1TP3A

Pdz3 domain of psd-95 protein complexed with kketpv peptide ligand
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
115
structure length
115
Chain Sequence
b'FLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVDSSGRIVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Presynaptic density protein 95
publication title Structure of the third PDZ domain of PSD-95 protein complexed with KKETPV peptide ligand
rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 28
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1tp3A00
2V90A 1MC7A 3DJAA 4YDPA 1R6JA 2G2LA 4N6XA 4P2AB 1TQ3A 4NMQA 3TMHA 4R2ZA 2JILA 2M0ZA 1WI4A 4PQWA 3LNYA 4JORA 2KA9A 1UM1A 1MFGA 4O06A 1UITA 2EAQA 4Z33A 4YYXA 2KOJA 3QJNA 4AMHA 5HEBA 2Z9IA 2KV8A 2BYGA 1IU0A 5F3XA 2EEIA 5HF1A 2VWRA 1BE9A 3K82A 4Q2OA 3STJA 2LUIA 2AWWA 2EV8A 2VSVA 1QAUA 3GCOA 5E6PB 2DAZA 2MX6A 1X5QA 2EJYA 1I92A 2LC7A 2EEHA 5HEDA 1SOZA 4Q2PA 1U39A 3SHWA 3NGHA 4MPAA 2QKVA 2WL7A 2F5YA 2EEJA 5D13A 2CS5A 1X6DA 2PKTA 1L6OA 3CS0A 3SHUA 1BFEA 2YT8A 4E35A 2E7KA 5FHTA 2IWOA 3BPUA 1IU2A 4KFVA 1FCFA 2KJDA 2PA1A 2OS6A 2JXOA 2KPLA 1N6FA 4JOFA 3QE1A 1UEPA 3B76A 3MH4A 1RGRA 4UU5A 3RL7A 1KY9A 1VB7A 4K6YA 2ZPMA 5H3JA 3L4FD 2EXGA 2OSGA 3GDUA 4K76A 3ID4A 2R4HA 2PKUA 1X8SA 4HOPA 1GQ4A 3PV2A 2H3LA 3QO6A 5HFBA 5E1YA 3KHFA 2IWNA 1V5QA 3I18A 4NMTA 1FC9A 3TSWA 1P1DA 2VSPA 4H11A 3AXAA 2QKUA 2JOAA 2F0AA 2X7ZA 2EDZA 3R0HA 1T2MA 3CBXA 2K20A 1OBXA 1QLCA 4NMSA 1V1TA 1N6EA 1Z86A 4NMPA 2PNTA 2DKRA 3NFKA 5HDYA 1LCYA 3KZDA 1UEZA 3E17A 1YBOA 3O46A 4NXQA 2K1ZA 1PDRA 1W9QA 1G9OA 4K72A 1Z87A 2CSSA 2KJPA 2QG1A 2LA8A 2LOBA 1Q3OA 1UFXA 1OBYA 4IC6A 3VQGA 3PV4A 2I0LA 4GHNA 4Q2NA 1UHPA 1TE0A 1WF8A 2UZCA 5E11A 2H2CA 5E22A 4OEPA 2KRGA 4FGMA 4F8KA 3TSVA 2W4FA 1K32A 2H3MA 5HFFA 2P3WA 4NMRA 3HVQC 2VRFA 4KFWA 4EDJA 2FNEA 2EDPA 3VQFA 3GDSA 1TP5A 2KG2A 1RZXA 1ZOKA 2G5MB 1W9EA 3CH8A 2FN5A 3SOEA 1WFVA 2I04A 2JINA 1WJLA 2M0TA 1VJ6A 3I4WA 2IWQA 3RLEA 2EHRA 3ID1A 5HJ1A 4P0CA 1KWAA 5HETA 1Q7XA 2ZPLA 4K75A 2AWXA 4OAJA 3EGHC 2KOHA 4Q2QA 2JREA 1NF3C 2EDVA 1UJUA 2KAWA 1N99A 1RGWA 3MH6A 2LC6A 2GZVA 1UJVA 2YUYA 5HFCA 3HPKA 2L4SA 3ID3A 2D92A 4WYUA 3PDZA 3PS4A 4L8NA 4K78A 2VPHA 1X45A 5GLJA 1X5RA 5F67A 5B6LA 3JXTA 1B8QA 2VZ5A 3DJ1A 1UEQA 1V5LA 4JOGA 4JOJA 3FY5A 3LNXA 1UEWA 2R3YA 2I0IA 1V6BA 1WFGA 5E21A 2M0UA 1WI2A 1I16A 5G1DA 4GVDA 2AWUA 5EZ0A 1UF1A 2I4SA 2I1NA 3DORA 4NMOA 2M0VA 1KEFA 3GJ9A 5I7ZA 2I6VA 3K1RA 4WYTA 1FC6A 2DC2A 1MFLA 2Q3GA 2KOMA 2DLUA 1WIFA 4NNMA 2CSJA 1N7EA 2KJKA 4E34A 5JXBA 1WHDA 1Y8TA 2DMZA 2QBWA 2D8IA 3DIWA 4JOKA 5FB8C 1RY4A 5HEYA 2W7RA 1Y7NA 4JOHA 1V62A 5GNDA 4UU6A 3ID2A 2KL1A 4Q6SA 1QAVA 3DJ3A 1QAVB 2DJTA 2D90A 4OEOA 4E3BA 3MH7A 2KPKA 2FE5A 3QDOA 3WKLA 4GVCA 3CBZA 1WHAA 2OGPA 1D5GA 2RRMA 1UJDA 2JWEA 1SOTA 3ZRTA 3NFLA 2OCSA 3GSLA 1GM1A 3GGEA 3TSZA 5HFDA 1U37A 2YT7A 1OZIA 1W9OA 1X5NA 3SFJA 4LMMA 3K50A 2KQFA 1N6DA 2YUBA 3I1EA 2YTWA 3KZEA 5HF4A 1WF7A 5DTHA 1ZUBA 3RL8A 5A2PA 