2ZPMA

Crystal structure analysis of pdz domain b
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
86
structure length
80
Chain Sequence
PVLENVQPNSAASAGLQAGDRIVVDGQPLTQWVTFVMLVRDNPGSLALEIERQGSPLSLTLIPESPGNGAIGFVGIEPVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of sigma E protease
publication title Crystal Structure analysis of PDZ-domain B
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 11
structure length 80
sequence length 86
ec nomenclature ec 3.4.24.-:
pdb deposition date 2008-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2zpmA00
1UFXA 1N7EA 2VZ5A 3O46A 1RZXA 2D8IA 1WG6A 2KA9A 1L6OA 2KAWA 3EGHC 2LC7A 1RGRA 1V5QA 2V90A 3SHUA 2PDZA 2EGOA 4Q6SA 3PV2A 1G9OA 5HFEA 1IU2A 3BPUA 2KPLA 2HGAA 4LMMA 2P3WA 2FE5A 2KRGA 1GQ4A 5G1DA 4NXPA 2QBWA 4JOFA 2DLUA 4E3BA 4HOPA 1U38A 5HETA 3WKMA 3PV4A 4FGMA 2QT5A 2OCSA 1N7TA 2KL1A 2VSPA 1B8QA 3CH8A 1V1TA 1P1EA 5FHTA 3VQFA 2DAZA 4JL7A 1VAEA 1SOZA 2UZCA 4WYUA 4Q6HA 5HEYA 4GVCA 5E22A 4NMSA 1QAUA 2R3YA 4JOKA 2EEHA 2MX6A 2IWNA 2E7KA 3DJ1A 1WF7A 3L4FD 3GDSA 2HE4A 4E34A 3MH4A 1UJUA 4NNMA 3CBXA 2CSSA 1VJ6A 2KJPA 1WFGA 3TMHA 1ZOKA 4NNLA 4F8KA 2EEJA 3I1EA 2OZFA 2QKTA 3PDZA 1MFGA 3QO6A 4YYXA 1V6BA 3CBZA 3STJA 1KWAA 4R2ZA 2KBSA 1TE0A 3I4WA 3ID4A 4NMOA 2JOAA 1X5NA 2KOMA 3SFJA 1TP5A 4NMRA 2EGNA 2H3LA 2EDZA 1WIFA 3FY5A 1N99A 1Q3OA 2DC2A 1VCWA 3GJ9A 2OS6A 5EYZA 1LCYA 3SUZA 2M0ZA 3NFLA 2R4HA 2Q9VA 5GNDA 3ID1A 2H2CA 5HFCA 2KG2A 2I6VA 1WI4A 1SOTA 1V5LA 2I0IA 5F3XA 1GM1A 1GQ5A 4Q2OA 5E1YA 5FB8C 1KEFA 1TP3A 1X5RA 2OSGA 2ZPLA 1D5GA 2DJTA 4NXRA 5D13A 4NMVA 2IWPA 2H2BA 1UEZA 5E21A 1PDRA 1WI2A 4P0CA 5DTHA 3NGHA 4JORA 3GDVA 2VWRA 2EEGA 2FCFA 3GSLA 4K75A 1FC6A 4NXQA 5GLJA 4Q3HA 5I7ZA 4AMHA 5H3JA 2KJKA 1UF1A 2JXOA 2M0UA 1N7FA 1T2MA 4G69A 1W9QA 4Q2NA 1OBYA 1BFEA 2EXGA 2D92A 3KHFA 1U3BA 2YT7A 5HFFA 2PNTA 3GDUA 1I16A 2DKRA 4MPAA 4UU6A 4NMQA 5E6PB 2I0LA 4K78A 2DM8A 1XZ9A 2KOJA 3R68A 1RY4A 1OBXA 2G5MB 2ZPMA 1WHDA 2KPKA 3LNXA 2EAQA 3MH6A 2G2LA 2YUBA 1WF8A 3QE1A 3VQGA 2YTWA 5HFDA 2PKUA 4O06A 1Z86A 4XHVA 4H11A 3TSVA 2LA8A 4OEOA 1FCFA 2PZDA 5JXBA 4JOHA 1N6EA 3DJAA 3K50A 2JIKA 4JOPA 3DIWA 1UM7A 2M0VA 4UU5A 2LOBA 2D90A 2Q3GA 5HDYA 3DJ3A 2I04A 2L4TA 4Q2PA 1UJVA 1UJDA 3TSZA 4E35A 4PQWA 1TQ3A 4RI0A 2AWUA 1VB7A 2AWXA 3QIKA 5HF1A 1N6FA 1I92A 1X8SA 2VSVA 1R6JA 1K32A 2IWOA 2QG1A 2REYA 3CBYA 2DB5A 1MFLA 3MH7A 4REYA 1FC9A 2VRFA 1UHPA 3SOEA 3QJMA 2YUYA 2MHOA 1M5ZA 2OGPA 2PA1A 3OU0A 2KOHA 2JILA 2PKTA 3HPMA 2KQFA 2KYLA 4Q2QA 2OMJA 5A2PA 2M3MA 1WHAA 2OPGA 1OBZA 2GZVA 3DORA 1W9OA 4P2AB 1NF3C 1UEQA 5HFBA 3SHWA 2BYGA 3CC0A 3JXTA 3RL7A 3B76A 2ENOA 2V1WA 5HF4A 2EEIA 2YT8A 2K20A 2EJYA 1NTEA 2RRMA 1OZIA 2JREA 3OTPA 5F67A 3ID3A 2F5YA 2KV8A 1U39A 1VA8A 1YBOA 4OEPA 3QJNA 2QKVA 5EZ0A 2OQSA 2W4FA 3ZRTA 1X45A 3I18A 4Z8JA 3WKLA 1X6DA 3LNYA 4NMTA 3GCOA 2QKUA 1X5QA 3K82A 4JOGA 3R69A 4JOJA 3AXAA 1V62A 3KZDA 3HPKA 2X7ZA 2K1ZA 3PDVA 4L8NA 4GHNA 2O2TA 2KJDA 1QLCA 2RCZA 3R0HA 2DMZA 4IC6A 