJA 1O5FH 1FUJA 1K28D 4RT1A 2QXIA 3AK5A 3RMLH 1RTLA 3PM3A 2LA8A 5GPIB 1UTMA 4YOIA 2OCSA 2KOMA 3RLEA 3RXUA 4JMYA 5BRRE 1FAXA 1GWAA 2WZQA 2Z3CA 4U2WA 1TP5A 1O5DH 4H6TA 2VRFA 2OQSA 1HAXB 2RRMA 1A1RA 1O2YA 1P2QA 1QNJA 4GSOA 2EAQA 5K0HA 1I16A 1Y7NA 1UW7A 1TPPA 2VWLA 4GPGA 4O06A 1Z1JA 2VH0A 4XRNA 2JWEA 3PV2A 2FOHA 2PUXB 3ZYDA 3I1EA 1SSXA 1TP3A 2BLQA 5TCAA 2P95A 3NXPA 1O2SA 1CE5A 4REYA 3MTYA 2F9VA 4FVBA 1V2QT 1BHXB 3NGHA 4X2VA 2VH6A 2TGDA 4HZHA 4ISOA 1JRSA 2NU3E 1EPTC 1TNLA 2QAAA 1VA8A 2F91A 2R2MB 4FUJA 3UQVA 2STBE 3LH3A 3UAIC 1TABE 2GZ9A 1A0HB 5FB8C 4IBLH 4MVNA 3RU4E 5LH8A 5E2OA 1XXFA 1CQQA 2XRCA 3CP7A 1N6DA 3ZVCA 3SO3A 5FCRA 2GX4A 1GI6A 1MD7A 2XBXA 1CT4E 4Y8XA 1T32A 1ESTA 5A8ZA 1P01A 3E91A 1MD8A 1UF1A 3VXEH 1MQ6A 2BB4A 1K0HA 2D26C 5I7ZA 3A7XA 1Q2WA 1C9PA 4AC9A 4CRAA 1G9IE 1BRAA 4XDEA 4Y7BA 4DG4A 1OBXA 5AHGH 2OTVA 5DSFA 5DP8A 2QXGA 1HAPH 2QF5A 2ZHEH 2PSXA 5JB9S 1W2KH 1V2WT 3MU1A 1GBDA 2BZ6H 2P8OC 2EEGA 1ZSJA 4JCNA 2I0IA 2K0QA 1SL3A 5FBEA 5EW2H 4K1SA 1Q3XA 1GBFA 2ALVA 3RUOA 1P9UA 2G5NA 1S6HA 3TU7H 3UREA 3U1JB 2OBOA 3MU0A 1FX0B 1GVZA 5HEDA 3UWJH 4GHNA 2ZFSA 3O5NA 1GBLA 2BDHA 1UHPA 1P05A 3VG8A 2ZNKH 5E11A 4UFEH 3EGGC 5T1VA 1QQUA 2FOCA 1A5HA 4BTIB 1TPSA 3KHVA 1X8SA 1TA2A 2GTBA 4D7FA 3QE1A 4MPXA 2I6QA 2BDGA 1PPGE 3TK5A 2A31A 5AFYH 2GVFA 1BMLA 1KY9A 5L6NH 3V3MA 3RLWH 4BAHB 1ESBA 2WYGA 3QUMP 1IQNA 2ZA5A 2M0ZA 1YM0A 2BVRH 4ZKSU 2BYGA 4ESTE 4ZXXH 4YM9A 2AMDA 6CHAB 1GCTB 1GM1A 4Z6AH 1C5YB 1GHZA 1KLTA 4KTSA 2A2XH 3TNSA 3U8TH 1VKYA 2OQUA 3OE7D 2A7CA 1L0ZA 1DDJA 5EZ0A 4QT8C 1ETRH 3A80A 1CT0E 3I77A 5EJ1A 3DCLA 5LPFA 3ATLA 1GJDB 1EPTB 3PLKA 3LGWA 2Z3DA 3MFJA 1YWUA 2DLSA 2P16A 3MH6A 3GOVB 4ZHMU 2ZP0H 1ZPBA 2TBSA 3ATKA 4KTUA 4NA7A 1NPMA 1L2EA 2KYLA 1O0DH 4UFFH 1IQHA 5G1EA 3FKSD 3FAOA 4R0IA 1Z71A 4JZDH 4Q3HA 2WSSD 4CREA 1L1NA 