2L97A

Solution structure of htra pdz domain from streptococcus pneumoniae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
127
structure length
127
Chain Sequence
b'MEGLGFAIPANDAINIIEQLEKNGKVTRPALGIQMVNLSNVSTSDIRRLNIPSNVTSGVIVRSVQSNMPANGHLEKYDVITKVDDKEIASSTDLQSALYNHSIGDTIKITYYRNGKEETTSIKLNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative serine protease
publication title Solution structure of HtrA PDZ domain from Streptococcus pneumoniae and its interaction with YYF-COOH containing peptides.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Protein binding
total genus 12
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13180 PDZ_2 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2l97A01
5D13A 1WI4A 2IWQA 4O06A 5HF1A 4Q2NA 3HPKA 3L4FD 3PV2A 2VPHA 2EDPA 3CC0A 1ZOKA 2EGKA 1N7EA 4NMTA 5HJ1A 1UJUA 1V5QA 1W9OA 4KFVA 1L6OA 2LA8A 4Q2QA 1QAUA 1MFGA 2DLUA 5E1YA 2QKVA 2OGPA 5GNDA 2EEHA 1UM7A 5HFFA 5F67A 3DJ3A 3TMHA 2OZFA 2PA1A 1VB7A 1WFVA 2KRGA 2RCZA 1VCWA 4AMHA 3ZRTA 2CSSA 2EGNA 2Q9VA 1SOZA 3I18A 2PDZA 2M0ZA 1WH1A 2Q3GA 2MX6A 2H2BA 1N99A 2EEIA 2DC2A 4XHVA 2HGAA 3WKLA 2GZVA 4JOKA 4F8KA 2EGOA 2PKUA 3OU0A 4UU6A 2DAZA 2JOAA 3GDUA 1TE0A 3KZEA 3R68A 2PKTA 2QT5A 2I0IA 1B8QA 4HOPA 2PZDA 5HEYA 3GJ9A 5F3XA 4K72A 3ID2A 1V5LA 2EDZA 1VJ6A 3I1EA 2OPGA 2LOBA 5G1EA 2W4FA 2EDVA 3QGLA 1TP3A 3B76A 3SUZA 1TP5A 2KPKA 3VQFA 2LC6A 2QKTA 4P0CA 5E6PB 3SHUA 2AWWA 4OEOA 3STJA 1WF7A 2I6VA 2I0LA 2M0UA 2KJKA 2H2CA 3O5NA 1BFEA 3EGHC 2K20A 4JOEA 4NMSA 5E11A 2OSGA 4P2AB 5B6LA 3GSLA 4GVCA 1RGRA 1KY9A 2D90A 1FC6A 3MH6A 2YT7A 2OS6A 4E35A 5HFCA 1KEFA 1BE9A 1FC9A 2G2LA 3CBXA 1U39A 3CBYA 5E21A 4MPAA 3O46A 2KAWA 2V1WA 4JOJA 3SHWA 4Q6SA 4NMPA 1M5ZA 4R2ZA 5I7ZA 2KQFA 1Y7NA 4EDJA 4JOGA 2KOMA 1X45A 3RL7A 2KA9A 2DKRA 1WG6A 1WJLA 1WF8A 2ZPMA 2KOHA 2R4HA 5EZ0A 2EXGA 2JILA 4NMVA 2M0VA 3NFKA 3NGHA 2OCSA 3SFJA 2EEGA 5HFDA 5H3JA 1IU2A 4NXPA 3PDZA 1FC7A 1VAEA 2HE4A 4K75A 4Q3HA 1X5QA 3QDOA 3DJ1A 4REYA 3NFLA 3K1RA 2KL1A 1UJVA 1TQ3A 3LNYA 1Z87A 3R0HA 3K50A 3MH7A 2YTWA 1Q3PA 5GLJA 1X6DA 4N6XA 1N7FA 3CH8A 2EJYA 2QBWA 2E7KA 2G5MB 4K6YA 