1UEWA 4EDJA 3E17A 1WJLA 2EDPA 2FNEA 3PV5A 2AWWA 2M10A 4JOEA 1P1DA 1Y7NA 4K76A 1N6DA 1UM1A 1W9EA 2Z9IA 2JWEA 3K1RA 4YDPA 4HOPB 3RLEA 4OAJA 2HE2A 1RGWA 1IHJA 4KFWA 1U37A 4N6XA 1WFVA 2CSJA 2EV8A 2LC6A 1UEPA 4NMPA 5HEBA 1QAVA 1Y8TA 2EDVA 5E11A 2I1NA 1IU0A 1Q7XA 2VPHA 2L4SA 2AINA 1WH1A 2JINA 2EHRA 5G1EA 1BE9A 1QAVB 1UITA 2I4SA 2DLSA 3EGGC 2M0TA 3NFKA 4GVDA 4WYTA 2H3MA 3GCNA 3ID2A 4Z33A 3QDOA 2FN5A 2F0AA 5HJ1A 1KY9A 5HEDA 3O5NA 3CS0A 2L97A 5B6LA 1Q3PA 2Z17A 4K72A 4KFVA 2WL7A 2LUIA 3RL8A 3TSWA 3QGLA 3KZEA 1FC7A 2EGKA 3CYYA 2IWQA 1Z87A 1MC7A 1ZUBA 4K6YA 3PS4A 3HVQC 2CS5A 3GGEA 2W7RA
chains in the Genus database with same CATH superfamily
1UFXA 1N7EA 2VZ5A 3O46A 1RZXA 2D8IA 1WG6A 2KA9A 1L6OA 2KAWA 3EGHC 2LC7A 1RGRA 1V5QA 2V90A 3SHUA 2PDZA 2EGOA 4Q6SA 4FLNA 3PV2A 1G9OA 5HFEA 1IU2A 3BPUA 2KPLA 3KDGA 2HGAA 4LMMA 2P3WA 2FE5A 2KRGA 1GQ4A 5G1DA 4NXPA 2QBWA 4JOFA 2DLUA 4E3BA 4HOPA 1U38A 5HETA 3WKMA 3PV4A 4FGMA 2QT5A 2OCSA 1N7TA 2KL1A 2VSPA 1B8QA 3CH8A 1V1TA 1P1EA 5FHTA 3VQFA 2DAZA 4JL7A 1VAEA 1SOZA 2UZCA 4WYUA 4Q6HA 5HEYA 4GVCA 5E22A 4NMSA 1QAUA 2R3YA 4JOKA 2EEHA 2MX6A 2IWNA 2E7KA 3DJ1A 1WF7A 3L4FD 3GDSA 2HE4A 4E34A 3MH4A 1UJUA 4NNMA 3CBXA 2CSSA 1VJ6A 2KJPA 1WFGA 3TMHA 1ZOKA 4NNLA 4F8KA 2EEJA 3I1EA 2OZFA 2QKTA 3PDZA 1MFGA 3QO6A 4YYXA 1V6BA 3CBZA 3STJA 1KWAA 4R2ZA 4JJ3A 2KBSA 1TE0A 3I4WA 3ID4A 4NMOA 2JOAA 1X5NA 2KOMA 3SFJA 1TP5A 4NMRA 2EGNA 2H3LA 2EDZA 1WIFA 3FY5A 1N99A 1Q3OA 2DC2A 1VCWA 3GJ9A 2OS6A 5EYZA 1LCYA 3SUZA 2M0ZA 3NFLA 2R4HA 2Q9VA 5GNDA 3ID1A 2H2CA 5HFCA 2KG2A 2I6VA 1WI4A 1SOTA 1V5LA 2I0IA 5F3XA 1GM1A 1GQ5A 4Q2OA 5E1YA 5FB8C 1KEFA 1TP3A 1X5RA 2OSGA 2ZPLA 1D5GA 2DJTA 4NXRA 5D13A 4NMVA 2IWPA 2H2BA 1UEZA 5E21A 1PDRA 1WI2A 4P0CA 5DTHA 3NGHA 4JORA 3GDVA 2VWRA 2EEGA 2FCFA 3GSLA 4K75A 1FC6A 4NXQA 5GLJA 4Q3HA 5I7ZA 4AMHA 5H3JA 2KJKA 2JSNA 1UF1A 2JXOA 2M0UA 1N7FA 1T2MA 4G69A 1W9QA 4Q2NA 1OBYA 1BFEA 2EXGA 2D92A 3KHFA 1U3BA 2YT7A 5HFFA 2PNTA 3GDUA 1I16A 2DKRA 4MPAA 4UU6A 4NMQA 5E6PB 2I0LA 4K78A 2DM8A 1XZ9A 2KOJA 3R68A 1RY4A 1OBXA 1X9ZA 2G5MB 2ZPMA 1WHDA 2KPKA 3LNXA 2EAQA 3MH6A 2G2LA 2YUBA 1WF8A 3QE1A 3VQGA 2YTWA 5HFDA 2PKUA 4O06A 1Z86A 4XHVA 4H11A 3TSVA 2LA8A 4OEOA 1FCFA 2PZDA 5JXBA 4JOHA 1N6EA 3DJAA 3K50A 2JIKA 4JOPA 3DIWA 1UM7A 2M0VA 4UU5A 2LOBA 2D90A 2Q3GA 5HDYA 3DJ3A 5IL9A 2I04A 2L4TA 4Q2PA 1UJVA 1UJDA 3TSZA 4E35A 4PQWA 1TQ3A 4RI0A 2AWUA 1VB7A 2AWXA 3QIKA 5HF1A 1N6FA 1I92A 1X8SA 2VSVA 1R6JA 1K32A 2IWOA 2QG1A 2REYA 3CBYA 2DB5A 1MFLA 3MH7A 4REYA 1FC9A 2VRFA 1UHPA 3SOEA 3QJMA 2YUYA 2MHOA 1M5ZA 2OGPA 2PA1A 3OU0A 2KOHA 2JILA 2PKTA 3HPMA 2KQFA 2KYLA 4Q2QA 2OMJA 5A2PA 2M3MA 1WHAA 2OPGA 1OBZA 2GZVA 3DORA 1W9OA 4P2AB 1NF3C 1UEQA 5HFBA 3SHWA 2BYGA 3CC0A 3JXTA 3RL7A 3B76A 2ENOA 2V1WA 5HF4A 2EEIA 2YT8A 2K20A 2EJYA 1NTEA 2RRMA 1OZIA 2JREA 3OTPA 5F67A 3ID3A 2F5YA 2KV8A 1U39A 1VA8A 1YBOA 4OEPA 3QJNA 2QKVA 5EZ0A 2OQSA 2W4FA 3ZRTA 1X45A 3I18A 4Z8JA 3WKLA 1X6DA 3LNYA 4NMTA 3GCOA 2QKUA 1X5QA 3K82A 