4RI0A 1OBZA 2IWPA 3EGGC 2OQSA 3CYYA 2Z17A 3R69A 1NTEA 5HFEA 3OU0A 2HE2A 4NNLA 2QKTA 2KYLA 4NXRA 1UM7A 2MHOA 2DM8A 3CBYA 4NXPA 4G69A 2ENOA 1Q3PA 4JL7A 2L4TA 3GDVA 2Q9VA 3WKMA 1FC7A 2REYA 2OZFA 2HGAA 2EGOA 1VA8A 2H2BA 3O5NA 2DLSA 3QGLA 5EYZA 2HE4A 3GCNA 4Q6HA 2PZDA 4JOEA 4HOPB 2V1WA 2O2TA 2RCZA 2KBSA 4Q3HA 3HPMA 1N7FA 3PV5A 2EEGA 1WH1A 2EGKA 1VAEA 2FCFA 4JOPA 1U38A 3PDVA 4Z8JA 1GQ5A 1IHJA 1P1EA 2QT5A 2PDZA 1N7TA 3CC0A 3R68A 4XHVA 2L97A 4REYA 3QJMA 4NMVA 2DB5A 3OTPA 3SUZA 1WG6A 2M10A 3QIKA 5G1EA 2OPGA 1M5ZA 2OMJA 1TP3A 2AINA 2JIKA 2EGNA 1VCWA 2M3MA 1U3BA 1XZ9A
chains in the Genus database with same CATH superfamily
2V90A 1MC7A 3DJAA 4YDPA 1R6JA 2G2LA 4N6XA 4P2AB 1TQ3A 4NMQA 3TMHA 4R2ZA 2JILA 2M0ZA 1WI4A 4PQWA 3LNYA 4JORA 2KA9A 1UM1A 1MFGA 4O06A 1UITA 2EAQA 4Z33A 4YYXA 2KOJA 3QJNA 4AMHA 5HEBA 2Z9IA 2KV8A 2BYGA 1IU0A 5F3XA 2EEIA 5HF1A 2VWRA 1BE9A 3K82A 4Q2OA 3STJA 2LUIA 2AWWA 2EV8A 2VSVA 1QAUA 3GCOA 5E6PB 2DAZA 2MX6A 1X5QA 2EJYA 1I92A 2LC7A 2EEHA 5HEDA 1SOZA 4Q2PA 1U39A 3SHWA 3NGHA 4MPAA 2QKVA 2WL7A 2F5YA 2GEFA 2EEJA 5D13A 2CS5A 1X6DA 2PKTA 1L6OA 3CS0A 3SHUA 1BFEA 2YT8A 4E35A 2E7KA 5FHTA 2IWOA 3BPUA 1IU2A 4KFVA 1FCFA 2KJDA 2PA1A 2OS6A 2JXOA 2KPLA 1N6FA 4JOFA 3QE1A 1UEPA 3B76A 3MH4A 1RGRA 4UU5A 3RL7A 1KY9A 1VB7A 4K6YA 2ZPMA 5H3JA 3L4FD 2EXGA 2OSGA 3GDUA 4K76A 3ID4A 2R4HA 2PKUA 1X8SA 4HOPA 1GQ4A 3PV2A 2H3LA 3QO6A 5HFBA 5E1YA 3KHFA 2IWNA 1V5QA 3I18A 4NMTA 1FC9A 3TSWA 1P1DA 2VSPA 4H11A 3AXAA 2QKUA 2JOAA 2F0AA 2X7ZA 2EDZA 3R0HA 1T2MA 3CBXA 2K20A 1OBXA 1QLCA 4NMSA 1V1TA 1N6EA 1Z86A 4NMPA 2PNTA 2DKRA 3NFKA 5HDYA 1LCYA 3KZDA 1UEZA 3E17A 1YBOA 3O46A 4NXQA 2K1ZA 1PDRA 1W9QA 1G9OA 4K72A 1Z87A 2CSSA 2KJPA 2QG1A 2LA8A 2LOBA 1Q3OA 1UFXA 1OBYA 4IC6A 3VQGA 3PV4A 2I0LA 4GHNA 4Q2NA 1UHPA 1TE0A 1WF8A 2UZCA 5E11A 2H2CA 5E22A 4OEPA 2KRGA 4FGMA 4F8KA 3TSVA 2W4FA 1K32A 2H3MA 5HFFA 2P3WA 4NMRA 3HVQC 2VRFA 4KFWA 4EDJA 2FNEA 2EDPA 3VQFA 3GDSA 1TP5A 2KG2A 1RZXA 1ZOKA 2G5MB 1W9EA 3CH8A 2FN5A 3SOEA 1WFVA 2I04A 4JJ0A 3NCVA 2JINA 1WJLA 2M0TA 1VJ6A 3I4WA 2IWQA 3RLEA 2EHRA 3ID1A 5HJ1A 4P0CA 1KWAA 5HETA 1Q7XA 2ZPLA 4K75A 2AWXA 4OAJA 3EGHC 2KOHA 2JSNA 4Q2QA 2JREA 1NF3C 2EDVA 1UJUA 2KAWA 1N99A 1RGWA 3MH6A 2LC6A 2GZVA 1UJVA 2YUYA 5HFCA 3HPKA 2L4SA 3ID3A 2D92A 4WYUA 3PDZA 3PS4A 4L8NA 4K78A 2VPHA 1X45A 5GLJA 1X5RA 5F67A 5B6LA 3JXTA 1B8QA 2VZ5A 3DJ1A 1UEQA 1V5LA 4JOGA 4JOJA 3FY5A 3LNXA 1UEWA 2R3YA 2I0IA 1V6BA 1WFGA 5E21A 2M0UA 1WI2A 1I16A 5G1DA 4GVDA 2AWUA 5EZ0A 1UF1A 2I4SA 2I1NA 3DORA 4NMOA 2M0VA 1KEFA 3GJ9A 5I7ZA 2I6VA 3K1RA 4WYTA 1FC6A 2DC2A 1MFLA 2Q3GA 2KOMA 2DLUA 1WIFA 4NNMA 2CSJA 1N7EA 2KJKA 4E34A 5JXBA 1WHDA 5IL9A 1Y8TA 2DMZA 2QBWA 2D8IA 3DIWA 4JOKA 5FB8C 1RY4A 5HEYA 4JJ3A 2W7RA 1Y7NA 4JOHA 1V62A 5GNDA 4UU6A 3ID2A 2KL1A 4Q6SA 1QAVA 3DJ3A 1QAVB 2DJTA 2D90A 4OEOA 4E3BA 3MH7A 2KPKA 2FE5A 3QDOA 3WKLA 4GVCA 3CBZA 1WHAA 2OGPA 1D5GA 2RRMA 1UJDA 2JWEA 1SOTA 3ZRTA 3NFLA 2OCSA 3GSLA 3KDKA 1GM1A 3GGEA 3TSZA 5HFDA 