3GCOA

Crystal structure of degs h198p/d320a mutant modified by dfp in complex with dnrdgnvyqf omp peptide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
317
structure length
302
Chain Sequence
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINPGNGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVNDLIISVDNKPAISALETMAQVAEIRPGSVIPVVVMRDDKQLTLQVTIQEYPAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 59
structure length 302
sequence length 317
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2009-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3gcoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gcoA01
5JBCS 3H7OA 3BTME 1F5KU 1C5YB 1AVXA 4YT6H 1GG6C 2JETC 2QXHA 3M36A 3T2NA 1BTZA 2QXGA 2F9BH 5LPEA 1BBRE 1N6XA 2I04A 3ZZ7A 2XBXA 4Q80A 3SUGA 5T3HA 1GBEA 1ZRKA 1TX7A 1ZUBA 5E11A 1CE5A 3ITIA 4GCHG 1PQ7A 2ZTZA 1FIZA 3SHAH 3GCOA 2STBE 3VQGA 2FODA 3GISB 2Q6GA 2J94A 1BOQA 4GSOA 2DKRA 4NMTA 5HFCA 2AGGX 3O8DA 1GDQA 1IQEA 1SGFA 2WUCA 3GJ9A 3O5NA 4X6MA 1C1MA 1AZZA 3NFKA 1HXEH 3VEQB 5AHGH 1EB2A 4OEOA 2AERH 4NMOA 1PPEE 2VIWA 1G2MA 2KBSA 2FPZA 2JIKA 3K65B 3S0NA 2ZFTA 4INHA 4JORA 1MC7A 3LC5A 2BM2A 2FX4A 1MKXK 1P11E 2EGOA 3MH5A 2KPKA 1O5CB 1KSNA 1TNKA 5GLJA 2V6NA 1SOZA 1HUTH 3UFAA 4BXWA 1TX6A 2EXGA 1VITG 5IYTA 3O8BA 1YCPM 1UVPA 1BMAA 2F5YA 2M0UA 1SSXA 1C2FA 2UWPA 1C1NA 1CO7E 4A1XA 3IITA 5D13A 3T26A 3RM0H 3VB4A 2H2ZA 1C1TA 1C5RA 3TJOA 3PV4A 2YUBA 5CMXH 5FPTA 1KLJH 3A81A 3A8CA 4KFWA 1ZR0A 2FYRA 2ZGJA 3EE0B 2WL7A 3F9EA 5DTHA 2FDAA 1EPTA 1D3PB 2ZTYA 1BE9A 4EDJA 5HJ1A 1PPGE 3EGHC 1MTNB 4JZIA 4D76A 4D8NA 3UNRA 1SQTA 2ZCLP 1V3XA 3VXEH 6LPRA 2ODQA 1FC6A 4DG4A 3RP2A 2OZFA 2VWRA 1GHYH 1NM6A 2QYIA 4X6PA 1UF1A 5EPYA 2PWXA 2A7HA 2FEQH 2VWLA 1M9UA 3BPUA 4NFEA 2EJYA 3TSZA 1XUFA 3NGHA 2UUFB 3R0FA 1M5ZA 2ZG0H 4K75A 2YT8A 3QTVH 4DCDA 2GCHF 4K1EA 3V0XA 2ZQ2A 4NIVA 1WQSA 4BAOB 1K1NA 1UCYH 3OSYA 4A5TS 4HOPA 5F8ZA 1TRNA 2EGNA 3SU1A 2V35A 2XWAA 5F8XA 2P93A 1A46H 1SGPE 3MNXA 4LK4A 2A5AA 4AGJA 9LPRA 1VB7A 4HGCA 2HNTC 4O06A 2LA8A 1QB1A 4AFQA 1BB0B 5CHAB 3LGIA 1N8OB 1MCVA 2BYGA 5DGJA 1UEQA 2OINA 3QDZB 1BHXF 2H5CA 1RD3B 1U39A 1THPB 1CBWC 2G4TA 2DM8A 3BG4B 3CENA 4NMVA 1B8QA 3RXOA 1Y3UA 3KEEA 4FUDA 2D2DA 7GCHF 4RKOB 2BDYA 1FJSA 8ESTE 1AQ7A 3S7HB 4TPIZ 1QURH 3SHUA 1C5MD 5A8YA 1S81A 1YCPK 4IGDA 3JZ1B 2PW8H 1P3CA 2XC4A 1O2QA 3F1SB 3SJ9A 1FY5A 3BEFB 4NSVA 3A83A 2OUAA 3DJAA 1TQ3A 2ZGHA 2ZO3H 2ZCKP 2Y80A 3PB1E 5DO4H 1EAUA 2RCZA 4Q2NA 1NRNH 1TPAE 4D9QA 2VH0A 3ID2A 1Z71A 1ACBE 5TJXA 4SGBE 1Q2WA 1MBMA 1UVUH 4NWLA 2Q3GA 2OD3B 1V6DA 1Z86A 1WF7A 4WYUA 1QY6A 5L30H 1CA0C 1L4DA 1GI2A 1O2GH 3A7TA 4CH8B 1N6EA 4UE7H 4B73A 2BXTH 2FOCA 3NK8A 4RN6A 1J16A 1XUHA 3EA7A 1V2QT 4AFZA 1MKWH 1ZMNA 4REYA 3RMNH 1AKSA 1WJLA 1C5PA 1K22H 1E0FD 1MUEB 2R0LA 1O39A 3BTGE 5A8ZA 2A5IA 1VGCB 1DY9A 2OBQA 1C1PA 2Q6FA 1KIGH 2UUKB 2FS8A 2FTLE 3GGEA 2EA3A 1UM1A 1O2TA 2W7SA 1O36A 2GKVE 3T27A 4BANB 1X5RA 5DP4A 4JOFA 3KZDA 3TMHA 1X5QA 1K1JA 1C2LA 1V2RT 4O3UA 2BY7X 2FLRH 5EGMA 1GMCF 2XNIA 3UQOA 1PPZA 1SLXB 1JIRA 1GJ6A 1MU6B 2FO9A 5DP7A 5EPNA 3ZV8A 3U1JB 1SVPA 3RXRA 1ANDA 2OSGA 3BF6H 2Y6TA 2F91A 1PDRA 2TGDA 1GMDG 2J4IA 1HPGA 2ZFPH 3DJ1A 1W10U 1QJ1B 4D9RA 2ZDLA 4FUBA 2XBYA 1HAIH 1TGTA 5EYZA 1OYQA 2WINI 3E1XB 3RXLA 1MAYA 4Y8XA 3SUDA 4G69A 1KDQB 5HFBA 1P2MA 1DX5M 2WPHS 3SUEA 2J9NA 1GGDB 3LGUA 1S6HA 3MU1A 4NZQA 3OX7U 2SGFE 1V1TA 4JL7A 1LDTT 1O37A 4AG2A 2A5KA 4ZKRU 2KJDA 3ATWA 5F3XA 1SG8B 1T4VH 2OPGA 1C5NH 2PSXA 4X0WU 1O2SA 2G5VA 2BY8X 1YPKH 1CT2E 1O3EA 1Y59T 1P9SA 3BTDE 4YT7H 2Y82A 3TNTA 2XBVA 1HAVA 3B76A 1TABE 2SGAA 2GCTB 4ABDA 3SJOA 1BBRH 3GY6A 1L4ZA 4UONA 4NIXA 1FCFA 1LPZB 1XXFA 1XUJA 3NWUA 1MQ5A 4PROA 1O3AA 4NXRA 1ORFA 1F5RA 5L6NH 1N6YA 2OXSA 3MU8A 1ZSLA 3A7WA 4NXQA 5G1EA 1GHWH 1V2LT 4K8YA 1FC7A 1HAGE 4BOHA 3ZZ3A 3VGCC 1PQAA 1GI6A 1O3IA 1V5QA 3O8RA 1UMAH 2XWBI 3FP6E 3U69H 3PWBA 5HFEA 1MH0A 3DHKH 1S5SA 3E0PB 3SV8A 2GV7A 1UK4A 1A5HA 3RM2H 3MMGA 4KGAA 3R68A 2ESTE 3S69A 1Z8GA 1Y3VA 1P57B 4A6LA 2P16A 1F7ZA 3VB5A 1SOTA 1JBUH 3SN8A 1GHXH 2BDAA 5JXBA 1THSH 2QCYA 4OAJA 5C5OA 3ODFA 3GDVA 3V12A 1BITA 1HJ9A 4I32A 2P3TB 5ETXA 3K1RA 2KAWA 1UTOA 5ABWA 2PR3A 5DP8A 1ANBA 1QFKH 4THNH 1AIXH 3I29A 2QKVA 3ATIA 4I8KA 5EG4A 4FUEA 5GCHG 2QA9E 5A0BA 1LQEA 1VJ9U 2VGCC 4GAWA 4XBCA 1FN6A 3DD2H 1SGNE 4XDEA 4NWKA 1K32A 1HBTH 1HIAB 1C9PA 2ALVA 3O46A 3ENSB 2H1UA 2EC9H 1EASA 1HFDA 1GL0E 5F03A 3UNSA 3RXKA 2REYA 1ARBA 2MHOA 2A0QB 1IQNA 3MHWU 4NZLA 1FUJA 2BDCA 3RMLH 2HRVA 2BD5A 5J4SA 1EAXA 1F92A 1WG6A 4Q2PA 3GSLA 1VJAU 3FANA 4ZKNU 3I77A 4MG3A 4DURA 5HF1A 1QLCA 2DMZA 1QJ6B 3SGAE 2VJ1A 2ALPA 4Z6AH 1GCTC 1QTFA 2OC1A 2F9PA 4GHTA 2L4TA 4UU6A 4GUXA 2O8TA 1GI5A 3GCNA 2NU1E 4JZEH 1I16A 2A2XH 2JILA 2ZDMA 4LXBH 1EOJA 5F8TA 1GMHG 2PDZA 1C2KA 4XHVA 1TOCB 3B8JA 3FZZA 1GBMA 2LOBA 5DP5A 3DA9B 3U8RH 3ID4A 3RLYH 2GT7A 1ELVA 3U8TH 3ZVFA 1G9IE 4O9VA 3GCTF 3F9GA 4Q6SA 2OGPA 1GI1A 2SGQE 2PKSC 1MMJN 1JXPA 1WQVH 3TNSA 2W5EA 4A1TA 4AG1A 3HK6B 6CHAC 1NT1A 3KQEA 3PO1C 4Y71A 2ZU5A 1DWDH 1P10A 4F49A 2W4FA 4RKJB 1YPGH 4UEHH 2GV6A 2CHAB 1H1BA 2GD4B 4X1NU 1MTUA 1W12U 1ZTKA 