4JOGA 3R69A 4JOJA 3AXAA 1V62A 3KZDA 3HPKA 2X7ZA 3NCVA 2K1ZA 3PDVA 4L8NA 4GHNA 2O2TA 2KJDA 1QLCA 2RCZA 3R0HA 2DMZA 4IC6A 1UEWA 4EDJA 3E17A 1WJLA 2EDPA 2FNEA 3PV5A 3GABA 5B42A 2AWWA 2M10A 3KDKA 4JOEA 1P1DA 1Y7NA 4K76A 1N6DA 1UM1A 1W9EA 2Z9IA 2JWEA 3K1RA 4YDPA 4HOPB 3RLEA 4OAJA 2HE2A 1RGWA 1IHJA 4KFWA 5ILBA 1U37A 4N6XA 1WFVA 2CSJA 2EV8A 2LC6A 1UEPA 4NMPA 5HEBA 1QAVA 1Y8TA 2GEFA 2EDVA 5E11A 2I1NA 1IU0A 1Q7XA 2VPHA 2L4SA 2AINA 1WH1A 2JINA 2EHRA 5G1EA 1BE9A 1QAVB 1UITA 2I4SA 2DLSA 3EGGC 2M0TA 3NFKA 4GVDA 4WYTA 2H3MA 3GCNA 3ID2A 4Z33A 3QDOA 2FN5A 4JJ0A 2F0AA 5HJ1A 1KY9A 5HEDA 3O5NA 3CS0A 2L97A 5B6LA 1Q3PA 2Z17A 4K72A 4KFVA 2WL7A 2LUIA 3RL8A 3TSWA 3QGLA 3KZEA 1FC7A 2EGKA 3CYYA 2IWQA 1Z87A 1MC7A 1ZUBA 4K6YA 3PS4A 3HVQC 2CS5A 3GGEA 2W7RA
chains in the Genus database with same CATH topology
1UFXA 1N7EA 2VZ5A 3O46A 1RZXA 2D8IA 1WG6A 2KA9A 1L6OA 2KAWA 3EGHC 2LC7A 1RGRA 1V5QA 2V90A 3SHUA 2PDZA 2EGOA 4Q6SA 4FLNA 3PV2A 1G9OA 5HFEA 1IU2A 3BPUA 2KPLA 3KDGA 2HGAA 4LMMA 2P3WA 2FE5A 2KRGA 1GQ4A 5G1DA 4NXPA 2QBWA 4JOFA 2DLUA 4E3BA 4HOPA 1U38A 5HETA 3WKMA 3PV4A 4FGMA 2QT5A 2OCSA 1N7TA 2KL1A 2VSPA 1B8QA 3CH8A 1V1TA 1P1EA 5FHTA 3VQFA 2DAZA 4JL7A 1VAEA 1SOZA 2UZCA 4WYUA 4Q6HA 5HEYA 4GVCA 5E22A 4NMSA 1QAUA 2R3YA 4JOKA 2EEHA 2MX6A 2IWNA 2E7KA 3DJ1A 1WF7A 3L4FD 3GDSA 2HE4A 4E34A 3MH4A 1UJUA 4NNMA 3CBXA 2CSSA 1VJ6A 2KJPA 1WFGA 3TMHA 1ZOKA 4NNLA 4F8KA 2EEJA 3I1EA 2OZFA 2QKTA 3PDZA 1MFGA 3QO6A 4YYXA 1V6BA 3CBZA 3STJA 1KWAA 4R2ZA 4JJ3A 2KBSA 1TE0A 3I4WA 3ID4A 4NMOA 2JOAA 1X5NA 2KOMA 3SFJA 1TP5A 4NMRA 2EGNA 2H3LA 2EDZA 1WIFA 3FY5A 1N99A 1Q3OA 2DC2A 1VCWA 3GJ9A 2OS6A 5EYZA 1LCYA 3SUZA 2M0ZA 3NFLA 2R4HA 2Q9VA 5GNDA 3ID1A 2H2CA 5HFCA 2KG2A 2I6VA 1WI4A 1SOTA 1V5LA 2I0IA 5F3XA 1GM1A 1GQ5A 4Q2OA 5E1YA 5FB8C 1KEFA 1TP3A 1X5RA 2OSGA 2ZPLA 1D5GA 2DJTA 4NXRA 5D13A 4NMVA 2IWPA 2H2BA 1UEZA 5E21A 1PDRA 1WI2A 4P0CA 5DTHA 3NGHA 4JORA 3GDVA 2VWRA 2EEGA 2FCFA 3GSLA 4K75A 1FC6A 4NXQA 5GLJA 4Q3HA 5I7ZA 4AMHA 5H3JA 2KJKA 2JSNA 1UF1A 2JXOA 2M0UA 1N7FA 1T2MA 4G69A 1W9QA 4Q2NA 1OBYA 1BFEA 2EXGA 2D92A 3KHFA 1U3BA 2YT7A 5HFFA 2PNTA 3GDUA 1I16A 2DKRA 4MPAA 4UU6A 4NMQA 5E6PB 2I0LA 4K78A 2DM8A 1XZ9A 2KOJA 3R68A 1RY4A 1OBXA 1X9ZA 2G5MB 2ZPMA 1WHDA 2KPKA 3LNXA 2EAQA 3MH6A 2G2LA 2YUBA 1WF8A 3QE1A 3VQGA 2YTWA 5HFDA 2PKUA 4O06A 1Z86A 4XHVA 4H11A 3TSVA 2LA8A 4OEOA 1FCFA 2PZDA 5JXBA 4JOHA 1N6EA 3DJAA 3K50A 2JIKA 4JOPA 3DIWA 1UM7A 2M0VA 4UU5A 2LOBA 2D90A 2Q3GA 5HDYA 3DJ3A 5IL9A 2I04A 2L4TA 4Q2PA 1UJVA 1UJDA 3TSZA 4E35A 4PQWA 1TQ3A 4RI0A 2AWUA 1VB7A 2AWXA 3QIKA 5HF1A 1N6FA 1I92A 1X8SA 2VSVA 1R6JA 1K32A 2IWOA 2QG1A 2REYA 3CBYA 2DB5A 1MFLA 3MH7A 4REYA 1FC9A 2VRFA 1UHPA 3SOEA 3QJMA 2YUYA 2MHOA 1M5ZA 2OGPA 2PA1A 3OU0A 2KOHA 2JILA 2PKTA 3HPMA 2KQFA 2KYLA 4Q2QA 2OMJA 5A2PA 2M3MA 1WHAA 2OPGA 1OBZA 2GZVA 3DORA 1W9OA 4P2AB 1NF3C 1UEQA 5HFBA 3SHWA 2BYGA 3CC0A 3JXTA 3RL7A 3B76A 2ENOA 2V1WA 5HF4A 2EEIA 2YT8A 2K20A 2EJYA 1NTEA 2RRMA 1OZIA 2JREA 3OTPA 