3KDGA 1U37A 2YT7A 1OZIA 1W9OA 1X5NA 3SFJA 4LMMA 3K50A 2KQFA 1N6DA 2YUBA 3I1EA 2YTWA 3KZEA 5HF4A 1WF7A 5DTHA 1ZUBA 3RL8A 5A2PA 4RI0A 5ILBA 1OBZA 2IWPA 3EGGC 3GABA 2OQSA 3CYYA 2Z17A 3R69A 1NTEA 5HFEA 3OU0A 2HE2A 4NNLA 2QKTA 2KYLA 4NXRA 1UM7A 2MHOA 2DM8A 3CBYA 4NXPA 4G69A 2ENOA 1Q3PA 4JL7A 2L4TA 3GDVA 2Q9VA 3WKMA 1FC7A 2REYA 5B42A 2OZFA 2HGAA 2EGOA 4FLNA 1VA8A 2H2BA 3O5NA 2DLSA 3QGLA 5EYZA 2HE4A 3GCNA 4Q6HA 2PZDA 4JOEA 4HOPB 2V1WA 2O2TA 2RCZA 2KBSA 4Q3HA 3HPMA 1N7FA 3PV5A 2EEGA 1WH1A 2EGKA 1X9ZA 1VAEA 2FCFA 4JOPA 1U38A 3PDVA 4Z8JA 1GQ5A 1IHJA 1P1EA 2QT5A 2PDZA 1N7TA 3CC0A 3R68A 4XHVA 2L97A 4REYA 3QJMA 4NMVA 2DB5A 3OTPA 3SUZA 1WG6A 2M10A 3QIKA 5G1EA 2OPGA 1M5ZA 2OMJA 1TP3A 2AINA 2JIKA 2EGNA 1VCWA 2M3MA 1U3BA 1XZ9A
chains in the Genus database with same CATH topology
2V90A 1MC7A 3DJAA 4YDPA 1R6JA 2G2LA 4N6XA 4P2AB 1TQ3A 4NMQA 3TMHA 4R2ZA 2JILA 2M0ZA 1WI4A 4PQWA 3LNYA 4JORA 2KA9A 1UM1A 1MFGA 4O06A 1UITA 2EAQA 4Z33A 4YYXA 2KOJA 3QJNA 4AMHA 5HEBA 2Z9IA 2KV8A 2BYGA 1IU0A 5F3XA 2EEIA 5HF1A 2VWRA 1BE9A 3K82A 4Q2OA 3STJA 2LUIA 2AWWA 2EV8A 2VSVA 1QAUA 3GCOA 5E6PB 2DAZA 2MX6A 1X5QA 2EJYA 1I92A 2LC7A 2EEHA 5HEDA 1SOZA 4Q2PA 1U39A 3SHWA 3NGHA 4MPAA 2QKVA 2WL7A 2F5YA 2GEFA 2EEJA 5D13A 2CS5A 1X6DA 2PKTA 1L6OA 3CS0A 3SHUA 1BFEA 2YT8A 4E35A 2E7KA 5FHTA 2IWOA 3BPUA 1IU2A 4KFVA 1FCFA 2KJDA 2PA1A 2OS6A 2JXOA 2KPLA 1N6FA 4JOFA 3QE1A 1UEPA 3B76A 3MH4A 1RGRA 4UU5A 3RL7A 1KY9A 1VB7A 4K6YA 2ZPMA 5H3JA 3L4FD 2EXGA 2OSGA 3GDUA 4K76A 3ID4A 2R4HA 2PKUA 1X8SA 4HOPA 1GQ4A 3PV2A 2H3LA 3QO6A 5HFBA 5E1YA 3KHFA 2IWNA 1V5QA 3I18A 4NMTA 1FC9A 3TSWA 1P1DA 2VSPA 4H11A 3AXAA 2QKUA 2JOAA 2F0AA 2X7ZA 2EDZA 3R0HA 1T2MA 3CBXA 2K20A 1OBXA 1QLCA 4NMSA 1V1TA 1N6EA 1Z86A 4NMPA 2PNTA 2DKRA 3NFKA 5HDYA 1LCYA 3KZDA 1UEZA 3E17A 1YBOA 3O46A 4NXQA 2K1ZA 1PDRA 1W9QA 1G9OA 4K72A 1Z87A 2CSSA 2KJPA 2QG1A 2LA8A 2LOBA 1Q3OA 1UFXA 1OBYA 4IC6A 3VQGA 3PV4A 2I0LA 4GHNA 4Q2NA 1UHPA 1TE0A 1WF8A 2UZCA 5E11A 2H2CA 5E22A 4OEPA 2KRGA 4FGMA 4F8KA 3TSVA 2W4FA 1K32A 2H3MA 5HFFA 2P3WA 4NMRA 3HVQC 2VRFA 4KFWA 4EDJA 2FNEA 2EDPA 3VQFA 3GDSA 1TP5A 2KG2A 1RZXA 1ZOKA 2G5MB 1W9EA 3CH8A 2FN5A 3SOEA 1WFVA 2I04A 4JJ0A 3NCVA 2JINA 1WJLA 2M0TA 1VJ6A 3I4WA 2IWQA 3RLEA 2EHRA 3ID1A 5HJ1A 4P0CA 1KWAA 5HETA 1Q7XA 2ZPLA 4K75A 2AWXA 4OAJA 3EGHC 2KOHA 2JSNA 4Q2QA 2JREA 1NF3C 2EDVA 1UJUA 2KAWA 1N99A 1RGWA 3MH6A 2LC6A 2GZVA 1UJVA 2YUYA 5HFCA 3HPKA 2L4SA 3ID3A 2D92A 4WYUA 3PDZA 3PS4A 4L8NA 4K78A 2VPHA 1X45A 5GLJA 1X5RA 5F67A 5B6LA 3JXTA 1B8QA 2VZ5A 3DJ1A 1UEQA 1V5LA 4JOGA 4JOJA 3FY5A 3LNXA 1UEWA 2R3YA 2I0IA 1V6BA 1WFGA 5E21A 2M0UA 1WI2A 1I16A 5G1DA 4GVDA 2AWUA 5EZ0A 1UF1A 2I4SA 2I1NA 3DORA 4NMOA 2M0VA 1KEFA 3GJ9A 5I7ZA 2I6VA 3K1RA 4WYTA 1FC6A 2DC2A 1MFLA 2Q3GA 2KOMA 2DLUA 1WIFA 4NNMA 2CSJA 1N7EA 2KJKA 4E34A 5JXBA 1WHDA 5IL9A 1Y8TA 2DMZA 2QBWA 2D8IA 3DIWA 4JOKA 5FB8C 1RY4A 5HEYA 4JJ3A 2W7RA 1Y7NA 4JOHA 1V62A 5GNDA 4UU6A 3ID2A 2KL1A 4Q6SA 1QAVA 3DJ3A 1QAVB 2DJTA 2D90A 