4Q2OA 2VSPA 2DMZA 2DM8A 1UITA 2DB5A 1Z86A 1UF1A 2D92A 2RRMA 2JIKA 4NXQA 2M10A 3DIWA 5HFBA 5HEDA 1WFGA 2EHRA 2D8IA 4OAJA 1D5GA 1RY4A 2CSJA 1N6EA 1GQ4A 1RZXA 1KWAA 3QJMA 1N7TA 2PNTA 2JWEA 3TSZA 1R6JA 3K82A 2WL7A 3VQGA 2YUYA 5DTHA 4YDPA 2OMJA 4Z33A 3R69A 1W9QA 2UZCA 4RI0A 3PV4A 2LC7A 1I92A 1QAVA 2V90A 2FN5A 2R3YA 3PS4A 3JXTA 2KG2A 3OTPA 2M3MA 2AINA 3QJNA 3DORA 2W7RA 2P3WA 4IC6A 2ZPLA 4GHNA 1XZ9A 3GGEA 3KZDA 5HF4A 1I16A 4FGMA 3LNXA 1G9OA 2IWOA 5FHTA 1IHJA 2EV8A 3RLEA 4K76A 1UM1A 2EEJA 1WI2A 2ENOA 5HEBA 5E22A 3QO6A 2QG1A 2DLSA 1U3BA 2HE2A 1UEPA 1FCFA 5HETA 2KV8A 1W9EA 5JXBA 2KPLA 4JORA 2OQSA 2F0AA 2MHOA 4YYXA 2FNEA 1NTEA 3SOEA 4JOPA 2I4SA 4JL7A 1RGWA 1U38A 2H3LA 2H3MA 2KYLA 1WHAA 1YBOA 3CS0A 1UEQA 2KBSA 2VSVA 5A2PA 3HVQC 1OBYA 1ZUBA 3BPUA 3E17A 5HDYA 2VZ5A 1VA8A 4G69A 2JINA 2IWPA 1N6FA 1OZIA 2REYA 3AXAA 4K78A 2FCFA 1NF3C 3CYYA 1V62A 3CBZA 2L4TA 3TSWA 3RL8A 4OEPA 4Q2PA 4E34A 1WIFA 3PV5A 3GDSA 4NMRA 1IU0A 2K1ZA 1Y8TA 2KJDA 3I4WA 4WYTA 3FY5A 1Q3OA 2VWRA 5G1DA 2IWNA 2YUBA 4JOHA 5FB8C 2AWUA 4PQWA 2BYGA 2M0TA 1X8SA 2KJPA 3GDVA 4NMOA 3WKMA 1GQ5A 3QIKA 4Q6HA 2JXOA 4JOFA 4GVDA 3PDVA 1OBZA 2L97A 1MFLA 3HPMA 4L8NA 2AWXA 3EGGC 2O2TA 2CS5A 2Z17A 1WHDA 1V6BA 4WYUA 1K32A 3GCNA 4E3BA 2DJTA 2QKUA 1UHPA 4HOPB 4NNMA 2KOJA 1PDRA 2I1NA 3QE1A 1SOTA 4NNLA 5EYZA 4NMQA 3TSVA 1N6DA 4KFWA 4LMMA 1QLCA 2I04A 1X5RA 2LUIA 1UJDA 2JREA 3GCOA 5HFEA 4NXRA 3ID1A 3DJAA 2VRFA 2Z9IA 1X5NA 3ID3A 1V1TA 2L4SA 2X7ZA 1GM1A 1UFXA 1U37A 1OBXA 1P1DA 1Q7XA 1QAVB 1MC7A 3KHFA 1T2MA 1P1EA 4Z8JA 2YT8A 4H11A 2EAQA 1UEWA 3MH4A 3ID4A 1UEZA 1LCYA 4UU5A 2F5YA 2FE5A
chains in the Genus database with same CATH superfamily
5D13A 1WI4A 2IWQA 4O06A 5HF1A 4Q2NA 3HPKA 3L4FD 3PV2A 2VPHA 4FLNA 2EDPA 3CC0A 1ZOKA 2EGKA 1N7EA 4NMTA 5HJ1A 1UJUA 1V5QA 1W9OA 4KFVA 1L6OA 2LA8A 4Q2QA 1QAUA 1MFGA 2DLUA 5E1YA 2QKVA 2OGPA 5GNDA 2EEHA 1UM7A 5HFFA 5F67A 3DJ3A 3TMHA 2OZFA 2PA1A 1VB7A 1WFVA 2KRGA 2RCZA 1VCWA 4AMHA 3ZRTA 2CSSA 2EGNA 2Q9VA 1SOZA 3I18A 2PDZA 2M0ZA 1WH1A 2Q3GA 2MX6A 2H2BA 1N99A 2EEIA 2DC2A 4XHVA 5B42A 2HGAA 3WKLA 2GZVA 4JOKA 4F8KA 2EGOA 2PKUA 3OU0A 4UU6A 2DAZA 2JOAA 