5F67A 3ID3A 2F5YA 2KV8A 1U39A 1VA8A 1YBOA 4OEPA 3QJNA 2QKVA 5EZ0A 2OQSA 2W4FA 3ZRTA 1X45A 3I18A 4Z8JA 3WKLA 1X6DA 3LNYA 4NMTA 3GCOA 2QKUA 1X5QA 3K82A 4JOGA 3R69A 4JOJA 3AXAA 1V62A 3KZDA 3HPKA 2X7ZA 3NCVA 2K1ZA 3PDVA 4L8NA 4GHNA 2O2TA 2KJDA 1QLCA 2RCZA 3R0HA 2DMZA 4IC6A 1UEWA 4EDJA 3E17A 1WJLA 2EDPA 2FNEA 3PV5A 3GABA 5B42A 2AWWA 2M10A 3KDKA 4JOEA 1P1DA 1Y7NA 4K76A 1N6DA 1UM1A 1W9EA 2Z9IA 2JWEA 3K1RA 4YDPA 4HOPB 3RLEA 4OAJA 2HE2A 1RGWA 1IHJA 4KFWA 5ILBA 1U37A 4N6XA 1WFVA 2CSJA 2EV8A 2LC6A 1UEPA 4NMPA 5HEBA 1QAVA 1Y8TA 2GEFA 2EDVA 5E11A 2I1NA 1IU0A 1Q7XA 2VPHA 2L4SA 2AINA 1WH1A 2JINA 2EHRA 5G1EA 1BE9A 1QAVB 1UITA 2I4SA 2DLSA 3EGGC 2M0TA 3NFKA 4GVDA 4WYTA 2H3MA 3GCNA 3ID2A 4Z33A 3QDOA 2FN5A 4JJ0A 2F0AA 5HJ1A 1KY9A 5HEDA 3O5NA 3CS0A 2L97A 5B6LA 1Q3PA 2Z17A 4K72A 4KFVA 2WL7A 2LUIA 3RL8A 3TSWA 3QGLA 3KZEA 1FC7A 2EGKA 3CYYA 2IWQA 1Z87A 1MC7A 1ZUBA 4K6YA 3PS4A 3HVQC 2CS5A 3GGEA 2W7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UFX A;  1N7E A;  2VZ5 A;  3O46 A;  1RZX A;  2D8I A;  1WG6 A;  2KA9 A;  1L6O A;  2KAW A;  3EGH C;  2LC7 A;  1RGR A;  1V5Q A;  2V90 A;  3SHU A;  2PDZ A;  2EGO A;  4Q6S A;  3PV2 A;  1G9O A;  5HFE A;  1IU2 A;  3BPU A;  2KPL A;  2HGA A;  4LMM A;  2P3W A;  2FE5 A;  2KRG A;  1GQ4 A;  5G1D A;  4NXP A;  2QBW A;  4JOF A;  2DLU A;  4E3B A;  4HOP A;  1U38 A;  5HET A;  3WKM A;  3PV4 A;  4FGM A;  2QT5 A;  2OCS A;  1N7T A;  2KL1 A;  2VSP A;  1B8Q A;  3CH8 A;  1V1T A;  1P1E A;  5FHT A;  3VQF A;  2DAZ A;  4JL7 A;  1VAE A;  1SOZ A;  2UZC A;  4WYU A;  4Q6H A;  5HEY A;  4GVC A;  5E22 A;  4NMS A;  1QAU A;  2R3Y A;  4JOK A;  2EEH A;  2MX6 A;  2IWN A;  2E7K A;  3DJ1 A;  1WF7 A;  3L4F D;  3GDS A;  2HE4 A;  4E34 A;  3MH4 A;  1UJU A;  4NNM A;  3CBX A;  2CSS A;  1VJ6 A;  2KJP A;  1WFG A;  3TMH A;  1ZOK A;  4NNL A;  4F8K A;  2EEJ A;  3I1E A;  2OZF A;  2QKT A;  3PDZ A;  1MFG A;  3QO6 A;  4YYX A;  1V6B A;  3CBZ A;  3STJ A;  1KWA A;  4R2Z A;  2KBS A;  1TE0 A;  3I4W A;  3ID4 A;  4NMO A;  2JOA A;  1X5N A;  2KOM A;  3SFJ A;  1TP5 A;  4NMR A;  2EGN A;  2H3L A;  2EDZ A;  1WIF A;  3FY5 A;  1N99 A;  1Q3O A;  2DC2 A;  1VCW A;  3GJ9 A;  2OS6 A;  5EYZ A;  1LCY A;  3SUZ A;  2M0Z A;  3NFL A;  2R4H A;  2Q9V A;  5GND A;  3ID1 A;  2H2C A;  5HFC A;  2KG2 A;  2I6V A;  1WI4 A;  1SOT A;  1V5L A;  2I0I A;  5F3X A;  1GM1 A;  1GQ5 A;  4Q2O A;  5E1Y A;  5FB8 C;  1KEF A;  1TP3 A;  1X5R A;  2OSG A;  2ZPL A;  1D5G A;  2DJT A;  4NXR A;  5D13 A;  4NMV A;  2IWP A;  2H2B A;  1UEZ A;  5E21 A;  1PDR A;  1WI2 A;  4P0C A;  5DTH A;  3NGH A;  4JOR A;  3GDV A;  2VWR A;  2EEG A;  2FCF A;  3GSL A;  4K75 A;  1FC6 A;  4NXQ A;  5GLJ A;  4Q3H A;  5I7Z A;  4AMH A;  5H3J A;  2KJK A;  1UF1 A;  2JXO A;  2M0U A;  1N7F A;  1T2M A;  4G69 A;  1W9Q A;  4Q2N A;  1OBY A;  1BFE A;  2EXG A;  2D92 A;  3KHF A;  1U3B A;  2YT7 A;  5HFF A;  2PNT A;  3GDU A;  1I16 A;  2DKR A;  4MPA A;  4UU6 A;  4NMQ A;  5E6P B;  2I0L A;  4K78 A;  2DM8 A;  1XZ9 