4OEOA 4E3BA 3MH7A 2KPKA 2FE5A 3QDOA 3WKLA 4GVCA 3CBZA 1WHAA 2OGPA 1D5GA 2RRMA 1UJDA 2JWEA 1SOTA 3ZRTA 3NFLA 2OCSA 3GSLA 3KDKA 1GM1A 3GGEA 3TSZA 5HFDA 3KDGA 1U37A 2YT7A 1OZIA 1W9OA 1X5NA 3SFJA 4LMMA 3K50A 2KQFA 1N6DA 2YUBA 3I1EA 2YTWA 3KZEA 5HF4A 1WF7A 5DTHA 1ZUBA 3RL8A 5A2PA 4RI0A 5ILBA 1OBZA 2IWPA 3EGGC 3GABA 2OQSA 3CYYA 2Z17A 3R69A 1NTEA 5HFEA 3OU0A 2HE2A 4NNLA 2QKTA 2KYLA 4NXRA 1UM7A 2MHOA 2DM8A 3CBYA 4NXPA 4G69A 2ENOA 1Q3PA 4JL7A 2L4TA 3GDVA 2Q9VA 3WKMA 1FC7A 2REYA 5B42A 2OZFA 2HGAA 2EGOA 4FLNA 1VA8A 2H2BA 3O5NA 2DLSA 3QGLA 5EYZA 2HE4A 3GCNA 4Q6HA 2PZDA 4JOEA 4HOPB 2V1WA 2O2TA 2RCZA 2KBSA 4Q3HA 3HPMA 1N7FA 3PV5A 2EEGA 1WH1A 2EGKA 1X9ZA 1VAEA 2FCFA 4JOPA 1U38A 3PDVA 4Z8JA 1GQ5A 1IHJA 1P1EA 2QT5A 2PDZA 1N7TA 3CC0A 3R68A 4XHVA 2L97A 4REYA 3QJMA 4NMVA 2DB5A 3OTPA 3SUZA 1WG6A 2M10A 3QIKA 5G1EA 2OPGA 1M5ZA 2OMJA 1TP3A 2AINA 2JIKA 2EGNA 1VCWA 2M3MA 1U3BA 1XZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V90 A;  1MC7 A;  3DJA A;  4YDP A;  1R6J A;  2G2L A;  4N6X A;  4P2A B;  1TQ3 A;  4NMQ A;  3TMH A;  4R2Z A;  2JIL A;  2M0Z A;  1WI4 A;  4PQW A;  3LNY A;  4JOR A;  2KA9 A;  1UM1 A;  1MFG A;  4O06 A;  1UIT A;  2EAQ A;  4Z33 A;  4YYX A;  2KOJ A;  3QJN A;  4AMH A;  5HEB A;  2Z9I A;  2KV8 A;  2BYG A;  1IU0 A;  5F3X A;  2EEI A;  5HF1 A;  2VWR A;  1BE9 A;  3K82 A;  4Q2O A;  3STJ A;  2LUI A;  2AWW A;  2EV8 A;  2VSV A;  1QAU A;  3GCO A;  5E6P B;  2DAZ A;  2MX6 A;  1X5Q A;  2EJY A;  1I92 A;  2LC7 A;  2EEH A;  5HED A;  1SOZ A;  4Q2P A;  1U39 A;  3SHW A;  3NGH A;  4MPA A;  2QKV A;  2WL7 A;  2F5Y A;  2EEJ A;  5D13 A;  2CS5 A;  1X6D A;  2PKT A;  1L6O A;  3CS0 A;  3SHU A;  1BFE A;  2YT8 A;  4E35 A;  2E7K A;  5FHT A;  2IWO A;  3BPU A;  1IU2 A;  4KFV A;  1FCF A;  2KJD A;  2PA1 A;  2OS6 A;  2JXO A;  2KPL A;  1N6F A;  4JOF A;  3QE1 A;  1UEP A;  3B76 A;  3MH4 A;  1RGR A;  4UU5 A;  3RL7 A;  1KY9 A;  1VB7 A;  4K6Y A;  2ZPM A;  5H3J A;  3L4F D;  2EXG A;  2OSG A;  3GDU A;  4K76 A;  3ID4 A;  2R4H A;  2PKU A;  1X8S A;  4HOP A;  1GQ4 A;  3PV2 A;  2H3L A;  3QO6 A;  5HFB A;  5E1Y A;  3KHF A;  2IWN A;  1V5Q A;  3I18 A;  4NMT A;  1FC9 A;  3TSW A;  1P1D A;  2VSP A;  4H11 A;  3AXA A;  2QKU A;  2JOA A;  2F0A A;  2X7Z A;  2EDZ A;  3R0H A;  1T2M A;  3CBX A;  2K20 A;  1OBX A;  1QLC A;  4NMS A;  1V1T A;  1N6E A;  1Z86 A;  4NMP A;  2PNT A;  2DKR A;  3NFK A;  5HDY A;  1LCY A;  3KZD A;  1UEZ A;  3E17 A;  1YBO A;  3O46 A;  4NXQ A;  2K1Z A;  1PDR A;  1W9Q A;  1G9O A;  4K72 A;  1Z87 A;  2CSS A;  2KJP A;  2QG1 A;  2LA8 A;  2LOB A;  1Q3O A;  1UFX A;  1OBY A;  4IC6 A;  3VQG A;  3PV4 A;  2I0L A;  4GHN A;  4Q2N A;  1UHP A;  1TE0 A;  1WF8 A;  2UZC A;  5E11 A;  2H2C A;  5E22 A;  4OEP A;  2KRG A;  4FGM A;  4F8K A;  3TSV A;  2W4F A;  1K32 A;  2H3M A;  5HFF A;  2P3W A;  4NMR A;  3HVQ C;  2VRF A;  4KFW A;  4EDJ A;  2FNE A;  2EDP A;  3VQF A;  3GDS A;  1TP5 A;  2KG2 A;  1RZX A;  1ZOK A;  2G5M B;  1W9E A;  3CH8 A;  2FN5 