3BSQA 3PWCA 1BJVA 3KN2A 2BD3A 1ETTH 4E7RG 1XUKA 4DT7B 1VAEA 4WVPE 1Z8JB 5T6FA 5LPFA 4INLA 2A45B 4X6NA 1BMMH 3MNSA 5HMAA 5H4IB 1FAXA 3RXVA 1QRZA 4CHAB 2PA1A 1E36B 2ZNKH 3C27B 1V2TT 4FU7A 1RGWA 1O2PA 1HJAB 2VINA 2KRGA 3A7ZA 5B6LA 3S9BA 3SOSA 2Y81A 2ZI2H 2DAZA 1EZQA 1TOMH 2CGAA 4X1RU 1G3EA 5I46H 4IBLH 1HV7A 4Q7XA 1WFGA 2G2LA 4ZHLU 1HCGA 3S9CA 2J92A 1UTJA 1DXWA 2Q9VA 4K72A 2OBOA 4WYTA 1QA0A 1XZ9A 3PS4A 1RTLA 2VIPA 4NMSA 5AFYH 1AHTH 1TRYA 2BDGA 3FAOA 4CRCA 3VQFA 1AU8A 1WFVA 1UHBA 4NA8A 4XOJA 1HAHH 3DFJA 2XW9A 3TSVA 1F0RA 3BV9B 4AB9A 3CBXA 2DUCA 1WU1A 4E7NA 3SOEA 4JOJA 3L6PA 1Z8IB 4ABEA 1GBAA 1G32B 1JRSA 1CA8B 4JK6A 2LPRA 2UZCA 3VB7A 4FUFA 2FXRA 2NU4E 2VVVA 3P8FA 1EZSC 1ZZZA 2V0BA 3SO3A 1KYNA 1C1RA 2I0IA 2ZWLH 2O9QA 1AI8H 2H9EH 4Y8ZA 1F2SE 2C8WB 3KGPA 1ELAA 2Z9KA 1O2JA 5GPIB 4N6XA 1UJ1A 4K6YA 1MTNC 1ZJKA 4CBNA 5T6GA 2BQ7B 1GHBG 5DJ7A 3SFJA 1LTOA 3ESTA 4KTCA 2ZDKA 1HB0B 2I6VA 1AY6H 4MPAA 1ZRBA 1OX1A 1LHFH 1Y3YA 1QNJA 3P6ZB 4AB8A 4ISLA 1TA6A 2ODYB 1SLWB 1WH1A 1SBWA 2ZC9H 1P1DA 3W95A 2DB5A 2H2BA 1WF8A 2JH5D 1VCPA 2QAAA 1S0RA 1L1JA 1U6QA 1V2NT 4GCHF 4ZROA 2F3CE 5A2PA 4K76A 3PV2A 5FBIA 4AZ2B 1CT4E 3EA9A 4WY3A 1G36A 1LVOA 1YLDA 3PLBA 3A7VA 1B5GH 1DM4B 8GCHF 1KEFA 1Y5UT 3TGKE 1U38A 1W9OA 5HETA 4AYYB 3Q3KA 1B0FA 1P09A 2WPKS 1ABIH 1DPOA 5CHAC 5AFZH 1N8OC 1TYNA 4HFPB 1OBYA 2K20A 3LT3A 5FCRA 2AH4X 3M5OA 2D8IA 1O2OA 1O3NA 2MX6A 1C1QA 5K7RA 1GVLA 2ANKH 2ZU2A 3BG4C 3LJJA 2EHRA 3I78A 1GVZA 2TRMA 2F9OA 2IWQA 4X8TH 1TBZH 1O2ZA 2I0LA 3OY6U 3M35A 1XXDA 1DLKB 7KMEH 1RJXB 2R2WU 4WXIA 4JZDH 2R3UA 3PM3A 4VGCB 9ESTA 1P3EA 1MQ6A 1V5LA 2BD2A 4Z8JA 4MVNA 1UITA 2ANWA 4M7GA 1O2MA 1W9QA 2UUJB 3JXTA 4MNWA 1OPHB 2OCVB 2QIQA 3SNCA 1ELFA 1ZYOA 4ISNA 3MO3A 4OS4A 4Y0ZE 4Y10E 5E0JA 4K1SA 2IWPA 4X8SH 2ZIQH 1A0LA 3MOCA 1C4V2 1A0HB 3SU2A 1EPTB 1AFQB 2BOKA 1LCYA 2YUYA 1BTYA 1C2GA 3TJVA 2CSJA 4MNYA 2VWNA 3VFEA 3EQ0H 5L2ZH 1DANH 1SHYA 5E2PA 4D7GA 1C4Y2 2HPPH 2XC5A 4BAHB 3L3TA 4U32A 2AEIH 2ZHDA 5C1YA 4B74A 1YGCH 1V2MT 3PMAB 4OGYA 3Q77A 2KG2A 1ZLRA 3D23A 4XBDA 3KNXA 1D6RA 2D90A 1GHVH 2RDLA 1GJ7B 3DT0H 4NMPA 4H6TA 1GQ4A 1SGIB 3O8CA 1JMOH 5GDSH 3HVQC 2OCSA 1ABJH 3NFLA 4FGMA 5EXMA 5FAHA 1VGCC 1P02A 3LGWA 3MYWA 1VR1H 4TWYA 1C5LH 2ZQ1A 4NA9H 3L33A 3BTHE 1CGJE 4CR9A 1UCYK 2EGKA 1DWCH 3K6YA 1QB6A 1QGFA 3SBKA 2Y7ZA 2FZZA 3OY5U 1WIFA 2RG3A 1ETRH 2QKUA 5EQSA 2Z9LA 1BTXA 4UU5A 4RSPA 1OKXA 1FV9A 3STIA 1FNIA 3UOPA 1UEWA 1P2NA 4K5ZA 4IN2A 1QL8A 4CRGA 6ESTA 1NTEA 1QHRB 4X1SU 4K60A 3MU5A 2YTWA 2A31A 2VIQA 1EJMA 1PYTC 2AS9A 5K0HA 2ZU1A 5LPRA 1BMNH 1LKAA 1UTLM 3SJKA 7LPRA 2BLWA 2DE9A 3ATMA 3CP7A 4IC5A 3TJNA 4ZKOU 1C2JA 1GGDC 1W0YH 1OBXA 1K1LA 2Z7FE 3M5LA 4K2YA 1W13U 2BYAX 4K69A 4X2WA 1GJCB 3UIRA 3M5NA 2G51A 3QZRA 2FIRH 2FNEA 1HGTH 4NNLA 2GMTB 3PMBB 2IJOB 2KL1A 3LH1A 4K1TA 1MTWA 4GVUA 4YTAA 4BTIB 4LZ4B 5FB8C 1BRCE 2FESH 1RIWB 4I31A 4Y79A 1I92A 1WUNH 1C1UH 2AMDA 4Y6DA 3VPKA 4ABGA 1NFWA 1AMHA 5FX6A 1X8SA 1EP5A 1ZGIA 3LNXA 3MI4A 3NPSA 2BB4A 3LONA 1L6OA 1WOFA 1HNEE 4NMQA 1O3OA 2PNTA 2WPMS 1QAVB 2FOBA 2FI5E 4I8GA 1VITH 4XBBA 3UNQA 4J2YB 1SGDE 3LGYA 1MTVA 3W94A 1PJPA 3BTKE 4ZUHA 2B8OH 2ZGXH 1W7GH 2K1QA 4Q7ZA 4I8JA 1O35A 2P3WA 1ZSKA 2C90B 3AASA 4D7FA 2EI6A 3MH7A 2B5TB 1J8AA 3CS7A 1MZAA 1SGYE 3PTNA 2BX3A 4DGJA 1Y5AT 3TGJE 3DUXH 1IQHA 2QKTA 3MU4A 3QGNB 3RC5A 4FUIA 3A7XA 2ULLA 1MKXH 1GHAG 2VIDA 3R0HA 1TBRH 2M0ZA 4ABHA 1ELGA 4Y0YE 1EX3A 4YOGA 1OYTH 2H3MA 5C67A 1TGBA 3QK1A 2ZDNA 2SGPE 3HATH 3E16B 1PYTD 1DDJA 1TMTH 1C5UA 1HXFH 1TNIA 1KY9A 2LUIA 5E8EH 3FVFB 1J9CH 3RXBA 1A3EH 2VIVA 5PTPA 3RLWH 3SNAA 1Q3OA 1FQ3A 2HNTE 3M37A 4AX9H 1EB1H 4NA7A 3PYHA 1MD7A 1FPCH 1OZIA 1BHXB 5HXFA 1G3DA 2ZZUH 2FOFA 5CE1A 1AUTC 2F9UA 3RU4E 3PLKA 1OWEA 4FUCA 3ZVCA 4Z33A 3BTFE 1TGSZ 2OC8A 3GY8A 3M7QA 1FY8E 1KXEA 2XC0A 1BUIA 3ATKA 1HAVB 1RS0A 4ZHAA 1JIMA 1A3BH 1UTMA 1C4U2 3LJOA 1EQ9A 1K1IA 5HM9A 1A2CH 2Z9JA 1GI8B 1T8OA 1Z1IA 2D8WA 1A1RA 1CGIE 1D6WA 2HE2A 3D65E 2BY9X 1AB9B 2FOGA 4WWYA 3T25A 3A82A 4BTUB 1JRTA 3I4WA 1LPGB 1GBJA 3D49H 4H11A 1PQ8A 1GVKB 5JDUB 2B0FA 1ELTA 1P2IA 4ZKSU 1UTNA 2GZ9A 1O2YA 4L8NA 2GVFA 3QGLA 2ANMH 4I8HA 4MPVA 2M3MA 1BZXE 2WPLS 1OOKB 2FTMA 2H9HA 2ASUB 1VJ6A 2KOMA 2J38A 8KME2 2G5MB 4GVDA 3Q3YA 4ZXYH 2O8LA 3T62A 1DICA 1RTKA 2ZDVH 2GCHG 1OWKA 3KL6A 1L0ZA 1Q3XA 5HF4A 3QJNA 3U8OH 1V2UT 1V2VT 3K6ZA 3SUFA 3RU4D 5E21A 1TPSA 2F9NA 4P0CA 4ASHA 1C2EA 2CHAC 1LMWB 3UQVA 1N1LA 5EQRA 1O3CA 2Z3EA 3HPMA 1NO9H 1XUIA 3Q3XA 4INKA 1PPBH 1O3KA 3CH8A 3HGNA 3RXGA 2EEGA 1NF3C 3RXCA 4F8KA 2JINA 5GCHF 2VWMA 2ZFSA 4O3TA 4R8TB 5EOKA 3TGIE 4X2YA 4CHAC 1SFQB 1WV7H 1NC6A 1O3DA 5C5NA 2OQUA 1YCPH 2PFEA 2ZGBH 1HJAC 5EXLA 2IWNA 1TQ0B 2GDEH 1YC0A 1N6DA 5EQQA 1KLTA 5JPMH 2ZF0H 4K78A 1ESAA 1S83A 4UDWH 5E2OA 1V6BA 3BIUH 3HPTB 1OS8A 3B9FH 1XVMA 1BA8B 3BN9A 2BD8A 3RXMA 3I1EA 4CR5A 2ZFRH 3A8AA 2HE4A 2VNTA 1MCTA 1O5DH 1YKTA 1N99A 3KZEA 3MNBA 2Z3CA 3SJ8A 5B6OA 1D4PB 4MNVA 1IQIA 4JCNA 8LPRA 2HWLB 4YDPA 2Q6DA 1GI9B 2DLUA 2TIOA 1NZQH 1GJBB 1C5SA 2YT7A 1BFEA 2FN5A 1HAYB 3RC6A 3T29A 2KA9A 1AGJA 2HNTF 1DT2A 3TU7H 2TGTA 1HAPH 2CF8H 4HI3A 3IG6B 3M7UA 3RDZA 3GICB 1C1SA 2AGIX 4TY6A 