3GDUA 1TE0A 3KZEA 3R68A 2PKTA 2QT5A 2I0IA 1B8QA 4HOPA 2PZDA 5HEYA 3GJ9A 5F3XA 4K72A 3ID2A 4JJ0A 1V5LA 2EDZA 5IL9A 3KDGA 1VJ6A 3I1EA 2OPGA 2LOBA 5G1EA 2W4FA 2EDVA 3QGLA 1TP3A 3B76A 3SUZA 1TP5A 2KPKA 3VQFA 2LC6A 2QKTA 4P0CA 5E6PB 3SHUA 2AWWA 4OEOA 3STJA 1WF7A 2I6VA 2I0LA 2M0UA 2KJKA 2H2CA 3O5NA 1BFEA 3EGHC 2K20A 4JOEA 4NMSA 5E11A 2OSGA 4P2AB 5B6LA 3GSLA 4GVCA 1RGRA 1KY9A 2D90A 1FC6A 3MH6A 2YT7A 2OS6A 4E35A 5HFCA 1KEFA 1BE9A 1FC9A 2G2LA 3CBXA 1U39A 3CBYA 5E21A 4MPAA 3O46A 2KAWA 2V1WA 4JOJA 3SHWA 4Q6SA 4NMPA 1M5ZA 4R2ZA 5I7ZA 2KQFA 1Y7NA 4EDJA 4JOGA 2KOMA 1X45A 3RL7A 2KA9A 2DKRA 1WG6A 1WJLA 1WF8A 2ZPMA 2KOHA 2R4HA 5EZ0A 2EXGA 2JILA 4NMVA 2M0VA 3NFKA 3NGHA 2OCSA 3SFJA 2EEGA 5HFDA 5H3JA 1IU2A 4NXPA 3PDZA 1FC7A 1VAEA 2HE4A 4K75A 4Q3HA 1X5QA 3QDOA 3DJ1A 4REYA 3NFLA 3K1RA 2KL1A 1UJVA 1TQ3A 3LNYA 1Z87A 3R0HA 3K50A 3MH7A 2YTWA 1Q3PA 5GLJA 1X6DA 4N6XA 1N7FA 3CH8A 2EJYA 2QBWA 2E7KA 2G5MB 4K6YA 4Q2OA 2VSPA 2DMZA 2DM8A 1UITA 2DB5A 1Z86A 1UF1A 2D92A 2RRMA 2JIKA 4NXQA 2M10A 3DIWA 5HFBA 5HEDA 1WFGA 2EHRA 2D8IA 2JSNA 4OAJA 1D5GA 1RY4A 2CSJA 1N6EA 1GQ4A 1RZXA 1KWAA 3QJMA 5ILBA 1N7TA 2PNTA 2JWEA 3TSZA 1R6JA 3K82A 2WL7A 3VQGA 2YUYA 5DTHA 4YDPA 2OMJA 4Z33A 3R69A 1W9QA 2UZCA 4RI0A 3PV4A 2LC7A 1I92A 1QAVA 2V90A 2FN5A 2R3YA 3PS4A 3JXTA 2KG2A 3OTPA 2M3MA 2AINA 3QJNA 3DORA 2W7RA 2P3WA 4IC6A 2ZPLA 4GHNA 1XZ9A 3GGEA 3KZDA 5HF4A 1I16A 4FGMA 3LNXA 1G9OA 2IWOA 5FHTA 1IHJA 4JJ3A 2EV8A 3RLEA 3NCVA 4K76A 1UM1A 2EEJA 1WI2A 2ENOA 5HEBA 5E22A 3QO6A 2QG1A 2DLSA 1U3BA 2HE2A 1UEPA 1FCFA 5HETA 2KV8A 1W9EA 5JXBA 2KPLA 4JORA 2OQSA 2F0AA 2MHOA 4YYXA 2FNEA 1NTEA 3SOEA 4JOPA 2I4SA 4JL7A 1RGWA 1U38A 2H3LA 2H3MA 2KYLA 1WHAA 1YBOA 3CS0A 1UEQA 2KBSA 2VSVA 5A2PA 3HVQC 1OBYA 1ZUBA 3BPUA 3E17A 5HDYA 2VZ5A 1VA8A 4G69A 2JINA 2IWPA 1N6FA 1OZIA 2REYA 3AXAA 4K78A 2FCFA 1NF3C 3CYYA 1V62A 3CBZA 2L4TA 3TSWA 3RL8A 4OEPA 4Q2PA 4E34A 1WIFA 3PV5A 3GDSA 4NMRA 1IU0A 2K1ZA 1Y8TA 2KJDA 3I4WA 4WYTA 3FY5A 1Q3OA 2VWRA 5G1DA 2IWNA 2YUBA 4JOHA 5FB8C 2AWUA 4PQWA 2BYGA 2M0TA 1X8SA 2KJPA 3GDVA 4NMOA 3WKMA 1GQ5A 3QIKA 4Q6HA 2JXOA 3KDKA 4JOFA 3GABA 4GVDA 3PDVA 1OBZA 2L97A 1MFLA 