A;  3SOE A;  1WFV A;  2I04 A;  2JIN A;  1WJL A;  2M0T A;  1VJ6 A;  3I4W A;  2IWQ A;  3RLE A;  2EHR A;  3ID1 A;  5HJ1 A;  4P0C A;  1KWA A;  5HET A;  1Q7X A;  2ZPL A;  4K75 A;  2AWX A;  4OAJ A;  3EGH C;  2KOH A;  4Q2Q A;  2JRE A;  1NF3 C;  2EDV A;  1UJU A;  2KAW A;  1N99 A;  1RGW A;  3MH6 A;  2LC6 A;  2GZV A;  1UJV A;  2YUY A;  5HFC A;  3HPK A;  2L4S A;  3ID3 A;  2D92 A;  4WYU A;  3PDZ A;  3PS4 A;  4L8N A;  4K78 A;  2VPH A;  1X45 A;  5GLJ A;  1X5R A;  5F67 A;  5B6L A;  3JXT A;  1B8Q A;  2VZ5 A;  3DJ1 A;  1UEQ A;  1V5L A;  4JOG A;  4JOJ A;  3FY5 A;  3LNX A;  1UEW A;  2R3Y A;  2I0I A;  1V6B A;  1WFG A;  5E21 A;  2M0U A;  1WI2 A;  1I16 A;  5G1D A;  4GVD A;  2AWU A;  5EZ0 A;  1UF1 A;  2I4S A;  2I1N A;  3DOR A;  4NMO A;  2M0V A;  1KEF A;  3GJ9 A;  5I7Z A;  2I6V A;  3K1R A;  4WYT A;  1FC6 A;  2DC2 A;  1MFL A;  2Q3G A;  2KOM A;  2DLU A;  1WIF A;  4NNM A;  2CSJ A;  1N7E A;  2KJK A;  4E34 A;  5JXB A;  1WHD A;  1Y8T A;  2DMZ A;  2QBW A;  2D8I A;  3DIW A;  4JOK A;  5FB8 C;  1RY4 A;  5HEY A;  2W7R A;  1Y7N A;  4JOH A;  1V62 A;  5GND A;  4UU6 A;  3ID2 A;  2KL1 A;  4Q6S A;  1QAV A;  3DJ3 A;  1QAV B;  2DJT A;  2D90 A;  4OEO A;  4E3B A;  3MH7 A;  2KPK A;  2FE5 A;  3QDO A;  3WKL A;  4GVC A;  3CBZ A;  1WHA A;  2OGP A;  1D5G A;  2RRM A;  1UJD A;  2JWE A;  1SOT A;  3ZRT A;  3NFL A;  2OCS A;  3GSL A;  1GM1 A;  3GGE A;  3TSZ A;  5HFD A;  1U37 A;  2YT7 A;  1OZI A;  1W9O A;  1X5N A;  3SFJ A;  4LMM A;  3K50 A;  2KQF A;  1N6D A;  2YUB A;  3I1E A;  2YTW A;  3KZE A;  5HF4 A;  1WF7 A;  5DTH A;  1ZUB A;  3RL8 A;  5A2P A;  4RI0 A;  1OBZ A;  2IWP A;  3EGG C;  2OQS A;  3CYY A;  2Z17 A;  3R69 A;  1NTE A;  5HFE A;  3OU0 A;  2HE2 A;  4NNL A;  2QKT A;  2KYL A;  4NXR A;  1UM7 A;  2MHO A;  2DM8 A;  3CBY A;  4NXP A;  4G69 A;  2ENO A;  1Q3P A;  4JL7 A;  2L4T A;  3GDV A;  2Q9V A;  3WKM A;  1FC7 A;  2REY A;  2OZF A;  2HGA A;  2EGO A;  1VA8 A;  2H2B A;  3O5N A;  2DLS A;  3QGL A;  5EYZ A;  2HE4 A;  3GCN A;  4Q6H A;  2PZD A;  4JOE A;  4HOP B;  2V1W A;  2O2T A;  2RCZ A;  2KBS A;  4Q3H A;  3HPM A;  1N7F A;  3PV5 A;  2EEG A;  1WH1 A;  2EGK A;  1VAE A;  2FCF A;  4JOP A;  1U38 A;  3PDV A;  4Z8J A;  1GQ5 A;  1IHJ A;  1P1E A;  2QT5 A;  2PDZ A;  1N7T A;  3CC0 A;  3R68 A;  4XHV A;  2L97 A;  4REY A;  3QJM A;  4NMV A;  2DB5 A;  3OTP A;  3SUZ A;  1WG6 A;  2M10 A;  3QIK A;  5G1E A;  2OPG A;  1M5Z A;  2OMJ A;  1TP3 A;  2AIN A;  2JIK A;  2EGN A;  1VCW A;  2M3M A;  1U3B A;  1XZ9 A; 
#chains in the Genus database with same CATH topology