3PV5A 1IHJA 5J4QA 3GY3A 2ZHFH 5A2MH 2G8TA 1G3BA 3QZQA 3SU3A 1Y3WA 1RY4A 1QIXB 3KQBA 1AZ8A 1PPHE 1FC9A 2RA3A 4SGAE 3CS0A 1O5EH 3E6PH 1C5OH 4B1TA 4UD9H 1E34B 2R3YA 2UWOA 1TGCA 1SGQE 1T31A 1ZTJA 4YESB 1GPZA 1O2LA 4E34A 4NG9H 3SI3H 1GBTA 2QT5A 1P0SH 2PTNA 1ZHMA 3SGQE 5HFFA 3U9AH 2WPIS 2HGAA 1E35B 4X6OA 1NFXA 1GI4A 3CBYA 2ZPRA 2GTBA 3LDXH 2EEHA 3ZZ9A 1NRSH 1BMLA 3ODDA 3BEUA 2L97A 3SU4A 3FY5A 4JK5A 4AN7A 1WYKA 2H6MA 5F6MA 1Q3PA 2D92A 2EDVA 4BAQB 1O38A 1UK3A 1LQDB 3M3SA 4GHQA 4NCYA 1DWBH 1C5VA 1R6JA 3RL7A 4E05H 1KXDA 4UFEH 4FVDA 4XSKU 1ZOMA 2V3OH 4KTUA 5TCCA 1NN6A 2ZCHP 1SLVB 1YBWA 2BQ6B 3U98H 4ABIA 3FZDA 4QT8C 1V2PT 4JOKA 1FI8A 1GI0A 1O3LA 4MNXA 2FWWA 3BTWE 1ESBA 1EZUC 4B71A 1LVMA 4MPXA 1TNJA 3TH3H 3GOVB 2QF3A 3ZZ4A 5EXNA 5BPEA 5C20A 5HDYA 4VGCC 1GBDA 1O5AB 1A5GH 1K2I1 4ZXXH 3RXDA 2EI7A 3SU5A 1CQQA 1K1OA 2WYJA 1O2XA 1XKAC 2A7JA 2PV9B 1O2UA 4PQWA 5C2ZA 2VSPA 1V2KT 1UK2A 1LHEH 4Y11E 2THFB 3ID3A 4NFFA 1DLEA 2FOEA 2CF9H 2F83A 2NU0E 2BLVA 5L2YH 1TB6H 1BTWA 2O8MA 4TY7A 1EPTC 1AFQC 1GHBF 4R2ZA 1WCZA 1O31A 2ZPQA 1YPMH 4DJZB 1F0TA 3KIDU 4A7IB 1RXPA 2VH6A 3A84A 1YPLH 3SHCH 1V2JT 3OU0A 1HJ8A 2G55A 3AXAA 5E22A 4U2WA 1OWHA 1WAYB 1HRTH 3TK6A 2JWEA 3WKLA 1H8DH 3UOUA 2VVUA 2FMJA 3TK9A 1PFXC 3HK3B 1YBOA 3NXPA 4WH8A 3SNBA 3LIWA 3HKJB 1YPEH 3RL8A 1G3CA 2ENOA 3BEIB 4X2XA 1GJ4H 3M7TA 4DIHH 1MU8B 4LZ1H 1LVYA 4LOYH 1C2IA 2L4SA 5E6PB 3SU0A 1ANEA 1GBFA 3RC4A 2TGPZ 2G00A 1LVBA 4X1QU 3EGKH 1MBQA 2EEIA 1ZPCA 2BVXH 5BRRE 1LHCH 1YP9A 2KV8A 2FLBH 3GY4A 1QJ7B 3A85A 1UO6A 1XX9A 3K9XB 1TALA 1IQLA 1O32A 2A32A 1T8NA 1XMNB 3E3TA 1SR5C 1P06A 1S0QA 5DG6A 2AIPA 1C9TA 1QB9A 3DORA 3M5MA 4WMFA 4YLUA 4AYVB 3R3GB 1O2HA 1O3PB 4CH2B 2VSVA 1CT0E 3MNCA 4B2BA 3EA8A 4NSYA 1GDNA 3QDOA 1UEZA 2PUQH 1P2JA 2AIQA 3RLEA 1T2MA 4I8LA 2OC0A 1AVWA 3QE1A 4H6SB 3PDVA 2YOLA 2FYQA 3EAJA 5G1DA 2V90A 1UJUA 3ZRTA 2GMTC 5A8XA 3A7YA 3B23B 3CC0A 1RIWC 3VB3A 2PSYA 5EU8A 3QX5H 1TE0A 3A87A 1TP3A 1MFGA 1D5GA 2VB0A 3FFGA 5HM2A 1O3HA 3L4FD 1GJAB 1XM1A 4CBOA 1WHAA 3ZZ6A 3GCTG 4OGXA 2FE5A 1IQJA 2RA0A 3EGGC 1HAOH 6GCHG 1ELDE 4Q2OA 5JBTA 4R0IA 2BVRH 2OP9A 1AWHB 1GJ8B 3PROA 4MPWA 4MQAA 3V7TA 2ZU4A 3A8BA 2R2MB 1L1NA 3BTEE 3TPIZ 1OBZA 1EKBB 3ZZCA 2FP7B 2ZDAH 3RUOA 3IWMA 3CYYA 3TITA 4XFQA 1YM0A 1Y8TA 2PHBA 4NMRA 3C1KA 1TMUH 3JZ2B 1SGTA 3SQEE 4NIWA 1HDTH 1VITF 3S9AA 3F6UH 2BD7A 3UY9A 3BIVH 2KJKA 1TNGA 1P12E 1MFLA 1QRWA 5E1YA 1WI2A 1IHSH 2BZ6H 2C8ZB 1TFXA 1FXYA 2HALA 1SPJA 4MPUA 3Q00A 2W7RA 2UUYA 3ZVGA 1O5GH 2C3SA 2Y5FA 1BIOA 4WMEA 2W3KA 4GVCA 1B0EA 3EYDA 1DWEH 1UEPA 2O8WA 2I4SA 4IC6A 3QGJA 2W3IA 5HEDA 1W7XH 1TLDA 4MLFB 3SU6A 5DPAA 3UPEA 1Z1JA 4OS1A 2EDZA 1IAUA 1QQ4A 1S85A 2QF0A 1UTPA 1C2DA 4TWWA 4FU8A 2EDPA 1NU7B 3NCLA 3RXPA 3MH4A 1TPOA 1WHDA 3P95A 1P9UA 4FUHA 1A4WH 5IDKA 1FY3A 1BTHH 3ZVBA 3QIKA 2V1WA 1ZSJA 2PKAA 2XTTB 3V13A 1UVOA 1P2KA 2VIOA 1P03A 1QRXA 1FMGA 3NZIA 1AB9C 1OSSA 2PKTA 2IPHA 2XBWA 3ZZDA 2X7ZA 2LC6A 2QXIA 4JOPA 5TCAA 1CHOG 1UJDA 1V62A 1SGFG 2QGRA 3ID1A 4J1YA 2VPHA 3OTJE 1KXBA 4HOPB 3SV7A 1BDAA 2Z9IA 3T28A 4ZHMU 4CRFA 2G4UA 2VVCA 1TONA 4F4OC 1A5IA 3E90B 5JB9S 3SHWA 2P8OB 3H5CB 3VXFH 5AF9H 4Q6HA 1EATA 2Y7XA 2CS5A 1FY4A 1IHTH 2P3UB 3LKWA 3TIUA 2KAIA 3MWIU 1RGRA 3VB6A 1UTQA 5HFDA 1ZHRA 1DSTA 2PLXA 4JYTA 5GJ4B 1GHAF 1ZGVA 1K28D 1TP5A 4DY7B 1Y5BT 1SQAA 1LO6A 1FN8A 3UR9A 8GCHG 1AWFH 1D3TB 2BLQA 3BG8A 3QLPH 1Q31A 5I25A 1NFYA 1QBNA 3SNDA 2J2UA 1YPJH 2JOAA 2BHGA 1YYY1 1UVTH 2SNWA 3PTBA 2GDDA 4ABJA 1V2OT 2ZGCA 4AMHA 1H9HE 2Y5GA 1Z7KA 3ZZAA 4X8VH 4UFGH 1QBOA 3E91A 3F68H 1LKBA 2M5TA 1KLIH 4RI0A 2FCFA 2A4RA 1QCPA 1TQ7B 4JOEA 1EP6A 1GDUA 2WUBA 2AMPA 1HAZB 2CXVA 3GCHB 1CHGA 1T7CA 3NKKA 1P1EA 2BX4A 1O3GA 2GCTC 3EDXB 2JH0D 1NRQH 3TK5A 3SQHE 1GJDB 3ZVDA 1RTFB 3R69A 2VU8E 4DW2U 2ANYA 4IW4E 1T32A 1TBQH 2BDHA 3P70B 1L1GA 1SLUB 5GIBA 2ZFFH 3KQCA 4JMYA 3F9HA 4ISOA 2PUXB 3A88A 4X2VA 1T8LA 2Z17A 1H8IH 5GNDA 3LOXA 5DP6A 1AKSB 1SB1H 1MAXA 4E06H 1DUEA 4E3BA 3ZVAA 1KXFA 1NROH 1TPPA 3TH2H 3PMJA 1LHGH 4TYDA 4OS7A 1ID5H 1MKWK 2WPJS 2B7DH 4GHNA 1N7FA 1C1VH 3LU9B 3SUZA 2PZDA 2G5NA 3KHFA 3WKMA 1O2KA 5EZ0A 2ZU3A 2WV5A 1NPMA 4FUJA 1FPHH 2SGDE 1MTSA 3SV2H 4MDSA 3AAVA 3SORA 2QXJA 4FU9A 1P04A 1SC8U 1GMDF 2GZVA 1KXAA 2PGBB 2BTCE 4DOQA 5E0HA 5T6DA 4JZ1A 4UFDH 3GDSA 1RRKA 1G9OA 3KCGH 2NU3E 1A0JA 3QUMP 1Q7XA 1EOLA 3PMHB 4CRDA 4LMMA 1IOEA 5JB8S 1W2KH 2PGQB 1G30B 2ZFQH 3V3MA 1O3JA 1ZHPA 2FOMB 2EEKA 3KQDA 1W3CA 2Z3DA 1FIWA 3ZZ5A 1BTPA 2GP9B 4NGAH 1YPHC 3HGPA 2QY0B 2B9LA 5AVDA 3SV6A 4JZFH 2BMGB 1O34A 5F67A 4ISIH 1P8VC 4Y7AA 1N7EA 3PDZA 1H4WA 1NFUA 2XCFA 1GL1A 3UR6A 1CVWH 2AGEX 2JKHA 4U01A 1GI3A 2P3FH 3SGBE 4JYUH 1QL7A 1ARCA 1J14A 2C4FH 1O3FA 1YF4A 4H4FA 1W11U 3M61U 1DSUA 2KYLA 3LGTA 2FS9A 1BBRK 1RZXA 1O33A 1TRMA 3LGVA 3S7KB 2ZHQH 2XYAA 1GG6B 2JETB 1DFPA 3A89A 3RXTA 1T8MA 1QAVA 4X8UH 2A4OA 2KJPA 3OYPA 1GHZA 3TVJB 3AW0A 3RXIA 1YPHE 2HLCA 1O2NA 2M10A 2AWXA 3SZNA 1AO5A 3MU0A 1WSSH 2BD9A 2KPLA 3GYMA 4Q2KA 3K82A 4B75A 3KHVA 3DIWA 1OWJA 2CJIA 1N7TA 3RXEA 4K8BA 4U30A 4I7YH 5FHTA 1ZPBA 3PLPA 2OS6A 5FCKA 5ESBA 4AORA 1CSOE 3URDA 2BQWB 2A7CA 2H5DA 5C3NA 2YNBA 1EJAA 4KELA 1FAKH 