1PQ8A 3GY4A 4X8UH 1SPJA 1RZXA 1K1NA 1S0RA 2PTCE 3PWCA 2PUQH 2W3IA 4UONA 3SN8A 2FM2A 1C2MA 1RIWB 1NF3C 1SG8B 1WDIA 2VVUA 1FJSA 2V1WA 2J97A 3KNXA 3NRLA 2FP7B 1V2UT 1QLCA 1TNKA 1C1SA 2VIVA 1LVMA 3SU1A 1U6QA 3UB0A 2VIOA 5C1YA 2D2DA 2P8OB 1JMOH 3MI4A 3GSLA 2DLUA 2G5VA 4D76A 1B7XB 2XNDD 1Z8IB 3HATH 4YXWD 1SQRA 3GCHB 5F6MA 3UFAA 3P8GA 1GHAF 3T62A 1P3CA 3STJA 3UWIA 1PPHE 1EAXA 4LZ1H 3A7TA 2D1JA 1UHBB 2Z9JA 4XHVA 2PTNA 2C3SA 1WI4A 2FODA 2OC1A 1V2OT 1W11U 3MO9A 2I04A 1AU8A 1L1GA 1NM6A 4FUIA 1O5EH 5A0AE 3KDGA 3AW0A 4TWYA 2AWWA 3A84A 3EQ0H 1C2DA 5HKKD 3CH8A 1GHAG 2EGKA 4NXRA 2H5CA 4A5TS 1E1RD 2IWPA 1EPTA 1HBTH 2F4LA 1QCPA 3IITA 2XXLA 2BY8X 4GAWA 4JOEA 3F9FA 3TJVA 1PQ7A 2Q6FA 4HTCH 3SYJA 2ZTYA 4ZAEA 3SGBE 3CNRA 3PV5A 2TPIZ 1FIZA 2CK3D 3A7WA 3C1KA 4H4FA 5EOKA 1C4Y2 4NIYA 1RTKA 2PNTA 1SGFG 3OTPA 2J38A 2ODPA 2ZKSA 2HVXA 4ABJA 3SJKA 2A0QB 2ZFTA 4I8GA 3VPKA 4J2YB 1MCTA 2ZO3H 3FANA 3P95A 4Q63A 5DPAA 1MU6B 3L4FD 2A4GA 3SU3A 1KXEA 1H9LB 1WTGH 2HRVA 5B6OA 4HOPB 4FU8A 5EYZA 1O2XA 2AGGX 4ABDA 1FLEE 1GI4A 3LH1A 3UOPA 1QJ7B 4D7GA 1ZR0A 2XCNA 1LHCH 2KRGA 1SQTA 4WH6A 3WY8A 5CDFE 3M5MA 1QRXA 3LNYA 2GJGA 2F9BH 1GJ5H 2TIOA 3DSOA 1GJ4H 3VGCC 3TJUA 3TSWA 1DSTA 2V0BA 2Y81A 3O8DA 1MBMA 2WV4A 2GCTC 4X1RU 1W9EA 1J14A 3SHAH 4UFDH 1BTXA 1AMHA 3UPEA 7LPRA 1KWAA 1SHYA 1C1NA 2BY9X 4M7GA 1VITF 1UHBA 1GDNA 1O2UA 2XNIA 4ISLA 1UVUH 2B7DH 2GT8A 1KLJH 2FLRH 1BB0B 3A7VA 2YMSC 1GBBA 3SV6A 2D90A 4XSKU 5KEDA 1IAUA 1QJ6B 5L2ZH 3SQEE 3TMHA 4R8TB 2L4SA 3GY8A 3I29A 1YC0A 1CGJE 4NMRA 1VITG 1WQVH 3K2UA 3I18A 2XWBI 2KJPA 2A5AA 4JZEH 2EQNA 3QGJA 4AN7A 2P94A 4K72A 1OBZA 2ZCKP 4RT0A 3CS0A 4NIWA 2DAZA 3QX5H 1NN6A 4YZUA 3QIKA 2G2LA 3ID4A 3VB6A 1ID5H 3AAVA 3BTHE 2EEJA 2JINA 2Z9LA 3PROA 2RCEA 4E06H 4IS5A 2G51A 2A5KA 3BSQA 2BQ7B 5E8EH 3ZZDA 1HJ8A 4HOPA 1UTLM 3KIDU 