 2V90 A;  1MC7 A;  3DJA A;  4YDP A;  1R6J A;  2G2L A;  4N6X A;  4P2A B;  1TQ3 A;  4NMQ A;  3TMH A;  4R2Z A;  2JIL A;  2M0Z A;  1WI4 A;  4PQW A;  3LNY A;  4JOR A;  2KA9 A;  1UM1 A;  1MFG A;  4O06 A;  1UIT A;  2EAQ A;  4Z33 A;  4YYX A;  2KOJ A;  3QJN A;  4AMH A;  5HEB A;  2Z9I A;  2KV8 A;  2BYG A;  1IU0 A;  5F3X A;  2EEI A;  5HF1 A;  2VWR A;  1BE9 A;  3K82 A;  4Q2O A;  3STJ A;  2LUI A;  2AWW A;  2EV8 A;  2VSV A;  1QAU A;  3GCO A;  5E6P B;  2DAZ A;  2MX6 A;  1X5Q A;  2EJY A;  1I92 A;  2LC7 A;  2EEH A;  5HED A;  1SOZ A;  4Q2P A;  1U39 A;  3SHW A;  3NGH A;  4MPA A;  2QKV A;  2WL7 A;  2F5Y A;  2GEF A;  2EEJ A;  5D13 A;  2CS5 A;  1X6D A;  2PKT A;  1L6O A;  3CS0 A;  3SHU A;  1BFE A;  2YT8 A;  4E35 A;  2E7K A;  5FHT A;  2IWO A;  3BPU A;  1IU2 A;  4KFV A;  1FCF A;  2KJD A;  2PA1 A;  2OS6 A;  2JXO A;  2KPL A;  1N6F A;  4JOF A;  3QE1 A;  1UEP A;  3B76 A;  3MH4 A;  1RGR A;  4UU5 A;  3RL7 A;  1KY9 A;  1VB7 A;  4K6Y A;  2ZPM A;  5H3J A;  3L4F D;  2EXG A;  2OSG A;  3GDU A;  4K76 A;  3ID4 A;  2R4H A;  2PKU A;  1X8S A;  4HOP A;  1GQ4 A;  3PV2 A;  2H3L A;  3QO6 A;  5HFB A;  5E1Y A;  3KHF A;  2IWN A;  1V5Q A;  3I18 A;  4NMT A;  1FC9 A;  3TSW A;  1P1D A;  2VSP A;  4H11 A;  3AXA A;  2QKU A;  2JOA A;  2F0A A;  2X7Z A;  2EDZ A;  3R0H A;  1T2M A;  3CBX A;  2K20 A;  1OBX A;  1QLC A;  4NMS A;  1V1T A;  1N6E A;  1Z86 A;  4NMP A;  2PNT A;  2DKR A;  3NFK A;  5HDY A;  1LCY A;  3KZD A;  1UEZ A;  3E17 A;  1YBO A;  3O46 A;  4NXQ A;  2K1Z A;  1PDR A;  1W9Q A;  1G9O A;  4K72 A;  1Z87 A;  2CSS A;  2KJP A;  2QG1 A;  2LA8 A;  2LOB A;  1Q3O A;  1UFX A;  1OBY A;  4IC6 A;  3VQG A;  3PV4 A;  2I0L A;  4GHN A;  4Q2N A;  1UHP A;  1TE0 A;  1WF8 A;  2UZC A;  5E11 A;  2H2C A;  5E22 A;  4OEP A;  2KRG A;  4FGM A;  4F8K A;  3TSV A;  2W4F A;  1K32 A;  2H3M A;  5HFF A;  2P3W A;  4NMR A;  3HVQ C;  2VRF A;  4KFW A;  4EDJ A;  2FNE A;  2EDP A;  3VQF A;  3GDS A;  1TP5 A;  2KG2 A;  1RZX A;  1ZOK A;  2G5M B;  1W9E A;  3CH8 A;  2FN5 A;  3SOE A;  1WFV A;  2I04 A;  4JJ0 A;  3NCV A;  2JIN A;  1WJL A;  2M0T A;  1VJ6 A;  3I4W A;  2IWQ A;  3RLE A;  2EHR A;  3ID1 A;  5HJ1 A;  4P0C A;  1KWA A;  5HET A;  1Q7X A;  2ZPL A;  4K75 A;  2AWX A;  4OAJ A;  3EGH C;  2KOH A;  2JSN A;  4Q2Q A;  2JRE A;  1NF3 C;  2EDV A;  1UJU A;  2KAW A;  1N99 A;  1RGW A;  3MH6 A;  2LC6 A;  2GZV A;  1UJV A;  2YUY A;  5HFC A;  3HPK A;  2L4S A;  3ID3 A;  2D92 A;  4WYU A;  3PDZ A;  3PS4 A;  4L8N A;  4K78 A;  2VPH A;  1X45 A;  5GLJ A;  1X5R A;  5F67 A;  5B6L A;  3JXT A;  1B8Q A;  2VZ5 A;  3DJ1 A;  1UEQ A;  1V5L A;  4JOG A;  4JOJ A;  3FY5 A;  3LNX A;  1UEW A;  2R3Y A;  2I0I A;  1V6B A;  1WFG A;  5E21 A;  2M0U A;  1WI2 A;  1I16 A;  5G1D A;  4GVD A;  2AWU A;  5EZ0 A;  1UF1 A;  2I4S A;  2I1N A;  3DOR A;  4NMO A;  2M0V A;  1KEF A;  3GJ9 A;  5I7Z A;  2I6V A;  3K1R A;  4WYT A;  1FC6 A;  2DC2 A;  1MFL A;  2Q3G A;  2KOM A;  2DLU A;  1WIF A;  4NNM A;  2CSJ A;  1N7E A;  2KJK A;  4E34 A;  5JXB A;  1WHD A;  5IL9 A;  1Y8T A;  2DMZ A;  2QBW A;  2D8I A;  3DIW A;  4JOK A;  5FB8 C;  1RY4 A;  5HEY A;  4JJ3 A;  2W7R A;  1Y7N A;  4JOH A;  1V62 A;  5GND A;  4UU6 A;  3ID2 A;  2KL1 A;  4Q6S A;  1QAV A;  3DJ3 A;  1QAV B;  2DJT A;  2D90 A;  4OEO A;  4E3B A;  3MH7 A;  2KPK A;  2FE5 A;  3QDO A;  3WKL A;  4GVC A;  3CBZ A;  1WHA A;  2OGP A;  1D5G A;  2RRM A;  1UJD A;  2JWE A;  1SOT A;  3ZRT