A;  2KOJ A;  3R68 A;  1RY4 A;  1OBX A;  2G5M B;  2ZPM A;  1WHD A;  2KPK A;  3LNX A;  2EAQ A;  3MH6 A;  2G2L A;  2YUB A;  1WF8 A;  3QE1 A;  3VQG A;  2YTW A;  5HFD A;  2PKU A;  4O06 A;  1Z86 A;  4XHV A;  4H11 A;  3TSV A;  2LA8 A;  4OEO A;  1FCF A;  2PZD A;  5JXB A;  4JOH A;  1N6E A;  3DJA A;  3K50 A;  2JIK A;  4JOP A;  3DIW A;  1UM7 A;  2M0V A;  4UU5 A;  2LOB A;  2D90 A;  2Q3G A;  5HDY A;  3DJ3 A;  2I04 A;  2L4T A;  4Q2P A;  1UJV A;  1UJD A;  3TSZ A;  4E35 A;  4PQW A;  1TQ3 A;  4RI0 A;  2AWU A;  1VB7 A;  2AWX A;  3QIK A;  5HF1 A;  1N6F A;  1I92 A;  1X8S A;  2VSV A;  1R6J A;  1K32 A;  2IWO A;  2QG1 A;  2REY A;  3CBY A;  2DB5 A;  1MFL A;  3MH7 A;  4REY A;  1FC9 A;  2VRF A;  1UHP A;  3SOE A;  3QJM A;  2YUY A;  2MHO A;  1M5Z A;  2OGP A;  2PA1 A;  3OU0 A;  2KOH A;  2JIL A;  2PKT A;  3HPM A;  2KQF A;  2KYL A;  4Q2Q A;  2OMJ A;  5A2P A;  2M3M A;  1WHA A;  2OPG A;  1OBZ A;  2GZV A;  3DOR A;  1W9O A;  4P2A B;  1NF3 C;  1UEQ A;  5HFB A;  3SHW A;  2BYG A;  3CC0 A;  3JXT A;  3RL7 A;  3B76 A;  2ENO A;  2V1W A;  5HF4 A;  2EEI A;  2YT8 A;  2K20 A;  2EJY A;  1NTE A;  2RRM A;  1OZI A;  2JRE A;  3OTP A;  5F67 A;  3ID3 A;  2F5Y A;  2KV8 A;  1U39 A;  1VA8 A;  1YBO A;  4OEP A;  3QJN A;  2QKV A;  5EZ0 A;  2OQS A;  2W4F A;  3ZRT A;  1X45 A;  3I18 A;  4Z8J A;  3WKL A;  1X6D A;  3LNY A;  4NMT A;  3GCO A;  2QKU A;  1X5Q A;  3K82 A;  4JOG A;  3R69 A;  4JOJ A;  3AXA A;  1V62 A;  3KZD A;  3HPK A;  2X7Z A;  2K1Z A;  3PDV A;  4L8N A;  4GHN A;  2O2T A;  2KJD A;  1QLC A;  2RCZ A;  3R0H A;  2DMZ A;  4IC6 A;  1UEW A;  4EDJ A;  3E17 A;  1WJL A;  2EDP A;  2FNE A;  3PV5 A;  2AWW A;  2M10 A;  4JOE A;  1P1D A;  1Y7N A;  4K76 A;  1N6D A;  1UM1 A;  1W9E A;  2Z9I A;  2JWE A;  3K1R A;  4YDP A;  4HOP B;  3RLE A;  4OAJ A;  2HE2 A;  1RGW A;  1IHJ A;  4KFW A;  1U37 A;  4N6X A;  1WFV A;  2CSJ A;  2EV8 A;  2LC6 A;  1UEP A;  4NMP A;  5HEB A;  1QAV A;  1Y8T A;  2EDV A;  5E11 A;  2I1N A;  1IU0 A;  1Q7X A;  2VPH A;  2L4S A;  2AIN A;  1WH1 A;  2JIN A;  2EHR A;  5G1E A;  1BE9 A;  1QAV B;  1UIT A;  2I4S A;  2DLS A;  3EGG C;  2M0T A;  3NFK A;  4GVD A;  4WYT A;  2H3M A;  3GCN A;  3ID2 A;  4Z33 A;  3QDO A;  2FN5 A;  2F0A A;  5HJ1 A;  1KY9 A;  5HED A;  3O5N A;  3CS0 A;  2L97 A;  5B6L A;  1Q3P A;  2Z17 A;  4K72 A;  4KFV A;  2WL7 A;  2LUI A;  3RL8 A;  3TSW A;  3QGL A;  3KZE A;  1FC7 A;  2EGK A;  3CYY A;  2IWQ A;  1Z87 A;  1MC7 A;  1ZUB A;  4K6Y A;  3PS4 A;  3HVQ C;  2CS5 A;  3GGE A;  2W7R A; 
#chains in the Genus database with same CATH topology