3UNQA 1NRQH 1S6LA 3SNAA 2VIWA 1FY1A 1LMWB 3MU4A 2WPHS 3ZVEA 2KL1A 3SUFA 1A3BH 1NS3A 4I7YH 2AFQB 1G3BA 1LO6A 4WMEA 1H8HD 2DKRA 1CGIE 2EEHA 2RDEA 1TNHA 4GHQA 2VSVA 1F0TA 2JIZD 2KOHA 5F3XA 4IC6A 1C2GA 3A86A 4FVDA 2EDPA 4H42U 1P03A 5DTHA 1SGRE 1EJMA 1OWJA 5HXFA 1XUJA 1WCZA 5EIYA 2CJIA 3VEQB 2K8IA 2HPQH 1COWD 3I78A 2C8ZB 3EA8A 2FOEA 1N1LA 1O2JA 3VGCB 2TGAA 1ETTH 2EHRA 2VZ5A 3CBZA 2FESH 2OC8A 5DGJA 2GCTB 4B6EA 5E0HA 3ZYEA 3A8BA 4KKDA 4CH2B 2P93A 1KLIH 2XYAA 1K32A 1ABIH 2P3UB 1D3TB 3G01A 1Z1IA 4UFGH 4U30A 1PPZA 1O3KA 1SBWA 2CSJA 2YMSB 4ISHH 1V2RT 5DJ7A 2WHXA 4M9FA 1QY6A 2BM2A 2CF8H 1G3CA 4AB8A 4ZHAA 3U8RH 1DFPA 1A0LA 2F3CE 1NY22 1W8BH 4XD7D 4LXBH 2UWOA 3F2HA 4F48B 4NA9H 1BRCE 1HUTH 1TOMH 1QBOA 1P1DA 1TYNA 4CRGA 2LC6A 3SNEA 1N6FA 1GJ6A 1SI5H 1PPFE 4X6MA 5PTPA 2GMTC 1BZXE 1LQDB 4H6SB 1GHVH 1HLTH 1DE7H 3ZZCA 1KYNA 1UVSH 1HNEE 3TGIE 1RRKA 1BTWA 3GCOA 1AD8H 3VB4A 3SHCH 3A87A 3E8LA 3SI3H 1DITH 4AYVB 2IWNA 1V5QA 4NCYA 2WPJS 5EGMA 3NK8A 4ZHLU 5TCCA 2QV1A 2WPLS 4Q2KA 1C1VH 1GCDA 1THSH 5HYOA 1ORFA 2LNCA 2ZPRA 2ZQ2A 5E6PB 3MNXA 1DWCH 4DIIH 5I25A 4FUDA 1C1PA 1DT2A 2FNEA 3K82A 2AIQA 1QJ1B 3SUEA 2KJDA 4XBDA 2DJTA 3S9BA 3SJIA 3SUGA 5J4QA 2BYAX 3PWBA 5EQRA 2J9NA 2M0VA 1O3JA 3HK3B 2D8WA 1X5NA 2ZGJA 1TB6H 1P06A 3KQEA 4H11A 2Z3EA 2PKTA 2JXOA 2MX6A 1O36A 3SUZA 6GCHF 2M2AA 3MU5A 3HGNA 1D6RA 3K9XB 5HMAA 1HJAC 3FP8E 2Z9KA 3OEED 4Y8YA 4RSPA 3GS9A 4NWLA 1TPAE 4JOHA 1J9CH 3A89A 3K50A 2SGEE 4WH8A 2W4FA 3QDOA 4TY7A 5HETA 1ZSLA 5AFZH 1T2MA 3OU0A 1S81A 2EA3A 3EGKH 4XBCA 1EJAA 5E0JA 6GCHG 1DANH 5HDYA 5F53A 1FY8E 5FHTA 1U38A 1YPMH 1ANBA 2VIQA 1IU2A 1FAKH 3E90B 1O31A 2SGDE 1ZSKA 2P3TB 2QXHA 5EW1H 3K6ZA 1WAYB 1NESE 1GBKA 2W26A 2EI8A 1ANEA 2Z9GA 3KL6A 4JZ1A 3RXTA 3TSZA 4WJG2 1HB0B 1BRBE 2HALA 1G36A 3EAJA 2VWMA 4AGKA 1LCYA 3DIWA 1GI8B 1WYKA 3RC4A 