A;  3NFL A;  2OCS A;  3GSL A;  3KDK A;  1GM1 A;  3GGE A;  3TSZ A;  5HFD A;  3KDG A;  1U37 A;  2YT7 A;  1OZI A;  1W9O A;  1X5N A;  3SFJ A;  4LMM A;  3K50 A;  2KQF A;  1N6D A;  2YUB A;  3I1E A;  2YTW A;  3KZE A;  5HF4 A;  1WF7 A;  5DTH A;  1ZUB A;  3RL8 A;  5A2P A;  4RI0 A;  5ILB A;  1OBZ A;  2IWP A;  3EGG C;  3GAB A;  2OQS A;  3CYY A;  2Z17 A;  3R69 A;  1NTE A;  5HFE A;  3OU0 A;  2HE2 A;  4NNL A;  2QKT A;  2KYL A;  4NXR A;  1UM7 A;  2MHO A;  2DM8 A;  3CBY A;  4NXP A;  4G69 A;  2ENO A;  1Q3P A;  4JL7 A;  2L4T A;  3GDV A;  2Q9V A;  3WKM A;  1FC7 A;  2REY A;  5B42 A;  2OZF A;  2HGA A;  2EGO A;  4FLN A;  1VA8 A;  2H2B A;  3O5N A;  2DLS A;  3QGL A;  5EYZ A;  2HE4 A;  3GCN A;  4Q6H A;  2PZD A;  4JOE A;  4HOP B;  2V1W A;  2O2T A;  2RCZ A;  2KBS A;  4Q3H A;  3HPM A;  1N7F A;  3PV5 A;  2EEG A;  1WH1 A;  2EGK A;  1X9Z A;  1VAE A;  2FCF A;  4JOP A;  1U38 A;  3PDV A;  4Z8J A;  1GQ5 A;  1IHJ A;  1P1E A;  2QT5 A;  2PDZ A;  1N7T A;  3CC0 A;  3R68 A;  4XHV A;  2L97 A;  4REY A;  3QJM A;  4NMV A;  2DB5 A;  3OTP A;  3SUZ A;  1WG6 A;  2M10 A;  3QIK A;  5G1E A;  2OPG A;  1M5Z A;  2OMJ A;  1TP3 A;  2AIN A;  2JIK A;  2EGN A;  1VCW A;  2M3M A;  1U3B A;  1XZ9 A; 
#chains in the Genus database with same CATH homology
 2V90 A;  1MC7 A;  3DJA A;  4YDP A;  1R6J A;  2G2L A;  4N6X A;  4P2A B;  1TQ3 A;  4NMQ A;  3TMH A;  4R2Z A;  2JIL A;  2M0Z A;  1WI4 A;  4PQW A;  3LNY A;  4JOR A;  2KA9 A;  1UM1 A;  1MFG A;  4O06 A;  1UIT A;  2EAQ A;  4Z33 A;  4YYX A;  2KOJ A;  3QJN A;  4AMH A;  5HEB A;  2Z9I A;  2KV8 A;  2BYG A;  1IU0 A;  5F3X A;  2EEI A;  5HF1 A;  2VWR A;  1BE9 A;  3K82 A;  4Q2O A;  3STJ A;  2LUI A;  2AWW A;  2EV8 A;  2VSV A;  1QAU A;  3GCO A;  5E6P B;  2DAZ A;  2MX6 A;  1X5Q A;  2EJY A;  1I92 A;  2LC7 A;  2EEH A;  5HED A;  1SOZ A;  4Q2P A;  1U39 A;  3SHW A;  3NGH A;  4MPA A;  2QKV A;  2WL7 A;  2F5Y A;  2GEF A;  2EEJ A;  5D13 A;  2CS5 A;  1X6D A;  2PKT A;  1L6O A;  3CS0 A;  3SHU A;  1BFE A;  2YT8 A;  4E35 A;  2E7K A;  5FHT A;  2IWO A;  3BPU A;  1IU2 A;  4KFV A;  1FCF A;  2KJD A;  2PA1 A;  2OS6 A;  2JXO A;  2KPL A;  1N6F A;  4JOF A;  3QE1 A;  1UEP A;  3B76 A;  3MH4 A;  1RGR A;  4UU5 A;  3RL7 A;  1KY9 A;  1VB7 A;  4K6Y A;  2ZPM A;  5H3J A;  3L4F D;  2EXG A;  2OSG A;  3GDU A;  4K76 A;  3ID4 A;  2R4H A;  2PKU A;  1X8S A;  4HOP A;  1GQ4 A;  3PV2 A;  2H3L A;  3QO6 A;  5HFB A;  5E1Y A;  3KHF A;  2IWN A;  1V5Q A;  3I18 A;  4NMT A;  1FC9 A;  3TSW A;  1P1D A;  2VSP A;  4H11 A;  3AXA A;  2QKU A;  2JOA A;  2F0A A;  2X7Z A;  2EDZ A;  3R0H A;  1T2M A;  3CBX A;  2K20 A;  1OBX A;  1QLC A;  4NMS A;  1V1T A;  1N6E A;  1Z86 A;  4NMP A;  2PNT A;  2DKR A;  3NFK A;  5HDY A;  1LCY A;  3KZD A;  1UEZ A;  3E17 A;  1YBO A;  3O46 A;  4NXQ A;  2K1Z A;  1PDR A;  1W9Q A;  1G9O A;  4K72 A;  1Z87 A;  2CSS A;  2KJP A;  2QG1 A;  2LA8 A;  2LOB A;  1Q3O A;  1UFX A;  1OBY A;  4IC6 A;  3VQG A;  3PV4 A;  2I0L A;  4GHN A;  4Q2N A;  1UHP