4YZUA 2CSSA 2G52A 4CRAA 2DC2A 2F0AA 1BCUH 1BRBE 2XXLA 4MTBA 2O8UA 3LNYA 2EV8A 1P2QA 1DS2E 4AFUA 1UVSH 3MFJA 2VZ5A 1OWDA 1GBHA 2AWWA 2FI4E 1SFIA 7GCHG 4JYVH 1NRPH 1C2MA 2FOAA 2A4GA 3GYLB 1OP8A 3P8NA 1W0ZU 1TWXB 2ZHWH 3A80A 2BY6X 2STAE 3RXHA 2SGEE 4FUGA 2P94A 2Q1JA 5G4BA 5JYIA 1BTUA 2C8XB 4A1VA 4CRBA 2P95A 3UUZA 1C5XB 1W8BH 2GZ8A 1O2IA 3U1IB 1BJUA 3RXAA 2JH6D 1QQUA 5H3JA 2HVXA 2AWUA 4I33A 4DIIH 2ZHEH 3FP7E 1GMHF 4OS6A 2NU2E 2R9PA 1AD8H 1Z8RA 1X6DA 3T5FH 4WXVA 1YLCA 2K1ZA 2ZPMA 1IQFA 2AMQA 1C5QA 2C93B 2J34A 5HEYA 3P8OA 2I6SA 1JOUB 1Z6JH 2F9VA 2GGVB 1AVGH 2NWNA 5HYOA 3ZZBA 5EW1H 1K1MA 4AOQA 4FVBA 2FX6A 3QTOH 3AVZA 1IU0A 1ZPZA 1UJVA 2CN0H 1L2EA 2ZPSA 1GBIA 1OWIA 4AFSA 1H9IE 1O5FH 2I6QA 1DOJA 1O0DH 1OP2A 2A1DB 3AAUA 2ODPA 2D26C 2QN5T 1MZDA 1PQ5A 1TA2A 1VZQH 1D3QB 2RCEA 3UWIA 3ZV9A 2CMYA 1BQYA 1DVAH 3P92A 4IN1A 1CBWB 3TH4H 2A2QH 4Q2QA 1NY22 1CGHA 1Z87A 4KTSA 1VCWA 2DJTA 1E37B 2BD4A 1GMCG 3AW1A 5FPYA 3SJIA 1C5ZB 1G2LA 2BDBA 2OQ5A 4Y7BA 4BXSA 2GX4A 1F0SA 4YYXA 3I18A 1TIOA 1O2VA 4NXPA 1ZTLA 1TX8A 1KDQA 1XKBC 1UM7A 2KOJA 1TNLA 5FXLA 3TSWA 2EI8A 2SNVA 1GBCA 3STJA 2OMJA 4B2CA 2ZA5A 1MD8A 2H2CA 3BTQE 4KP0A 5A09A 1UHBB 1IU2A 1WTGH 1O30A 4BNRA 3GDUA 3SW2B 3TLOA 2BXUH 5I7ZA 4A92A 1GJ5H 4YOJA 4BAKB 1TAWA 3M3TA 2CV3A 1NESE 5DKMA 2WV4A 4ABFA 2E7KA 1WTHD 1SGCA 2R4HA 1BRAA 2AYWA 5SGAE 1N6FA 3A8DA 3ZZ8A 4OS5A 1CA0B 2I1NA 1SI5H 1BRUP 1UFXA 1GCDA 1INCA 1P05A 1EAWA 1W14U 4IMQA 3RXSA 4KFVA 1U3BA 2H3LA 2BY5X 1C5WB 4H42U 3Q76A 3LPRA 1BT7A 5JBBS 4B2AA 2OTVA 3E8LA 1NRRH 1PPFE 1KWAA 3RXJA 5DP3A 2AINA 1NU9A 2Y5HA 3WY8A 1GJ9B 1IQGA 1DITH 4Y8YA 1KTTB 4FXGH 5FX5A 2ZEBA 1F5LA 3ELAH 6GCHF 3K2UA 1E38B 1SGEE 4YM9A 2QBWA 1DE7H 1P01A 3F9FA 1W9EA 1H9LB 1SHHB 3KF2A 4YLQH 3UTUH 2J95A 1ZJDA 4IMZA 2R0KA 1V2ST 1K1PA 2P8OC 2XRCA 1CU1A 1FONA 4ESTE 1QL9A 2ZP0H 2Z9GA 3MTYA 2DE8A 3G01A 2LC7A 1A61H 1ELEE 2W7UA 1HYLA 4BTTB 1EXFA 3QO6A 2FOHA 1O5BB 1THRH 1UCYE 3NUMA 4TPYA 1J17T 1KXCA 2BZAA 3MO6A 4OEPA 5C1UA 1X7AC 5JBAS 1O3BA 1HIAA 1NTPA 1SGRE 1Y7NA 1OXGA 2HPQH 4ABBA 5FBEA 5A0AE 1TGNA 3MH6A 1QA7A 2ZECA 3QN7A 3ZYDA 1ZOKA 4K3JA 4DVAU 1KTSB 2H9TH 3H7TA 1VCQA 4Q7YA 1GQ5A 2PKUA 3QWCH 2TBSA 4E35A 1GM1A 1Z6EA 4HTCH 1SMFE 2TGAA 4OS2A 3RMMH 1A7SA 1O3MA 1RGQA 3RU4T 5HEBA 7ESTE 2OC7A 1WBGB 2V3HH 4WF8A 2OQSA 2M0TA 1F0UA 1X5NA 2G81E 4ZAEA 1QBVH 2BDIA 4ABAA 3HKIB 4GPGA 1ANCA 2UWLA 3GCHC 4HZHA 1IQKA 2KQFA 2IN2A 4WMDA 1AE8H 4BAMB 3BTTE 1HAXB 1QAUA 2HOBA 3VGCB 2AFQB 4XE4A 2Z6BD 5GXPA 2BLOA 3LH3A 1FZZA 5GWZA 3P8GA 1V2WT 3SV9A 2IOTA 4NIYA 1B7XB 2W26A 4NNMA 1P2OA 2PKAB 1CHOF 1OP0A 4AGKA 1VA8A 1GI7B 5C1XA 2O2TA 4KKDA 3MO9A 4WH6A 2ZTXA 1C5TA 3SNEA 4WJG2 2VWOA 4JOGA 1C1OA 1S6FA 3ZYEA 2DLSA 2M0VA 1EZXC 4IS5A 4CREA 1AN1E 3N7OA 3DJ3A 2RRMA 2FM2A 2TPIZ 1ELBA 3DFLA 5FPSA 3QJMA 3GY2A 3GY7A 2GT8A 4ZMAH 1ESTA 1O2RA 2ZPLA 5A0CA 1O2WA 2KAIB 2C8YB 5LGOA 2JREA 1UHPA 2HGTH 4O97A 2VGCB 1DUAA 4O03A 4Y76A 1QR3E 4ISHH 3URCA 1AE5A 2BVSH 2A4QA 5E0GA 1D3DB 3RXFA 3E17A 1AFEH 3ZVEA 2EEJA 4P2AB 1AUJA 1PPCE 1TNHA 3SI4H 2FI3E 3RXUA 2KOHA 3CBZA 1ZMJA 2BOHB 1FY1A 1T4UH 2ILNA 1DY8A 4ZH8A 2WYGA 1UTKA 1D9IA 1GBKA 1GBLA 4UFFH 5ESTE 1ETSH 2GZ7A 1HLTH 1Y3XA 4X1PU 3TJUA 5LH8A 1XUGA 1XVOA 1DXPA 2SFAA 2JXOA 1U37A 1FLEE 3HPKA 2Z94A 2PTCE 5DK1A 2VRFA 4JOHA 3GY5A 3RMOH 1GCTB 1ELCA 1J15A 4B76A 2D1JA 1S82A 3UREA 1S84A 4Q3HA 3A86A 3M3VA 2OLGA 1EAIA 5EODA 4Z0KA 1C1WH 2IWOA 1K9OE 1EUFA 1G37A 1NS3A 2QC2A 2YNAA 1WI4A 4YO9A 2XCNA 1RFNA 3UWJH 2LNCA 3E0NB 1K21H 1GWAA 1LPKB 2EAQA 1LHDH 2QV1A 3FP8E 3D62A 2P59A 3K50A 5DP9A 4GLYA 1C2HA 1X45A 2ZKSA 2PKSB 1SQOA 1FDPA 3P17H 5HGGA 1TMBH 3ATLA 3LC3A 1ZMLA 4YOIA 1SL3A 1EJNA 2QG1A 1JWTA 3RXQA 6CHAB 1IQMA 3OTPA 3PO1B 5EW2H 1GBBA
chains in the Genus database with same CATH superfamily
5JBCS 3H7OA 3BTME 1F5KU 1C5YB 1AVXA 4YT6H 1GG6C 2JETC 2QXHA 3M36A 3T2NA 1BTZA 2QXGA 2F9BH 5LPEA 1BBRE 1N6XA 2I04A 3ZZ7A 2XBXA 4Q80A 3SUGA 5T3HA 1GBEA 1ZRKA 1TX7A 1ZUBA 5E11A 1CE5A 2IJD1 3ITIA 4GCHG 1PQ7A 2ZTZA 1FIZA 3SHAH 3GCOA 2STBE 3VQGA 2FODA 3GISB 2Q6GA 2J94A 1BOQA 5C0TA 4GSOA 2DKRA 4NMTA 5HFCA 2AGGX 3O8DA 1GDQA 1IQEA 1SGFA 2WUCA 3GJ9A 3O5NA 4X6MA 1C1MA 1AZZA 3NFKA 1HXEH 3VEQB 5AHGH 1EB2A 4OEOA 2AERH 4NMOA 1PPEE 2VIWA 1G2MA 2KBSA 2FPZA 2JIKA 3K65B 3S0NA 2ZFTA 4INHA 4JORA 1MC7A 3LC5A 2BM2A 2FX4A 1MKXK 1P11E 2EGOA 3MH5A 2KPKA 1O5CB 1KSNA 1TNKA 5GLJA 1FX0B 2V6NA 5C0UA 1SOZA 1HUTH 3UFAA 2HLDD 4BXWA 1TX6A 2EXGA 1VITG 5IYTA 3O8BA 1YCPM 1UVPA 1BMAA 2F5YA 2M0UA 1SSXA 1C2FA 2UWPA 1C1NA 1CO7E 4A1XA 3IITA 5D13A 3T26A 3RM0H 3VB4A 2H2ZA 1C1TA 1C5RA 3TJOA 3PV4A 2YUBA 5CMXH 5FPTA 1KLJH 3A81A 3A8CA 4KFWA 1ZR0A 2FYRA 2ZGJA 3EE0B 2WL7A 3F9EA 5DTHA 3WW7A 2FDAA 1EPTA 1D3PB 2ZTYA 1BE9A 4EDJA 5HJ1A 1PPGE 3EGHC 1MTNB 4JZIA 4D76A 4D8NA 3UNRA 1SQTA 2ZCLP 1V3XA 3VXEH 6LPRA 2ODQA 1FC6A 4DG4A 3RP2A 2OZFA 2VWRA 1GHYH 1NM6A 2QYIA 4X6PA 1UF1A 5EPYA 2PWXA 2A7HA 2FEQH 2VWLA 1M9UA 3BPUA 4NFEA 2EJYA 3TSZA 1XUFA 3NGHA 2UUFB 3R0FA 1M5ZA 2ZG0H 4K75A 2YT8A 3QTVH 4DCDA 2GCHF 4K1EA 3V0XA 3N7DA 2ZQ2A 4NIVA 1WQSA 4BAOB 1K1NA 1UCYH 3OSYA 4A5TS 4HOPA 5F8ZA 1TRNA 2EGNA 3SU1A 2V35A 2XWAA 5F8XA 