4BTTB 5SGAE 4AORA 1N7TA 1IHTH 1PJPA 3UQOA 3S7KB 1FV9A 1UTQA 4FXGH 1C5TA 1G3DA 3R68A 3P8NA 1HXFH 5T6GA 2YT8A 5FX5A 1U39A 2ZFQH 4B73A 1WXRA 2H1UA 3RXFA 2SGPE 2M5TA 4UEHH 1A7SA 4E7NA 3ID1A 1A5IA 1W14U 3WWBA 4K2YA 1D4PB 2BD4A 1AE8H 3RXKA 1FQ3A 2HLDD 2BDAA 1OWEA 3LC3A 3SV2H 4BTUB 1VCQA 2RDLA 1Y3YA 2HLCA 3M3SA 3Q3XA 3B23B 3M36A 1D6WA 1WIFA 2BZAA 4JL7A 1EOLA 1Z6JH 3EE7A 3TK6A 1A46H 1O5GH 1P04A 3SJOA 2XBVA 4EDJA 3S7HB 1THPB 1SKYE 1O5AB 4OM9A 2ZDKA 3Q76A 3N7OA 2CN0H 3TGJE 2HE4A 4KFWA 1DWEH 1DX5M 2O8LA 1BTPA 3GCTG 4E34A 1ZRBA 1BJVA 1CA8B 4NXQA 1ESAA 1KXDA 1VB7A 3TH2H 5T6FA 5A2MH 4D8NA 2HVYB 4ZROA 1LQEA 2AS9A 3CENA 2DE8A 1JXPA 3QTOH 1SFQB 3L3TA 2H6MA 4INLA 1OWDA 1SGNE 3SV7A 3O46A 1K21H 4JJ3A 1GBAA 1NBME 1VAEA 2QGRA 3L33A 3P8OA 3RM2H 1SQAA 1CHGA 1QL7A 1GMCF 3BIVH 2OCVB 1HAZB 4JOPA 1C5MD 1O2VA 4CR5A 5C5NA 4BAOB 2G8TA 1J8AA 1HAGE 5G1DA 2F0AA 4NA8A 1TNJA 4BNRA 3E6PH 3M5OA 3K65B 3A81A 3BG8A 3OTJE 1FC6A 3PTNA 3E0PB 3MH7A 3H7TA 4WVPE 3TJNA 1GMCG 1QRWA 3MH5A 4TY6A 4B2BA 2PP6A 1QB6A 5EPNA 3ID2A 5JB8S 1CA0B 4FUGA 3GJ9A 1S85A 1YKTA 1P2OA 2ANKH 2PKAB 1ZTKA 5DP4A 3SNBA 1BIOA 1C5RA 2VPHA 3LU9B 2PKUA 4Z1MD 1O3BA 1ZLRA 2FYRA 1WUNH 2J4IA 3BF6H 2ANWA 1FDPA 1ZRKA 2GZ7A 1MUEB 4MPAA 1ANCA 1CT2E 3P17H 3DJ1A 6CHAC 1UJ1A 1GCTC 1EASA 2FPZA 2ZU1A 3HPMA 2UZCA 1FMGA 3GY3A 5H4IB 7KMEH 1Y8TA 1L1JA 1IQJA 1OSSA 2EI7A 2ZPSA 2H9EH 4NMPA 2O8UA 1DPOA 2YNAA 2W3KA 4L8NA 3F0OA 3SV8A 2FTMA 3P6ZB 3HKIB 1G37A 3FOAA
chains in the Genus database with same CATH topology
3KF2A 2CHAB 2ZPMA 5HJ1A 1GBHA 4CBNA 4FLNA 1PQ5A 2BY7X 2QKTA 1UTJA 2HWLB 3OY6U 1WFGA 4XOJA 3IG6B 2AWUA 1MZDA 5ETXA 3K1RA 2AWXA 1BFEA 5HEYA 4B71A 3MNSA 1FY5A 2UWLA 2W7UA 1NRSH 3LNXA 2ZU3A 5A0BA 4Q6SA 1O34A 2G5MB 2ZPQA 1DS2E 4ZH8A 2VWOA 1TIOA 4K60A 1RIWC 1ZPZA 4IN1A 2AEIH 2AERH 1Q3PA 1UCYH 