A;  1TE0 A;  1WF8 A;  2UZC A;  5E11 A;  2H2C A;  5E22 A;  4OEP A;  2KRG A;  4FGM A;  4F8K A;  3TSV A;  2W4F A;  1K32 A;  2H3M A;  5HFF A;  2P3W A;  4NMR A;  3HVQ C;  2VRF A;  4KFW A;  4EDJ A;  2FNE A;  2EDP A;  3VQF A;  3GDS A;  1TP5 A;  2KG2 A;  1RZX A;  1ZOK A;  2G5M B;  1W9E A;  3CH8 A;  2FN5 A;  3SOE A;  1WFV A;  2I04 A;  4JJ0 A;  3NCV A;  2JIN A;  1WJL A;  2M0T A;  1VJ6 A;  3I4W A;  2IWQ A;  3RLE A;  2EHR A;  3ID1 A;  5HJ1 A;  4P0C A;  1KWA A;  5HET A;  1Q7X A;  2ZPL A;  4K75 A;  2AWX A;  4OAJ A;  3EGH C;  2KOH A;  2JSN A;  4Q2Q A;  2JRE A;  1NF3 C;  2EDV A;  1UJU A;  2KAW A;  1N99 A;  1RGW A;  3MH6 A;  2LC6 A;  2GZV A;  1UJV A;  2YUY A;  5HFC A;  3HPK A;  2L4S A;  3ID3 A;  2D92 A;  4WYU A;  3PDZ A;  3PS4 A;  4L8N A;  4K78 A;  2VPH A;  1X45 A;  5GLJ A;  1X5R A;  5F67 A;  5B6L A;  3JXT A;  1B8Q A;  2VZ5 A;  3DJ1 A;  1UEQ A;  1V5L A;  4JOG A;  4JOJ A;  3FY5 A;  3LNX A;  1UEW A;  2R3Y A;  2I0I A;  1V6B A;  1WFG A;  5E21 A;  2M0U A;  1WI2 A;  1I16 A;  5G1D A;  4GVD A;  2AWU A;  5EZ0 A;  1UF1 A;  2I4S A;  2I1N A;  3DOR A;  4NMO A;  2M0V A;  1KEF A;  3GJ9 A;  5I7Z A;  2I6V A;  3K1R A;  4WYT A;  1FC6 A;  2DC2 A;  1MFL A;  2Q3G A;  2KOM A;  2DLU A;  1WIF A;  4NNM A;  2CSJ A;  1N7E A;  2KJK A;  4E34 A;  5JXB A;  1WHD A;  5IL9 A;  1Y8T A;  2DMZ A;  2QBW A;  2D8I A;  3DIW A;  4JOK A;  5FB8 C;  1RY4 A;  5HEY A;  4JJ3 A;  2W7R A;  1Y7N A;  4JOH A;  1V62 A;  5GND A;  4UU6 A;  3ID2 A;  2KL1 A;  4Q6S A;  1QAV A;  3DJ3 A;  1QAV B;  2DJT A;  2D90 A;  4OEO A;  4E3B A;  3MH7 A;  2KPK A;  2FE5 A;  3QDO A;  3WKL A;  4GVC A;  3CBZ A;  1WHA A;  2OGP A;  1D5G A;  2RRM A;  1UJD A;  2JWE A;  1SOT A;  3ZRT A;  3NFL A;  2OCS A;  3GSL A;  3KDK A;  1GM1 A;  3GGE A;  3TSZ A;  5HFD A;  3KDG A;  1U37 A;  2YT7 A;  1OZI A;  1W9O A;  1X5N A;  3SFJ A;  4LMM A;  3K50 A;  2KQF A;  1N6D A;  2YUB A;  3I1E A;  2YTW A;  3KZE A;  5HF4 A;  1WF7 A;  5DTH A;  1ZUB A;  3RL8 A;  5A2P A;  4RI0 A;  5ILB A;  1OBZ A;  2IWP A;  3EGG C;  3GAB A;  2OQS A;  3CYY A;  2Z17 A;  3R69 A;  1NTE A;  5HFE A;  3OU0 A;  2HE2 A;  4NNL A;  2QKT A;  2KYL A;  4NXR A;  1UM7 A;  2MHO A;  2DM8 A;  3CBY A;  4NXP A;  4G69 A;  2ENO A;  1Q3P A;  4JL7 A;  2L4T A;  3GDV A;  2Q9V A;  3WKM A;  1FC7 A;  2REY A;  5B42 A;  2OZF A;  2HGA A;  2EGO A;  4FLN A;  1VA8 A;  2H2B A;  3O5N A;  2DLS A;  3QGL A;  5EYZ A;  2HE4 A;  3GCN A;  4Q6H A;  2PZD A;  4JOE A;  4HOP B;  2V1W A;  2O2T A;  2RCZ A;  2KBS A;  4Q3H A;  3HPM A;  1N7F A;  3PV5 A;  2EEG A;  1WH1 A;  2EGK A;  1X9Z A;  1VAE A;  2FCF A;  4JOP A;  1U38 A;  3PDV A;  4Z8J A;  1GQ5 A;  1IHJ A;  1P1E A;  2QT5 A;  2PDZ A;  1N7T A;  3CC0 A;  3R68 A;  4XHV A;  2L97 A;  4REY A;  3QJM A;  4NMV A;  2DB5 A;  3OTP A;  3SUZ A;  1WG6 A;  2M10 A;  3QIK A;  5G1E A;  2OPG A;  1M5Z A;  2OMJ A;  1TP3 A;  2AIN A;  2JIK A;  2EGN A;  1VCW A;  2M3M A;  1U3B A;  1XZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...