2P93A 1A46H 1SGPE 3MNXA 4LK4A 2A5AA 4AGJA 9LPRA 1VB7A 4HGCA 2HNTC 4O06A 2LA8A 1QB1A 4AFQA 1BB0B 5CHAB 3LGIA 1N8OB 1MCVA 2BYGA 5DGJA 1UEQA 2OINA 3QDZB 1BHXF 2H5CA 1RD3B 1U39A 1THPB 1CBWC 2G4TA 2DM8A 3BG4B 3CENA 4NMVA 1B8QA 3RXOA 2JDID 1Y3UA 3KEEA 4FUDA 2D2DA 2QE7D 7GCHF 4RKOB 2BDYA 1FJSA 8ESTE 1AQ7A 3S7HB 4TPIZ 1QURH 3SHUA 4FLNA 1C5MD 5A8YA 1S81A 1YCPK 4IGDA 3JZ1B 2PW8H 1P3CA 2XC4A 1O2QA 3F1SB 3SJ9A 1FY5A 3BEFB 4NSVA 3A83A 2OUAA 3DJAA 4I86A 1TQ3A 2ZGHA 2ZO3H 2ZCKP 2Y80A 3PB1E 5DO4H 1EAUA 2RCZA 4Q2NA 1NRNH 1TPAE 4D9QA 2VH0A 3ID2A 1Z71A 1ACBE 5TJXA 3F2FA 4SGBE 1Q2WA 1MBMA 1UVUH 4NWLA 2Q3GA 2OD3B 1V6DA 1Z86A 1WF7A 4WYUA 1QY6A 5L30H 1CA0C 1L4DA 1GI2A 1O2GH 3A7TA 4CH8B 1N6EA 4UE7H 2EQNA 4B73A 5T1VA 2BXTH 2FOCA 3NK8A 4RN6A 1J16A 1XUHA 3NRLA 3EA7A 1V2QT 4AFZA 1MKWH 1ZMNA 4REYA 3RMNH 1AKSA 1WJLA 1C5PA 1K22H 1E0FD 1MUEB 2R0LA 1O39A 3BTGE 5A8ZA 2A5IA 1VGCB 1DY9A 2OBQA 1C1PA 2Q6FA 1KIGH 2UUKB 2FS8A 2FTLE 3GGEA 2EA3A 1UM1A 1O2TA 2W7SA 1O36A 2GKVE 3T27A 4BANB 1X5RA 5DP4A 4JOFA 3KZDA 3TMHA 1X5QA 1K1JA 1C2LA 1V2RT 3OE7D 4O3UA 2BY7X 2FLRH 5EGMA 1GMCF 2XNIA 3UQOA 1PPZA 1SLXB 1JIRA 1GJ6A 1MU6B 2FO9A 5DP7A 5EPNA 3ZV8A 3U1JB 1SVPA 3RXRA 1ANDA 2OSGA 3BF6H 4B6EA 2Y6TA 2F91A 1PDRA 2TGDA 1GMDG 2J4IA 1HPGA 3CNRA 2ZFPH 3DJ1A 1W10U 1QJ1B 5KGOA 4D9RA 2ZDLA 4FUBA 3F0OA 2XBYA 1HAIH 1TGTA 5EYZA 1OYQA 2WINI 3E1XB 3RXLA 1MAYA 4Y8XA 3SUDA 4G69A 1KDQB 5HFBA 1P2MA 1DX5M 2WPHS 3SUEA 2J9NA 1GGDB 3LGUA 1S6HA 3MU1A 4NZQA 3OX7U 2SGFE 1V1TA 4JL7A 1LDTT 1O37A 4AG2A 1H8ED 2A5KA 4ZKRU 2KJDA 2W6ID 3ATWA 5F3XA 2RFKC 1SG8B 1T4VH 2OPGA 1C5NH 5KECA 2PSXA 4X0WU 1O2SA 2G5VA 2BY8X 1YPKH 1CT2E 1O3EA 1Y59T 1P9SA 3BTDE 4YT7H 2Y82A 3TNTA 2XBVA 1HAVA 3B76A 1TABE 2SGAA 2GCTB 4ABDA 3SJOA 1BBRH 3GY6A 1L4ZA 4UONA 4NIXA 1FCFA 1LPZB 1XXFA 1XUJA 3NWUA 1MQ5A 4PROA 1O3AA 4NXRA 1ORFA 1F5RA 5L6NH 1N6YA 2OXSA 3MU8A 1ZSLA 3A7WA 4NXQA 5G1EA 1GHWH 1V2LT 4K8YA 1FC7A 1HAGE 4BOHA 3ZZ3A 3VGCC 2WZQA 1PQAA 1GI6A 1O3IA 1V5QA 2VBCA 3O8RA 1UMAH 2XWBI 3FP6E 3U69H 3PWBA 5HFEA 1MH0A 1VKYA 1S5SA 3DHKH 3E0PB 3F2HA 2GV7A 1UK4A 3SV8A 1A5HA 3RM2H 3MMGA 4KGAA 3R68A 2ESTE 3S69A 1Z8GA 1Y3VA 1P57B 4A6LA 2P16A 1F7ZA 3VB5A 1SOTA 1JBUH 3SN8A 1GHXH 5EJLA 2BDAA 5JXBA 1SQRA 1THSH 2QCYA 4OAJA 5C5OA 3ODFA 3GDVA 3V12A 1BITA 1HJ9A 3H09A 4I32A 2P3TB 5ETXA 3K1RA 2KAWA 1UTOA 5ABWA 2PR3A 5DP8A 1ANBA 1QFKH 4THNH 1AIXH 3I29A 2QKVA 3ATIA 4I8KA 5EG4A 4FUEA 5GCHG 2QA9E 5A0BA 1LQEA 1VJ9U 2VGCC 4GAWA 4XBCA 1FN6A 5C17A 3DD2H 1SGNE 4XDEA 4NWKA 1K32A 1HBTH 1HIAB 1C9PA 2ALVA 3O46A 3ENSB 2H1UA 2EC9H 1EASA 1HFDA 1GL0E 5F03A 2YMSC 3UNSA 3RXKA 2REYA 1ARBA 2MHOA 2A0QB 1IQNA 3MHWU 4NZLA 1FUJA 2BDCA 3RMLH 2HRVA 2BD5A 5J4SA 1EAXA 1F92A 1WG6A 4Q2PA 3GSLA 1VJAU 3FANA 4ZKNU 3I77A 4MG3A 4DURA 5HF1A 1QLCA 5C94A 2DMZA 1QJ6B 3SGAE 2VJ1A 2ALPA 4Z6AH 5FL7D 1GCTC 2J97A 1QTFA 2OC1A 2F9PA 4GHTA 2L4TA 4UU6A 4GUXA 2O8TA 1GI5A 3GCNA 2NU1E 4JZEH 1I16A 2A2XH 2JILA 2ZDMA 4LXBH 1EOJA 2RDEA 5F8TA 1GMHG 4ACBA 2PDZA 1C2KA 4XHVA 1TOCB 3B8JA 3FZZA 1GBMA 2LOBA 5DP5A 3DA9B 3U8RH 3ID4A 3RLYH 2GT7A 1ELVA 3U8TH 3ZVFA 1G9IE 4O9VA 3GCTF 3F9GA 4Q6SA 2OGPA 1GI1A 2SGQE 2PKSC 1MMJN 1JXPA 5EJZA 1WQVH 3TNSA 2W5EA 4A1TA 4AG1A 3HK6B 6CHAC 1EFRD 1NT1A 3KQEA 3PO1C 4Y71A 2ZU5A 1DWDH 1P10A 4F49A 2W4FA 4RKJB 1YPGH 4UEHH 2GV6A 2CHAB 1H1BA 2GD4B 4X1NU 1MTUA 1W12U 1ZTKA 3BSQA 3PWCA 1BJVA 2KCYA 3KN2A 2BD3A 3GABA 1ETTH 4E7RG 1XUKA 4DT7B 1VAEA 4WVPE 1Z8JB 5T6FA 5LPFA 4INLA 2A45B 4X6NA 1BMMH 3MNSA 5HMAA 5H4IB 1FAXA 3RXVA 1QRZA 4CHAB 2PA1A 1E36B 2ZNKH 3C27B 1V2TT 4FU7A 1RGWA 1O2PA 1HJAB 2VINA 2KRGA 3A7ZA 5B6LA 3S9BA 3SOSA 2Y81A 2ZI2H 3KDGA 2DAZA 1EZQA 1TOMH 2CGAA 4X1RU 1G3EA 5I46H 4IBLH 1HV7A 4Q7XA 1WFGA 2G2LA 4ZHLU 1HCGA 3S9CA 2J92A 1UTJA 1DXWA 2Q9VA 4K72A 2YMSD 2OBOA 4WYTA 2OK5A 1QA0A 1XZ9A 3PS4A 1RTLA 2VIPA 4NMSA 5AFYH 1AHTH 1TRYA 2BDGA 3FAOA 4CRCA 3VQFA 1AU8A 1WFVA 1UHBA 4NA8A 4XOJA 1HAHH 3DFJA 2XW9A 2IPQX 3TSVA 1F0RA 3BV9B 4AB9A 3CBXA 2DUCA 1WU1A 4E7NA 3SOEA 4JOJA 3L6PA 1Z8IB 4ABEA 1GBAA 4M9FA 1G32B 1JRSA 1CA8B 4JK6A 2LPRA 2UZCA 3VB7A 4FUFA 2FXRA 2NU4E 2VVVA 3P8FA 1EZSC 1ZZZA 2V0BA 3SO3A 1KYNA 1E79D 1C1RA 2I0IA 2ZWLH 2O9QA 1AI8H 2H9EH 4Y8ZA 1F2SE 2C8WB 3KGPA 1ELAA 2WV9A 2Z9KA 1O2JA 5GPIB 4N6XA 1UJ1A 4K6YA 1MTNC 1ZJKA 5F53A 4CBNA 5T6GA 2F4LA 2BQ7B 1GHBG 5DJ7A 3SFJA 1LTOA 3ESTA 4KTCA 2ZDKA 1HB0B 2I6VA 1AY6H 4MPAA 1ZRBA 1OX1A 1LHFH 1Y3YA 1QNJA 3P6ZB 4AB8A 4ISLA 1TA6A 2ODYB 1SLWB 1WH1A 1SBWA 2ZC9H 1P1DA 3W95A 2DB5A 2H2BA 1UW7A 1WF8A 4JJ3A 2JH5D 1VCPA 2QAAA 1S0RA 1L1JA 1U6QA 1V2NT 4GCHF 4ZROA 2F3CE 5A2PA 4K76A 3PV2A 5FBIA 4AZ2B 1CT4E 3EA9A 4WY3A 1G36A 1LVOA 1YLDA 3PLBA 3A7VA 1B5GH 1DM4B 8GCHF 1KEFA 1Y5UT 3TGKE 1U38A 1W9OA 5HETA 4AYYB 3Q3KA 1B0FA 1P09A 2WPKS 1ABIH 1DPOA 5CHAC 1KMHB 5AFZH 1N8OC 1TYNA 4HFPB 1OBYA 2K20A 3LT3A 5FCRA 2AH4X 3M5OA 2D8IA 1O2OA 1O3NA 2MX6A 1C1QA 5K7RA 1GVLA 2ANKH 2ZU2A 3BG4C 3LJJA 2EHRA 3I78A 1GVZA 2TRMA 2F9OA 2IWQA 4X8TH 1TBZH 1O2ZA 2I0LA 3OY6U 3M35A 1XXDA 1DLKB 7KMEH 1RJXB 2R2WU 4WXIA 4JZDH 2R3UA 3PM3A 4VGCB 9ESTA 1P3EA 1MQ6A 1V5LA 2BD2A 4Z8JA 4MVNA 1UITA 2ANWA 2J98A 1O2MA 1W9QA 2UUJB 3JXTA 