 1UFX A;  1N7E A;  2VZ5 A;  3O46 A;  1RZX A;  2D8I A;  1WG6 A;  2KA9 A;  1L6O A;  2KAW A;  3EGH C;  2LC7 A;  1RGR A;  1V5Q A;  2V90 A;  3SHU A;  2PDZ A;  2EGO A;  4Q6S A;  4FLN A;  3PV2 A;  1G9O A;  5HFE A;  1IU2 A;  3BPU A;  2KPL A;  3KDG A;  2HGA A;  4LMM A;  2P3W A;  2FE5 A;  2KRG A;  1GQ4 A;  5G1D A;  4NXP A;  2QBW A;  4JOF A;  2DLU A;  4E3B A;  4HOP A;  1U38 A;  5HET A;  3WKM A;  3PV4 A;  4FGM A;  2QT5 A;  2OCS A;  1N7T A;  2KL1 A;  2VSP A;  1B8Q A;  3CH8 A;  1V1T A;  1P1E A;  5FHT A;  3VQF A;  2DAZ A;  4JL7 A;  1VAE A;  1SOZ A;  2UZC A;  4WYU A;  4Q6H A;  5HEY A;  4GVC A;  5E22 A;  4NMS A;  1QAU A;  2R3Y A;  4JOK A;  2EEH A;  2MX6 A;  2IWN A;  2E7K A;  3DJ1 A;  1WF7 A;  3L4F D;  3GDS A;  2HE4 A;  4E34 A;  3MH4 A;  1UJU A;  4NNM A;  3CBX A;  2CSS A;  1VJ6 A;  2KJP A;  1WFG A;  3TMH A;  1ZOK A;  4NNL A;  4F8K A;  2EEJ A;  3I1E A;  2OZF A;  2QKT A;  3PDZ A;  1MFG A;  3QO6 A;  4YYX A;  1V6B A;  3CBZ A;  3STJ A;  1KWA A;  4R2Z A;  4JJ3 A;  2KBS A;  1TE0 A;  3I4W A;  3ID4 A;  4NMO A;  2JOA A;  1X5N A;  2KOM A;  3SFJ A;  1TP5 A;  4NMR A;  2EGN A;  2H3L A;  2EDZ A;  1WIF A;  3FY5 A;  1N99 A;  1Q3O A;  2DC2 A;  1VCW A;  3GJ9 A;  2OS6 A;  5EYZ A;  1LCY A;  3SUZ A;  2M0Z A;  3NFL A;  2R4H A;  2Q9V A;  5GND A;  3ID1 A;  2H2C A;  5HFC A;  2KG2 A;  2I6V A;  1WI4 A;  1SOT A;  1V5L A;  2I0I A;  5F3X A;  1GM1 A;  1GQ5 A;  4Q2O A;  5E1Y A;  5FB8 C;  1KEF A;  1TP3 A;  1X5R A;  2OSG A;  2ZPL A;  1D5G A;  2DJT A;  4NXR A;  5D13 A;  4NMV A;  2IWP A;  2H2B A;  1UEZ A;  5E21 A;  1PDR A;  1WI2 A;  4P0C A;  5DTH A;  3NGH A;  4JOR A;  3GDV A;  2VWR A;  2EEG A;  2FCF A;  3GSL A;  4K75 A;  1FC6 A;  4NXQ A;  5GLJ A;  4Q3H A;  5I7Z A;  4AMH A;  5H3J A;  2KJK A;  2JSN A;  1UF1 A;  2JXO A;  2M0U A;  1N7F A;  1T2M A;  4G69 A;  1W9Q A;  4Q2N A;  1OBY A;  1BFE A;  2EXG A;  2D92 A;  3KHF A;  1U3B A;  2YT7 A;  5HFF A;  2PNT A;  3GDU A;  1I16 A;  2DKR A;  4MPA A;  4UU6 A;  4NMQ A;  5E6P B;  2I0L A;  4K78 A;  2DM8 A;  1XZ9 A;  2KOJ A;  3R68 A;  1RY4 A;  1OBX A;  1X9Z A;  2G5M B;  2ZPM A;  1WHD A;  2KPK A;  3LNX A;  2EAQ A;  3MH6 A;  2G2L A;  2YUB A;  1WF8 A;  3QE1 A;  3VQG A;  2YTW A;  5HFD A;  2PKU A;  4O06 A;  1Z86 A;  4XHV A;  4H11 A;  3TSV A;  2LA8 A;  4OEO A;  1FCF A;  2PZD A;  5JXB A;  4JOH A;  1N6E A;  3DJA A;  3K50 A;  2JIK A;  4JOP A;  3DIW A;  1UM7 A;  2M0V A;  4UU5 A;  2LOB A;  2D90 A;  2Q3G A;  5HDY A;  3DJ3 A;  5IL9 A;  2I04 A;  2L4T A;  4Q2P A;  1UJV A;  1UJD A;  3TSZ A;  4E35 A;  4PQW A;  1TQ3 A;  4RI0 A;  2AWU A;  1VB7 A;  2AWX A;  3QIK A;  5HF1 A;  1N6F A;  1I92 A;  1X8S A;  2VSV A;  1R6J A;  1K32 A;  2IWO A;  2QG1 A;  2REY A;  3CBY A;  2DB5 A;  1MFL A;  3MH7 A;  4REY A;  1FC9 A;  2VRF A;  1UHP A;  3SOE A;  3QJM A;  2YUY A;  2MHO A;  1M5Z A;  2OGP A;  2PA1 A;  3OU0 A;  2KOH A;  2JIL A;  2PKT A;  3HPM A;  2KQF A;  2KYL A;  4Q2Q A;  2OMJ A;  5A2P A;  2M3M A;  1WHA A;  2OPG A;  1OBZ A;  2GZV A;  3DOR A;  1W9O A;  4P2A B;  1NF3 C;  1UEQ A;  5HFB A;  3SHW A;  2BYG A;  3CC0 A;  3JXT A;  3RL7 A;  3B76 A;  2ENO A;  2V1W A;  5HF4 A;  2EEI A;  2YT8 A;  2K20 A;  2EJY A;  1NTE A;  2RRM A;  1OZI A;  2JRE A;  3OTP A;  5F67 A;  3ID3 A;  2F5Y A;  2KV8 A;  1U39 A;  1VA8 A;  1YBO A;  4OEP A;  3QJN A;  2QKV A;  5EZ0 A;  2OQS A;  2W4F A;  3ZRT A;  1X45 A;  3I18 A;  4Z8J A;  3WKL A;  1X6D A;  