1JIMA 4CRCA 1EP5A 3LIWA 1QAVB 1Y5AT 1P8VC 2ANYA 5CHAB 2XTTB 1FPHH 2PKAA 2BDBA 2KAIB 2KBSA 4NG9H 4O97A 3GCHC 3AVZA 1TX8A 2ANMH 1NTEA 4WYTA 1B8QA 2A4OA 1LVBA 3F1SB 2EDVA 3EA9A 1RGWA 3V12A 1DSUA 1HAOH 1C5OH 2D8IA 2P3WA 1IQFA 1E37B 4CRFA 1JWTA 1AB9B 4FU7A 6ESTA 1GJCB 2PZDA 1K1MA 3GABA 1ZOMA 3RL7A 2AIPA 1X7AC 2KA9A 3L6PA 1E0FD 1BBRK 1G3EA 1O2HA 1R6JA 1O3EA 1W12U 1XUIA 1C5WB 2ZFRH 5EODA 1ABJH 4YO9A 1EZXC 1GJ9B 1HYLA 1EX3A 3ODDA 4KP0A 5JBCS 2OPGA 1QB9A 2DE9A 1V1TA 4JOFA 1O3OA 5A2PA 1C5NH 2BOKA 3OX7U 4NMSA 4NWKA 5EQQA 4A1XA 4JYUH 1AIXH 2HNTC 1RXPA 4X8SH 4BXWA 4JK6A 3RC6A 1TRNA 3LT3A 1Z8JB 1GMDG 1C1TA 3U8OH 4I8JA 2Q9VA 4NZLA 1MFGA 4Q2PA 1KTSB 2ASUB 2NU4E 3MYWA 1TAWA 2UUYA 1NFYA 1H1BA 4B75A 1BMMH 1C2KA 1P11E 3SHWA 3DFJA 5C1XA 1MKWK 2YUBA 4YYXA 1QB1A 1TGSZ 4BAQB 4WMFA 2KAWA 5HFFA 1TBRH 1N8OB 1QAVA 4OEOA 5GLJA 4UD9H 1SGQE 2O8TA 4U32A 2KAIA 2RCZA 1WF8A 5HF1A 2K1ZA 2VIPA 4Y71A 4YDPA 2VWNA 3KN2A 4Q80A 4O03A 4Y0YE 2F5YA 1O3IA 1OWIA 4E05H 4YOJA 1O2NA 3O8CA 2BX4A 2PW8H 2ZCHP 2PWXA 3V7TA 1XUHA 4F4OC 1PPCE 3SORA 3PMBB 1MFLA 3QGLA 1LKAA 1S5SA 4AFUA 4X1QU 2AYWA 4SGAE 3ZZ6A 2K1QA 1UEZA 1W7XH 1QRZA 2XC0A 5LPEA 4YT7H 4MQAA 4K5ZA 4MPVA 1LVYA 1C5LH 1ZZZA 1O3LA 2GT7A 4Y79A 5DKMA 3GYLB 2BVSH 4Y11E 1BTZA 1P09A 1C2HA 1C2IA 1LDTT 1T8OA 1INCA 1HV7A 3RXOA 2HPPH 3GDSA 3ZVAA 2H2ZA 2STAE 1CVWH 2GGVB 3SOSA 4O3TA 2JILA 1FXYA 1O2ZA 1O3PB 3NPSA 4E35A 5HFDA 1JBUH 2ZHQH 1PYTC 1BA8B 4A1VA 4Y7AA 4TPYA 3FZZA 1Z86A 2KG2A 4JK5A 1L4ZA 4Y6DA 2FCFA 3U98H 1QIXB 2H2BA 1P02A 3Q3YA 3P70B 1X5RA 5L30H 2ESTE 2ZTXA 4B1TA 4K69A 1W0YH 1NZQH 2UWPA 2EC9H 3KHFA 4GVUA 1UTKA 4OS1A 1SOTA 3STIA 5B42A 1RTFB 3GY2A 3LONA 3UOUA 1B0EA 2VINA 1SR5C 1P2NA 1SB1H 5GDSH 1J16A 3SNCA 1C2JA 2I6VA 3ID3A 1QL8A 2A7HA 1GI3A 1C1QA 1OXGA 1KXCA 1V2TT 2QIQA 1AWHB 2OSGA 4I8KA 3BTWE 3GICB 2R4HA