4M7GA 4MNWA 1OPHB 2OCVB 2QIQA 3SNCA 1ELFA 1ZYOA 4ISNA 3MO3A 4OS4A 4Y0ZE 4Y10E 5E0JA 4K1SA 2IWPA 4X8SH 2ZIQH 1A0LA 3MOCA 1C4V2 1A0HB 3SU2A 1EPTB 1AFQB 2BOKA 5ILBA 4F48B 1LCYA 3OEHD 2YUYA 1BTYA 1C2GA 3TJVA 2CSJA 4MNYA 2VWNA 3VFEA 3EQ0H 5L2ZH 1DANH 1SHYA 5E2PA 4D7GA 1C4Y2 2HPPH 2XC5A 4BAHB 3L3TA 4U32A 2AEIH 2ZHDA 5C1YA 4B74A 1YGCH 1V2MT 3PMAB 4OGYA 3Q77A 2KG2A 1ZLRA 3D23A 4XBDA 3KNXA 1D6RA 2D90A 1GHVH 2RDLA 1GJ7B 3DT0H 4NMPA 4H6TA 1GQ4A 1SGIB 3O8CA 1JMOH 5GDSH 3HVQC 2OCSA 1ABJH 5EW2H 3NFLA 4FGMA 5EXMA 4Z1MD 5FAHA 1VGCC 1P02A 3LGWA 3MYWA 1QZ8A 1VR1H 4TWYA 1C5LH 2ZQ1A 4NA9H 3L33A 3BTHE 1CGJE 4CR9A 1UCYK 2EGKA 1DWCH 3K6YA 1QB6A 1QGFA 3WWFA 3SBKA 2Y7ZA 2FZZA 3OY5U 1WIFA 2RG3A 1ETRH 2QKUA 5EQSA 2Z9LA 1BTXA 4UU5A 2GEFA 1OKXA 1FV9A 4RSPA 4RT1A 3STIA 3PRDA 1FNIA 3UOPA 1UEWA 1P2NA 4K5ZA 4IN2A 1QL8A 4CRGA 6ESTA 1NTEA 1QHRB 2CK3D 4K60A 3MU5A 2YTWA 2A31A 2VIQA 1EJMA 3F3BA 4X1SU 1PYTC 2XOKD 2AS9A 5K0HA 2ZU1A 4FETA 5LPRA 1BMNH 1LKAA 1UTLM 3SJKA 7LPRA 2BLWA 2DE9A 3ATMA 3CP7A 4IC5A 3TJNA 4ZKOU 1C2JA 1GGDC 1W0YH 1OBXA 1K1LA 2Z7FE 3M5LA 4K2YA 1W13U 2BYAX 4K69A 4X2WA 1GJCB 3UIRA 3M5NA 2G51A 3QZRA 2FIRH 2FNEA 1HGTH 4NNLA 2GMTB 3PMBB 2IJOB 2KL1A 3LH1A 4K1TA 1MTWA 4GVUA 4YTAA 4BTIB 4LZ4B 5FB8C 1BRCE 2FESH 1RIWB 4I31A 4Y79A 1I92A 1WUNH 1C1UH 2AMDA 4Y6DA 3VPKA 4ABGA 1NFWA 1AMHA 5FX6A 1X8SA 1EP5A 1ZGIA 2KCPA 3LNXA 3MI4A 3NPSA 2BB4A 3LONA 1L6OA 4TSFD 1WXRA 1WOFA 1HNEE 4NMQA 1O3OA 2PNTA 2WPMS 1QAVB 2FOBA 2FI5E 4I8GA 1VITH 4XBBA 3UNQA 4J2YB 1SGDE 3LGYA 1MTVA 3W94A 1PJPA 3BTKE 4ZUHA 2B8OH 2ZGXH 1W7GH 2K1QA 4Q7ZA 4I8JA 1O35A 2P3WA 1ZSKA 2C90B 3AASA 4D7FA 2EI6A 3MH7A 2B5TB 1J8AA 3CS7A 1MZAA 1SGYE 2KCAA 3PTNA 2BX3A 4DGJA 1Y5AT 3TGJE 3DUXH 1IQHA 2QKTA 3MU4A 3QGNB 3RC5A 4FUIA 3A7XA 2ULLA 1MKXH 1GHAG 2VIDA 3R0HA 1TBRH 2M0ZA 4ABHA 1ELGA 4Y0YE 1EX3A 4YOGA 1OYTH 2H3MA 5C67A 1TGBA 3QK1A 2ZDNA 1K0HA 2SGPE 3HATH 3E16B 1PYTD 1DDJA 1C5UA 1TMTH 1HXFH 1TNIA 1KY9A 2LUIA 5E8EH 3FVFB 1J9CH 3DSPA 4ASUD 3RXBA 1A3EH 2VIVA 5PTPA 3RLWH 3SNAA 1Q3OA 1FQ3A 2HNTE 3M37A 4AX9H 1EB1H 4NA7A 3PYHA 1MD7A 1FPCH 1OZIA 1BHXB 5HXFA 1G3DA 2ZZUH 2FOFA 5CE1A 1AUTC 2F9UA 3RU4E 3PLKA 1OWEA 4FUCA 3ZVCA 4Z33A 3BTFE 1TGSZ 2OC8A 3GY8A 3M7QA 1FY8E 1KXEA 2XC0A 1BUIA 3ATKA 1HAVB 1RS0A 4ZHAA 1JIMA 1A3BH 1UTMA 1C4U2 3LJOA 1EQ9A 1K1IA 5HM9A 1A2CH 2Z9JA 1GI8B 1T8OA 1Z1IA 2D8WA 1A1RA 1CGIE 1D6WA 2HE2A 3D65E 2BY9X 1AB9B 2FOGA 4WWYA 3T25A 3A82A 4BTUB 1JRTA 3I4WA 1LPGB 1GBJA 3D49H 4H11A 1PQ8A 1GVKB 5JDUB 2B0FA 1ELTA 1P2IA 3FKSD 1UTNA 4ZKSU 2GZ9A 1O2YA 4L8NA 2GVFA 3QGLA 2ANMH 4I8HA 4MPVA 2M3MA 1BZXE 2WPLS 1OOKB 2FTMA 2H9HA 2ASUB 1VJ6A 2KOMA 2J38A 8KME2 2G5MB 4GVDA 2WHXA 3Q3YA 2O8LA 4ZXYH 3T62A 1DICA 1RTKA 2ZDVH 2GCHG 1OWKA 3KL6A 1L0ZA 1Q3XA 5HF4A 3QJNA 3F0PA 3U8OH 1V2UT 1V2VT 3K6ZA 3SUFA 3RU4D 5E21A 1TPSA 2F9NA 4P0CA 4ASHA 1C2EA 2CHAC 1LMWB 3UQVA 1N1LA 5EQRA 1O3CA 2Z3EA 3HPMA 1NO9H 1XUIA 3Q3XA 4INKA 1PPBH 1O3KA 4YXWD 3CH8A 3HGNA 3RXGA 5HKKD 2EEGA 1NF3C 3RXCA 4F8KA 2JINA 5GCHF 2VWMA 2ZFSA 4O3TA 4R8TB 5EOKA 3TGIE 4X2YA 4CHAC 1SFQB 1WV7H 1NC6A 1O3DA 5C5NA 2OQUA 1YCPH 2PFEA 2ZGBH 1HJAC 5EXLA 2IWNA 1TQ0B 2GDEH 1YC0A 1N6DA 5EQQA 1KLTA 5JPMH 2ZF0H 4K78A 1ESAA 2M2AA 1S83A 4UDWH 5E2OA 1V6BA 3BIUH 3HPTB 3OEED 1OS8A 3B9FH 1XVMA 1BA8B 3BN9A 2BD8A 3RXMA 3I1EA 4CR5A 3KYGA 2ZFRH 3A8AA 2HE4A 2VNTA 1MCTA 4B6FA 1O5DH 1YKTA 1N99A 3KZEA 3MQKC 3MNBA 1YLNA 2Z3CA 3SJ8A 5B6OA 1D4PB 4MNVA 1IQIA 4JCNA 8LPRA 2HWLB 4YDPA 2Q6DA 1GI9B 2DLUA 2TIOA 1NZQH 1GJBB 1C5SA 2YT7A 1BFEA 2FN5A 1HAYB 3FO8D 3RC6A 3T29A 2KA9A 1AGJA 2HNTF 1W0KD 1DT2A 3TU7H 2TGTA 1HAPH 2CF8H 4HI3A 3IG6B 3M7UA 3RDZA 3GICB 1C1SA 2AGIX 4TY6A 3PV5A 1IHJA 5J4QA 3GY3A 3N99A 2ZHFH 5A2MH 2G8TA 1G3BA 3QZQA 3SU3A 1Y3WA 1RY4A 1QIXB 3KQBA 1AZ8A 1PPHE 1FC9A 2RA3A 4SGAE 3CS0A 1O5EH 3E6PH 1C5OH 4B1TA 4UD9H 1E34B 2R3YA 2UWOA 1TGCA 1SGQE 1T31A 1ZTJA 4YESB 1GPZA 1O2LA 4E34A 4NG9H 3SI3H 1GBTA 2QT5A 1P0SH 2PTNA 1ZHMA 3SGQE 5HFFA 3U9AH 2WPIS 2HGAA 1E35B 2KX4A 4X6OA 2EY4C 1NFXA 1GI4A 3CBYA 2ZPRA 2GTBA 3LDXH 2EEHA 3ZZ9A 1NRSH 1BMLA 3ODDA 3BEUA 2L97A 3SU4A 3FY5A 4JK5A 4AN7A 1WYKA 2H6MA 5F6MA 1Q3PA 2D92A 2EDVA 4BAQB 1O38A 1UK3A 1LQDB 3M3SA 4GHQA 4NCYA 1DWBH 1C5VA 3NCVA 1R6JA 3RL7A 4E05H 1KXDA 3EE7A 4UFEH 4FVDA 4XSKU 1ZOMA 2V3OH 4KTUA 5TCCA 1NN6A 2ZCHP 1SLVB 1YBWA 2BQ6B 3U98H 4ABIA 3FZDA 4QT8C 1V2PT 4JOKA 1FI8A 1GI0A 2AHME 1O3LA 4MNXA 2FWWA 3BTWE 1ESBA 1EZUC 4B71A 1LVMA 4MPXA 1TNJA 5EJ1A 4DT4A 3TH3H 3GOVB 2QF3A 3ZZ4A 5EXNA 5BPEA 5C20A 5HDYA 4VGCC 1GBDA 1O5AB 1A5GH 1K2I1 4ZXXH 3RXDA 2EI7A 3SU5A 1CQQA 1K1OA 2WYJA 1O2XA 1XKAC 2A7JA 2PV9B 1O2UA 1H8HD 4PQWA 5C2ZA 2VSPA 1V2KT 1UK2A 1LHEH 4Y11E 2THFB 3N7EA 3ID3A 4NFFA 1DLEA 2FOEA 2CF9H 2F83A 2NU0E 2BLVA 5L2YH 1TB6H 1BTWA 2O8MA 4TY7A 1EPTC 1AFQC 1GHBF 4R2ZA 2V7QD 1WCZA 1O31A 2ZPQA 1YPMH 4DJZB 3OFND 1F0TA 3KIDU 4A7IB 1RXPA 2VH6A 3A84A 1YPLH 3SHCH 1V2JT 3OU0A 1HJ8A 2G55A 3AXAA 5E22A 4U2WA 1OWHA 1WAYB 1HRTH 3TK6A 2JWEA 3WKLA 1H8DH 3UOUA 2VVUA 2FMJA 3TK9A 1PFXC 3HK3B 1YBOA 3NXPA 4WH8A 3SNBA 3LIWA 3HKJB 1YPEH 3RL8A 1G3CA 2ENOA 3BEIB 4X2XA 1GJ4H 3M7TA 4DIHH 1MU8B 4LZ1H 1LVYA 