3LNY A;  4NMT A;  3GCO A;  2QKU A;  1X5Q A;  3K82 A;  4JOG A;  3R69 A;  4JOJ A;  3AXA A;  1V62 A;  3KZD A;  3HPK A;  2X7Z A;  3NCV A;  2K1Z A;  3PDV A;  4L8N A;  4GHN A;  2O2T A;  2KJD A;  1QLC A;  2RCZ A;  3R0H A;  2DMZ A;  4IC6 A;  1UEW A;  4EDJ A;  3E17 A;  1WJL A;  2EDP A;  2FNE A;  3PV5 A;  3GAB A;  5B42 A;  2AWW A;  2M10 A;  3KDK A;  4JOE A;  1P1D A;  1Y7N A;  4K76 A;  1N6D A;  1UM1 A;  1W9E A;  2Z9I A;  2JWE A;  3K1R A;  4YDP A;  4HOP B;  3RLE A;  4OAJ A;  2HE2 A;  1RGW A;  1IHJ A;  4KFW A;  5ILB A;  1U37 A;  4N6X A;  1WFV A;  2CSJ A;  2EV8 A;  2LC6 A;  1UEP A;  4NMP A;  5HEB A;  1QAV A;  1Y8T A;  2GEF A;  2EDV A;  5E11 A;  2I1N A;  1IU0 A;  1Q7X A;  2VPH A;  2L4S A;  2AIN A;  1WH1 A;  2JIN A;  2EHR A;  5G1E A;  1BE9 A;  1QAV B;  1UIT A;  2I4S A;  2DLS A;  3EGG C;  2M0T A;  3NFK A;  4GVD A;  4WYT A;  2H3M A;  3GCN A;  3ID2 A;  4Z33 A;  3QDO A;  2FN5 A;  4JJ0 A;  2F0A A;  5HJ1 A;  1KY9 A;  5HED A;  3O5N A;  3CS0 A;  2L97 A;  5B6L A;  1Q3P A;  2Z17 A;  4K72 A;  4KFV A;  2WL7 A;  2LUI A;  3RL8 A;  3TSW A;  3QGL A;  3KZE A;  1FC7 A;  2EGK A;  3CYY A;  2IWQ A;  1Z87 A;  1MC7 A;  1ZUB A;  4K6Y A;  3PS4 A;  3HVQ C;  2CS5 A;  3GGE A;  2W7R A; 
#chains in the Genus database with same CATH homology
 1UFX A;  1N7E A;  2VZ5 A;  3O46 A;  1RZX A;  2D8I A;  1WG6 A;  2KA9 A;  1L6O A;  2KAW A;  3EGH C;  2LC7 A;  1RGR A;  1V5Q A;  2V90 A;  3SHU A;  2PDZ A;  2EGO A;  4Q6S A;  4FLN A;  3PV2 A;  1G9O A;  5HFE A;  1IU2 A;  3BPU A;  2KPL A;  3KDG A;  2HGA A;  4LMM A;  2P3W A;  2FE5 A;  2KRG A;  1GQ4 A;  5G1D A;  4NXP A;  2QBW A;  4JOF A;  2DLU A;  4E3B A;  4HOP A;  1U38 A;  5HET A;  3WKM A;  3PV4 A;  4FGM A;  2QT5 A;  2OCS A;  1N7T A;  2KL1 A;  2VSP A;  1B8Q A;  3CH8 A;  1V1T A;  1P1E A;  5FHT A;  3VQF A;  2DAZ A;  4JL7 A;  1VAE A;  1SOZ A;  2UZC A;  4WYU A;  4Q6H A;  5HEY A;  4GVC A;  5E22 A;  4NMS A;  1QAU A;  2R3Y A;  4JOK A;  2EEH A;  2MX6 A;  2IWN A;  2E7K A;  3DJ1 A;  1WF7 A;  3L4F D;  3GDS A;  2HE4 A;  4E34 A;  3MH4 A;  1UJU A;  4NNM A;  3CBX A;  2CSS A;  1VJ6 A;  2KJP A;  1WFG A;  3TMH A;  1ZOK A;  4NNL A;  4F8K A;  2EEJ A;  3I1E A;  2OZF A;  2QKT A;  3PDZ A;  1MFG A;  3QO6 A;  4YYX A;  1V6B A;  3CBZ A;  3STJ A;  1KWA A;  4R2Z A;  4JJ3 A;  2KBS A;  1TE0 A;  3I4W A;  3ID4 A;  4NMO A;  2JOA A;  1X5N A;  2KOM A;  3SFJ A;  1TP5 A;  4NMR A;  2EGN A;  2H3L A;  2EDZ A;  1WIF A;  3FY5 A;  1N99 A;  1Q3O A;  2DC2 A;  1VCW A;  3GJ9 A;  2OS6 A;  5EYZ A;  1LCY A;  3SUZ A;  2M0Z A;  3NFL A;  2R4H A;  2Q9V A;  5GND A;  3ID1 A;  2H2C A;  5HFC A;  2KG2 A;  2I6V A;  1WI4 A;  1SOT A;  1V5L A;  2I0I A;  5F3X A;  1GM1 A;  1GQ5 A;  4Q2O A;  5E1Y A;  5FB8 C;  1KEF A;  1TP3 A;  1X5R A;  2OSG A;  2ZPL A;  1D5G A;  2DJT A;  4NXR A;  5D13 A;  4NMV A;  2IWP A;  2H2B A;  1UEZ A;  5E21 A;  1PDR A;  1WI2 A;  4P0C A;  5DTH A;  3NGH A;  4JOR A;  3GDV A;  2VWR A;  2EEG A;  2FCF A;  3GSL A;  4K75 A;  1FC6 A;  