4LOYH 1C2IA 2L4SA 5E6PB 3SU0A 1ANEA 1GBFA 3RC4A 2TGPZ 2G00A 1WDIA 1LVBA 3FOAA 4X1QU 3EGKH 1MBQA 3U28C 2EEIA 1ZPCA 2BVXH 5BRRE 1LHCH 1YP9A 2KV8A 2FLBH 3GY4A 1QJ7B 3A85A 1UO6A 1XX9A 3K9XB 1TALA 1IQLA 1O32A 2A32A 1T8NA 1XMNB 3E3TA 1SR5C 1P06A 1S0QA 5DG6A 2AIPA 1C9TA 1QB9A 3DORA 3M5MA 4WMFA 4YLUA 4AYVB 3R3GB 1O2HA 1O3PB 4CH2B 2VSVA 1CT0E 3MNCA 4RT0A 4B2BA 3EA8A 4NSYA 1GDNA 3QDOA 2J98B 1UEZA 2PUQH 1P2JA 2AIQA 3RLEA 1T2MA 3ZIAD 4I8LA 2OC0A 1AVWA 3QE1A 4H6SB 3PDVA 2YOLA 2FYQA 3EAJA 5G1DA 2V90A 3SZEA 1UJUA 3ZRTA 2GMTC 5A8XA 3A7YA 3B23B 3CC0A 1RIWC 3VB3A 2PSYA 5EU8A 3QX5H 1TE0A 3A87A 1TP3A 1MFGA 1D5GA 2VB0A 3FFGA 5HM2A 1O3HA 3L4FD 5KEDA 1GJAB 3FN8A 1XM1A 4CBOA 1WHAA 3ZZ6A 3GCTG 4OGXA 2FE5A 1IQJA 2RA0A 3EGGC 1HAOH 6GCHG 1ELDE 4Q2OA 5JBTA 4R0IA 2BVRH 2OP9A 1AWHB 1GJ8B 3PROA 4MPWA 4MQAA 3V7TA 2ZU4A 3A8BA 2R2MB 1L1NA 3BTEE 3TPIZ 1OBZA 1EKBB 3ZZCA 2FP7B 2ZDAH 3RUOA 3IWMA 3CYYA 3TITA 4XFQA 1YM0A 1Y8TA 2PHBA 4NMRA 3C1KA 1TMUH 3JZ2B 1SGTA 3SQEE 4NIWA 1HDTH 1VITF 3S9AA 3F6UH 2BD7A 3UY9A 3BIVH 2KJKA 1TNGA 1P12E 1MFLA 3UB0A 1QRWA 5E1YA 1WI2A 1IHSH 2BZ6H 2C8ZB 4P00A 1TFXA 2K0QA 1FXYA 3UAIC 2HALA 1SPJA 2YMSB 4MPUA 2KCOA 3Q00A 2W7RA 2UUYA 3ZVGA 2XNDD 1O5GH 2C3SA 4F55A 2Y5FA 1BIOA 4WMEA 2W3KA 4TT3D 4GVCA 1B0EA 3EYDA 1DWEH 1UEPA 2O8WA 2I4SA 4IC6A 3QGJA 2W3IA 5HEDA 1W7XH 1TLDA 4MLFB 3SU6A 5DPAA 3UPEA 1Z1JA 4OS1A 2EDZA 1IAUA 1QQ4A 1S85A 2QF0A 1UTPA 1C2DA 4TWWA 4FU8A 2EDPA 1NU7B 3NCLA 3RXPA 3MH4A 1TPOA 1WHDA 3P95A 1P9UA 4FUHA 1A4WH 5IDKA 1FY3A 1BTHH 3ZVBA 3QIKA 2V1WA 1ZSJA 2PKAA 2XTTB 5EIYA 3V13A 1UVOA 1P2KA 2VIOA 1P03A 1QRXA 1FMGA 2GJGA 3NZIA 1AB9C 1OSSA 2PKTA 2IPHA 2XBWA 3ZZDA 2X7ZA 2LC6A 2QXIA 4JOPA 5TCAA 1CHOG 1UJDA 1V62A 1SGFG 2QGRA 3F2GA 3ID1A 4J1YA 2VPHA 3OTJE 4Q4LA 1KXBA 4HOPB 3SV7A 1BDAA 2Z9IA 3T28A 4ZHMU 4CRFA 2G4UA 2VVCA 1TONA 4F4OC 1A5IA 3E90B 5JB9S 3SHWA 2P8OB 3H5CB 3VXFH 5AF9H 4Q6HA 1EATA 2Y7XA 2CS5A 1FY4A 1IHTH 2P3UB 3LKWA 3TIUA 2KAIA 3DCLA 3MWIU 1RGRA 3VB6A 1UTQA 5HFDA 1ZHRA 1DSTA 2PLXA 4JYTA 5GJ4B 1GHAF 1ZGVA 1K28D 1TP5A 4DY7B 1Y5BT 1SQAA 1LO6A 1FN8A 3UR9A 8GCHG 1AWFH 1D3TB 2BLQA 3BG8A 3QLPH 1Q31A 5I25A 1NFYA 1QBNA 3SNDA 2J2UA 1YPJH 2J5UA 2JOAA 2BHGA 1YYY1 1UVTH 2SNWA 3PTBA 2GDDA 4ABJA 1V2OT 4ACAA 2ZGCA 4AMHA 1H9HE 2Y5GA 1Z7KA 3ZZAA 4X8VH 4UFGH 1QBOA 3E91A 3F68H 1LKBA 2M5TA 1KLIH 4RI0A 2FCFA 2A4RA 1QCPA 1TQ7B 3PRBA 4JOEA 1EP6A 1GDUA 2WUBA 2AMPA 1YY3A 1HAZB 2CXVA 3GCHB 1CHGA 1T7CA 3KYFA 3NKKA 1P1EA 2BX4A 1O3GA 2GCTC 3EDXB 2JH0D 1NRQH 3TK5A 3SQHE 1GJDB 3ZVDA 1RTFB 3R69A 2VU8E 4DW2U 4XD7D 2ANYA 4IW4E 1T32A 1TBQH 2BDHA 3P70B 1L1GA 1SLUB 5GIBA 2ZFFH 3KQCA 4JMYA 3F9HA 4ISOA 2PUXB 3A88A 4X2VA 1T8LA 2Z17A 1H8IH 5GNDA 3LOXA 5DP6A 1AKSB 1SB1H 1MAXA 4E06H 1DUEA 4E3BA 3ZVAA 1KXFA 1NROH 1TPPA 3TH2H 3PMJA 1LHGH 4TYDA 4OS7A 1ID5H 1MKWK 2WPJS 2B7DH 4GHNA 1N7FA 1C1VH 3LU9B 3SUZA 2PZDA 2G5NA 3KHFA 3WKMA 1O2KA 5EZ0A 2ZU3A 2WV5A 1NPMA 4FUJA 1FPHH 2SGDE 1MTSA 3SV2H 4MDSA 3AAVA 3SORA 2QXJA 4FU9A 1P04A 1SC8U 1GMDF 2GZVA 1KXAA 2PGBB 2BTCE 4DOQA 5E0HA 5T6DA 4JZ1A 4UFDH 5IK2D 3GDSA 1RRKA 1BMFD 1G9OA 3KCGH 2NU3E 1A0JA 3QUMP 1Q7XA 1EOLA 3PMHB 4CRDA 4LMMA 1SKYE 1IOEA 5JB8S 1W2KH 2PGQB 1G30B 2ZFQH 3V3MA 1O3JA 1ZHPA 2FOMB 2EEKA 3KQDA 1W3CA 2Z3DA 1FIWA 3ZZ5A 1BTPA 2GP9B 4NGAH 1YPHC 3HGPA 2QY0B 2B9LA 2KR7A 5AVDA 3SV6A 4JZFH 2BMGB 1O34A 5F67A 4ISIH 1P8VC 4Y7AA 1N7EA 3PDZA 4ZCNA 1W0JD 1H4WA 1NFUA 2XCFA 1GL1A 3UR6A 1CVWH 2AGEX 2JKHA 4U01A 1GI3A 2P3FH 3SGBE 4JYUH 2K8IA 1QL7A 1ARCA 1J14A 1S6LA 2C4FH 1O3FA 1YF4A 4H4FA 1W11U 3M61U 1DSUA 2KYLA 3LGTA 2FS9A 1BBRK 1RZXA 1O33A 1TRMA 3LGVA 3S7KB 2ZHQH 2XYAA 1GG6B 2JETB 1DFPA 3A89A 3RXTA 1T8MA 1QAVA 4X8UH 2A4OA 2KJPA 3OYPA 1GHZA 3TVJB 3AW0A 3RXIA 1YPHE 2HLCA 1O2NA 2M10A 3GS9A 2AWXA 3SZNA 4P02A 1AO5A 3MU0A 1WSSH 2BD9A 2KPLA 3GYMA 4Q2KA 3K82A 4B75A 3KHVA 3DIWA 2KZ4A 1OWJA 2CJIA 1N7TA 3RXEA 4K8BA 4U30A 4I7YH 5FHTA 1ZPBA 3PLPA 2OS6A 5FCKA 5ESBA 4AORA 1CSOE 3URDA 2BQWB 2A7CA 2H5DA 5C3NA 2YNBA 1EJAA 4KELA 1FAKH 4YZUA 2CSSA 2G52A 4CRAA 1COWD 2DC2A 2F0AA 1BCUH 1BRBE 2XXLA 3KQ5A 4MTBA 2O8UA 3LNYA 2EV8A 1P2QA 1DS2E 4AFUA 1UVSH 3MFJA 2VZ5A 1OWDA 1GBHA 2AWWA 2FI4E 1SFIA 2WPDD 7GCHG 4JYVH 1NRPH 1C2MA 2FOAA 2A4GA 3GYLB 1OP8A 3P8NA 1W0ZU 1TWXB 2ZHWH 3A80A 2BY6X 2STAE 3RXHA 2SGEE 4FUGA 2WSSD 2P94A 2Q1JA 5G4BA 5JYIA 1BTUA 2C8XB 4A1VA 4CRBA 2P95A 4Q63A 3DSGA 3UUZA 1C5XB 1W8BH 2GZ8A 1O2IA 3U1IB 1BJUA 3RXAA 2JH6D 1QQUA 2KM0A 5H3JA 2HVXA 2AWUA 4I33A 4DIIH 2ZHEH 3FP7E 1GMHF 4OS6A 2NU2E 2R9PA 1AD8H 1Z8RA 1X6DA 5HIZA 4WXVA 3T5FH 1YLCA 2K1ZA 2ZPMA 1IQFA 2AMQA 1C5QA 2C93B 2J34A 5HEYA 3P8OA 2I6SA 1JOUB 1Z6JH 2F9VA 2GGVB 3WWBA 1AVGH 2NWNA 5HYOA 3ZZBA 5EW1H 1K1MA 4AOQA 2JSNA 4FVBA 2FX6A 3QTOH 1NBME 3AVZA 2HVYB 1IU0A 1ZPZA 1UJVA 2CN0H 1L2EA 2ZPSA 3OAAD 1GBIA 1OWIA 4AFSA 1H9IE 1O5FH 2I6QA 1DOJA 1O0DH 1OP2A 2A1DB 3AAUA 2ODPA 2D26C 2L6OA 2QN5T 1E1RD 1MZDA 1PQ5A 1TA2A 1VZQH 2JJ1D 1D3QB 2RCEA 3UWIA 3ZV9A 2CMYA 1BQYA 1DVAH 3P92A 4IN1A 1CBWB 3TH4H 2A2QH 4Q2QA 1NY22 1CGHA 1Z87A 4KTSA 1VCWA 2DJTA 1E37B 2BD4A 1GMCG 3AK5A 3AW1A 5FPYA 3SJIA 1C5ZB 1G2LA 2BDBA 2OQ5A 4Y7BA 4BXSA 2GX4A 1F0SA 