4NXQ A;  5GLJ A;  4Q3H A;  5I7Z A;  4AMH A;  5H3J A;  2KJK A;  2JSN A;  1UF1 A;  2JXO A;  2M0U A;  1N7F A;  1T2M A;  4G69 A;  1W9Q A;  4Q2N A;  1OBY A;  1BFE A;  2EXG A;  2D92 A;  3KHF A;  1U3B A;  2YT7 A;  5HFF A;  2PNT A;  3GDU A;  1I16 A;  2DKR A;  4MPA A;  4UU6 A;  4NMQ A;  5E6P B;  2I0L A;  4K78 A;  2DM8 A;  1XZ9 A;  2KOJ A;  3R68 A;  1RY4 A;  1OBX A;  1X9Z A;  2G5M B;  2ZPM A;  1WHD A;  2KPK A;  3LNX A;  2EAQ A;  3MH6 A;  2G2L A;  2YUB A;  1WF8 A;  3QE1 A;  3VQG A;  2YTW A;  5HFD A;  2PKU A;  4O06 A;  1Z86 A;  4XHV A;  4H11 A;  3TSV A;  2LA8 A;  4OEO A;  1FCF A;  2PZD A;  5JXB A;  4JOH A;  1N6E A;  3DJA A;  3K50 A;  2JIK A;  4JOP A;  3DIW A;  1UM7 A;  2M0V A;  4UU5 A;  2LOB A;  2D90 A;  2Q3G A;  5HDY A;  3DJ3 A;  5IL9 A;  2I04 A;  2L4T A;  4Q2P A;  1UJV A;  1UJD A;  3TSZ A;  4E35 A;  4PQW A;  1TQ3 A;  4RI0 A;  2AWU A;  1VB7 A;  2AWX A;  3QIK A;  5HF1 A;  1N6F A;  1I92 A;  1X8S A;  2VSV A;  1R6J A;  1K32 A;  2IWO A;  2QG1 A;  2REY A;  3CBY A;  2DB5 A;  1MFL A;  3MH7 A;  4REY A;  1FC9 A;  2VRF A;  1UHP A;  3SOE A;  3QJM A;  2YUY A;  2MHO A;  1M5Z A;  2OGP A;  2PA1 A;  3OU0 A;  2KOH A;  2JIL A;  2PKT A;  3HPM A;  2KQF A;  2KYL A;  4Q2Q A;  2OMJ A;  5A2P A;  2M3M A;  1WHA A;  2OPG A;  1OBZ A;  2GZV A;  3DOR A;  1W9O A;  4P2A B;  1NF3 C;  1UEQ A;  5HFB A;  3SHW A;  2BYG A;  3CC0 A;  3JXT A;  3RL7 A;  3B76 A;  2ENO A;  2V1W A;  5HF4 A;  2EEI A;  2YT8 A;  2K20 A;  2EJY A;  1NTE A;  2RRM A;  1OZI A;  2JRE A;  3OTP A;  5F67 A;  3ID3 A;  2F5Y A;  2KV8 A;  1U39 A;  1VA8 A;  1YBO A;  4OEP A;  3QJN A;  2QKV A;  5EZ0 A;  2OQS A;  2W4F A;  3ZRT A;  1X45 A;  3I18 A;  4Z8J A;  3WKL A;  1X6D A;  3LNY A;  4NMT A;  3GCO A;  2QKU A;  1X5Q A;  3K82 A;  4JOG A;  3R69 A;  4JOJ A;  3AXA A;  1V62 A;  3KZD A;  3HPK A;  2X7Z A;  3NCV A;  2K1Z A;  3PDV A;  4L8N A;  4GHN A;  2O2T A;  2KJD A;  1QLC A;  2RCZ A;  3R0H A;  2DMZ A;  4IC6 A;  1UEW A;  4EDJ A;  3E17 A;  1WJL A;  2EDP A;  2FNE A;  3PV5 A;  3GAB A;  5B42 A;  2AWW A;  2M10 A;  3KDK A;  4JOE A;  1P1D A;  1Y7N A;  4K76 A;  1N6D A;  1UM1 A;  1W9E A;  2Z9I A;  2JWE A;  3K1R A;  4YDP A;  4HOP B;  3RLE A;  4OAJ A;  2HE2 A;  1RGW A;  1IHJ A;  4KFW A;  5ILB A;  1U37 A;  4N6X A;  1WFV A;  2CSJ A;  2EV8 A;  2LC6 A;  1UEP A;  4NMP A;  5HEB A;  1QAV A;  1Y8T A;  2GEF A;  2EDV A;  5E11 A;  2I1N A;  1IU0 A;  1Q7X A;  2VPH A;  2L4S A;  2AIN A;  1WH1 A;  2JIN A;  2EHR A;  5G1E A;  1BE9 A;  1QAV B;  1UIT A;  2I4S A;  2DLS A;  3EGG C;  2M0T A;  3NFK A;  4GVD A;  4WYT A;  2H3M A;  3GCN A;  3ID2 A;  4Z33 A;  3QDO A;  2FN5 A;  4JJ0 A;  2F0A A;  5HJ1 A;  1KY9 A;  5HED A;  3O5N A;  3CS0 A;  2L97 A;  5B6L A;  1Q3P A;  2Z17 A;  4K72 A;  4KFV A;  2WL7 A;  2LUI A;  3RL8 A;  3TSW A;  3QGL A;  3KZE A;  1FC7 A;  2EGK A;  3CYY A;  2IWQ A;  1Z87 A;  1MC7 A;  1ZUB A;  4K6Y A;  3PS4 A;  3HVQ C;  2CS5 A;  3GGE A;  2W7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...