4YYXA 3I18A 1TIOA 1O2VA 4NXPA 1ZTLA 1TX8A 1KDQA 1XKBC 1UM7A 2KOJA 1TNLA 5FXLA 3TSWA 2EI8A 2SNVA 1GBCA 3STJA 1NBMD 2OMJA 4B2CA 2ZA5A 1MD8A 2H2CA 3BTQE 4KP0A 5A09A 1UHBB 1IU2A 1WTGH 1O30A 4BNRA 3GDUA 3SW2B 3TLOA 2BXUH 5I7ZA 4A92A 1GJ5H 4YOJA 4BAKB 1TAWA 3M3TA 2CV3A 1NESE 5DKMA 2WV4A 4ABFA 1E1QD 2E7KA 1WTHD 1SGCA 2R4HA 1BRAA 2AYWA 5SGAE 1N6FA 3A8DA 3ZZ8A 4OS5A 1CA0B 2I1NA 1SI5H 1BRUP 1UFXA 1GCDA 1INCA 1P05A 1EAWA 1W14U 4IMQA 3RXSA 4KFVA 1U3BA 2H3LA 2BY5X 1C5WB 4H42U 3Q76A 3LPRA 4JJ0A 1BT7A 5JBBS 4B2AA 2OTVA 3E8LA 1NRRH 4OM9A 1PPFE 1KWAA 3RXJA 5DP3A 2AINA 1NU9A 2Y5HA 3WY8A 1GJ9B 1IQGA 1DITH 4Y8YA 1KTTB 4FXGH 5FX5A 2ZEBA 1F5LA 3ELAH 6GCHF 3K2UA 1E38B 1SGEE 4YM9A 2QBWA 1DE7H 1P01A 3F9FA 1W9EA 1H9LB 3KDKA 1SHHB 3KF2A 4YLQH 3UTUH 2F43B 2J95A 1ZJDA 4IMZA 2R0KA 1V2ST 1K1PA 2P8OC 2XRCA 1CU1A 1FONA 4ESTE 1QL9A 2ZP0H 2Z9GA 3MTYA 2DE8A 3G01A 2LC7A 1A61H 1ELEE 2W7UA 1HYLA 4BTTB 1EXFA 3QO6A 2FOHA 1O5BB 1THRH 1UCYE 3NUMA 4TPYA 1J17T 1KXCA 2QF5A 2BZAA 3MO6A 4OEPA 5C1UA 1X7AC 5JBAS 2PP6A 1O3BA 1HIAA 1NTPA 1SGRE 1Y7NA 1OXGA 5B42A 2HPQH 4ABBA 5FBEA 4HG6A 5A0AE 1TGNA 3MH6A 1QA7A 2ZECA 3QN7A 3ZYDA 1ZOKA 4K3JA 4DVAU 1KTSB 2H9TH 3DSOA 3H7TA 5DSFA 1VCQA 4Q7YA 1GQ5A 2PKUA 3QWCH 2TBSA 4E35A 1GM1A 1Z6EA 4HTCH 1SMFE 2TGAA 4OS2A 3RMMH 3SYJA 1A7SA 1O3MA 1RGQA 3RU4T 5HEBA 7ESTE 2W6JD 2OC7A 1WBGB 2V3HH 4WF8A 2OQSA 2L74A 2M0TA 1F0UA 1X5NA 2G81E 4ZAEA 1QBVH 2BDIA 4ABAA 3HKIB 2V3MA 4GPGA 1ANCA 2UWLA 3GCHC 4HZHA 1IQKA 2KQFA 2IN2A 4WMDA 1AE8H 4BAMB 3BTTE 4AC9A 1HAXB 1QAUA 2HOBA 3VGCB 2AFQB 4XE4A 2Z6BD 5GXPA 2BLOA 3LH3A 1FZZA 5GWZA 3P8GA 1V2WT 3SV9A 2IOTA 5IL9A 4NIYA 1B7XB 2W26A 4NNMA 1P2OA 2PKAB 1CHOF 1OP0A 4AGKA 1VA8A 1GI7B 5C1XA 1X9ZA 2O2TA 4KKDA 3MO9A 4WH6A 2ZTXA 1C5TA 3SNEA 4WJG2 5CHBA 1OHHD 4JOGA 2VWOA 1C1OA 1S6FA 3ZYEA 2DLSA 4XRNA 2M0VA 1EZXC 4IS5A 4CREA 1AN1E 3N7OA 3DJ3A 2RRMA 2FM2A 2TPIZ 1ELBA 3DFLA 5FPSA 3QJMA 3GY2A 3GY7A 2GT8A 1MABB 4ZMAH 1ESTA 1O2RA 1YWUA 2ZPLA 5A0CA 1O2WA 2KAIB 2C8YB 5LGOA 2JREA 2LELA 1UHPA 2HGTH 4O97A 2VGCB 1DUAA 4O03A 4Y76A 1QR3E 4ISHH 3URCA 1AE5A 2BVSH 2A4QA 5E0GA 1D3DB 3RXFA 3E17A 1AFEH 3ZVEA 2EEJA 4P2AB 1AUJA 1PPCE 2JIZD 5CDFE 1TNHA 3SI4H 2FI3E 3RXUA 2KOHA 3CBZA 1ZMJA 2BOHB 1FY1A 1T4UH 2ILNA 1DY8A 4ZH8A 2WYGA 1UTKA 1D9IA 1GBKA 1GBLA 4UFFH 5ESTE 2QF4A 1ETSH 2GZ7A 3W1EA 1HLTH 1Y3XA 4X1PU 3TJUA 5LH8A 4FOUC 1XUGA 1XVOA 1DXPA 2SFAA 2JXOA 1U37A 1FLEE 3HPKA 5DN6D 2Z94A 2PTCE 5DK1A 2VRFA 4JOHA 3GY5A 3RMOH 1GCTB 2KFWA 1ELCA 1J15A 4B76A 2D1JA 1S82A 3UREA 1S84A 4Q3HA 3A86A 3M3VA 2OLGA 1EAIA 5EODA 4Z0KA 1C1WH 2IWOA 1K9OE 1EUFA 1G37A 1NS3A 2QC2A 2YNAA 1WI4A 4YO9A 2XCNA 1RFNA 3UWJH 2LNCA 3E0NB 1K21H 5HIYA 1GWAA 1LPKB 2EAQA 1LHDH 2QV1A 3FP8E 3D62A 2JJ2D 2P59A 3K50A 5DP9A 4GLYA 1C2HA 1X45A 2ZKSA 2PKSB 1SQOA 1FDPA 3P17H 5HGGA 1TMBH 3ATLA 3LC3A 3VG8A 1ZMLA 4YOIA 1SL3A 1EJNA 2QG1A 1JWTA 3RXQA 6CHAB 1IQMA 3OTPA 3PO1B 2LP6A 1GBBA
chains in the Genus database with same CATH topology
5JBCS 3H7OA 3BTME 1F5KU 1C5YB 1AVXA 4YT6H 1GG6C 2JETC 2QXHA 3M36A 3T2NA 1BTZA 2QXGA 2F9BH 5LPEA 1BBRE 1N6XA 2I04A 3ZZ7A 2XBXA 4Q80A 3SUGA 5T3HA 1GBEA 1ZRKA 1TX7A 1ZUBA 5E11A 1CE5A 3ITIA 4GCHG 1PQ7A 2ZTZA 1FIZA 3SHAH 3GCOA 2STBE 3VQGA 2FODA 3GISB 2Q6GA 2J94A 1BOQA 4GSOA 2DKRA 4NMTA 5HFCA 2AGGX 3O8DA 1GDQA 1IQEA 1SGFA 2WUCA 3GJ9A 3O5NA 4X6MA 1C1MA 1AZZA 3NFKA 1HXEH 3VEQB 5AHGH 1EB2A 4OEOA 2AERH 4NMOA 1PPEE 2VIWA 1G2MA 2KBSA 2FPZA 2JIKA 3K65B 3S0NA 2ZFTA 4INHA 4JORA 1MC7A 3LC5A 2BM2A 2FX4A 1MKXK 1P11E 2EGOA 3MH5A 2KPKA 1O5CB 1KSNA 1TNKA 5GLJA 2V6NA 1SOZA 1HUTH 3UFAA 4BXWA 1TX6A 2EXGA 1VITG 5IYTA 3O8BA 1YCPM 1UVPA 1BMAA 2F5YA 2M0UA 1SSXA 1C2FA 2UWPA 1C1NA 1CO7E 4A1XA 3IITA 5D13A 3T26A 3RM0H 3VB4A 2H2ZA 1C1TA 1C5RA 3TJOA 3PV4A 2YUBA 5CMXH 5FPTA 1KLJH 3A81A 3A8CA 4KFWA 1ZR0A 2FYRA 2ZGJA 3EE0B 2WL7A 3F9EA 5DTHA 2FDAA 1EPTA 1D3PB 2ZTYA 1BE9A 4EDJA 5HJ1A 1PPGE 3EGHC 1MTNB 4JZIA 4D76A 4D8NA 3UNRA 1SQTA 2ZCLP 1V3XA 3VXEH 6LPRA 2ODQA 1FC6A 4DG4A 3RP2A 2OZFA 2VWRA 1GHYH 1NM6A 2QYIA 4X6PA 1UF1A 5EPYA 2PWXA 2A7HA 2FEQH 2VWLA 1M9UA 3BPUA 4NFEA 2EJYA 3TSZA 1XUFA 3NGHA 2UUFB 3R0FA 1M5ZA 2ZG0H 4K75A 2YT8A 3QTVH 4DCDA 2GCHF 4K1EA 3V0XA 2ZQ2A 4NIVA 1WQSA 4BAOB 1K1NA 1UCYH 3OSYA 4A5TS 4HOPA 5F8ZA 1TRNA 2EGNA 3SU1A 2V35A 2XWAA 5F8XA 2P93A 1A46H 1SGPE 3MNXA 4LK4A 2A5AA 4AGJA 9LPRA 1VB7A 4HGCA 2HNTC 4O06A 2LA8A 1QB1A 4AFQA 1BB0B 5CHAB 3LGIA 1N8OB 1MCVA 2BYGA 5DGJA 1UEQA 2OINA 3QDZB 1BHXF 2H5CA 1RD3B 1U39A 1THPB 1CBWC 2G4TA 2DM8A 3BG4B 3CENA 4NMVA 1B8QA 3RXOA 1Y3UA 3KEEA 4FUDA 2D2DA 7GCHF 4RKOB 2BDYA 1FJSA 8ESTE 1AQ7A 3S7HB 4TPIZ 1QURH 3SHUA 4FLNA 1C5MD 5A8YA 1S81A 1YCPK 4IGDA 3JZ1B 2PW8H 1P3CA 2XC4A 1O2QA 3F1SB 3SJ9A 1FY5A 3BEFB 4NSVA 3A83A 2OUAA 3DJAA 1TQ3A 2ZGHA 2ZO3H 2ZCKP 2Y80A 3PB1E 5DO4H 1EAUA 2RCZA 4Q2NA 1NRNH 1TPAE 4D9QA 2VH0A 3ID2A 1Z71A 1ACBE 5TJXA 4SGBE 1Q2WA 1MBMA 1UVUH 4NWLA 2Q3GA 2OD3B 1V6DA 1Z86A 1WF7A 4WYUA 1QY6A 5L30H 1CA0C 1L4DA 1GI2A 1O2GH 3A7TA 4CH8B 1N6EA 4UE7H 4B73A 2BXTH 2FOCA 3NK8A 4RN6A 1J16A 1XUHA 3EA7A 1V2QT 4AFZA 1MKWH 1ZMNA 4REYA 3RMNH 1AKSA 1WJLA 1C5PA 1K22H 1E0FD 1MUEB 2R0LA 1O39A </