3HPMA 4L8NA 2AWXA 3EGGC 2O2TA 2CS5A 2Z17A 1WHDA 1V6BA 4WYUA 1K32A 3GCNA 4E3BA 2DJTA 2QKUA 1UHPA 4HOPB 4NNMA 2KOJA 1PDRA 2I1NA 3QE1A 1SOTA 1X9ZA 4NNLA 5EYZA 4NMQA 3TSVA 1N6DA 4KFWA 4LMMA 1QLCA 2I04A 2GEFA 1X5RA 2LUIA 1UJDA 2JREA 3GCOA 5HFEA 4NXRA 3ID1A 3DJAA 2VRFA 2Z9IA 1X5NA 3ID3A 1V1TA 2L4SA 2X7ZA 1GM1A 1UFXA 1U37A 1OBXA 1P1DA 1Q7XA 1QAVB 1MC7A 3KHFA 1T2MA 1P1EA 4Z8JA 2YT8A 4H11A 2EAQA 1UEWA 3MH4A 3ID4A 1UEZA 1LCYA 4UU5A 2F5YA 2FE5A
chains in the Genus database with same CATH topology
5D13A 1WI4A 2IWQA 4O06A 5HF1A 4Q2NA 3HPKA 3L4FD 3PV2A 2VPHA 4FLNA 2EDPA 3CC0A 1ZOKA 2EGKA 1N7EA 4NMTA 5HJ1A 1UJUA 1V5QA 1W9OA 4KFVA 1L6OA 2LA8A 4Q2QA 1QAUA 1MFGA 2DLUA 5E1YA 2QKVA 2OGPA 5GNDA 2EEHA 1UM7A 5HFFA 5F67A 3DJ3A 3TMHA 2OZFA 2PA1A 1VB7A 1WFVA 2KRGA 2RCZA 1VCWA 4AMHA 3ZRTA 2CSSA 2EGNA 2Q9VA 1SOZA 3I18A 2PDZA 2M0ZA 1WH1A 2Q3GA 2MX6A 2H2BA 1N99A 2EEIA 2DC2A 4XHVA 5B42A 2HGAA 3WKLA 2GZVA 4JOKA 4F8KA 2EGOA 2PKUA 3OU0A 4UU6A 2DAZA 2JOAA 3GDUA 1TE0A 3KZEA 3R68A 2PKTA 2QT5A 2I0IA 1B8QA 4HOPA 2PZDA 5HEYA 3GJ9A 5F3XA 4K72A 3ID2A 4JJ0A 1V5LA 2EDZA 5IL9A 3KDGA 1VJ6A 3I1EA 2OPGA 2LOBA 5G1EA 2W4FA 2EDVA 3QGLA 1TP3A 3B76A 3SUZA 1TP5A 2KPKA 3VQFA 2LC6A 2QKTA 4P0CA 5E6PB 3SHUA 2AWWA 4OEOA 3STJA 1WF7A 2I6VA 2I0LA 2M0UA 2KJKA 2H2CA 3O5NA 1BFEA 3EGHC 2K20A 4JOEA 4NMSA 5E11A 2OSGA 4P2AB 5B6LA 3GSLA 4GVCA 1RGRA 1KY9A 2D90A 1FC6A 3MH6A 2YT7A 2OS6A 4E35A 5HFCA 1KEFA 1BE9A 1FC9A 2G2LA 3CBXA 1U39A 3CBYA 5E21A 4MPAA 3O46A 2KAWA 2V1WA 4JOJA 3SHWA 4Q6SA 4NMPA 1M5ZA 4R2ZA 5I7ZA 2KQFA 1Y7NA 4EDJA 4JOGA 2KOMA 1X45A 3RL7A 2KA9A 2DKRA 1WG6A 1WJLA 1WF8A 2ZPMA 2KOHA 2R4HA 5EZ0A 2EXGA 2JILA 4NMVA 2M0VA 3NFKA 3NGHA 2OCSA 3SFJA 2EEGA 5HFDA 5H3JA 1IU2A 4NXPA 3PDZA 1FC7A 1VAEA 2HE4A 4K75A 4Q3HA 1X5QA 3QDOA 3DJ1A 4REYA 3NFLA 3K1RA 2KL1A 1UJVA 1TQ3A 3LNYA 1Z87A 3R0HA 3K50A 3MH7A 2YTWA 1Q3PA 5GLJA 1X6DA 4N6XA 1N7FA 3CH8A 2EJYA 2QBWA 2E7KA 2G5MB 4K6YA 4Q2OA 2VSPA 2DMZA 2DM8A 1UITA 2DB5A 1Z86A 1UF1A 2D92A 2RRMA 2JIKA 4NXQA 2M10A 3DIWA 5HFBA 5HEDA 1WFGA 2EHRA 2D8IA 2JSNA 4OAJA 1D5GA 1RY4A 2CSJA 1N6EA 1GQ4A 1RZXA 1KWAA 3QJMA 5ILBA 1N7TA 2PNTA 2JWEA 3TSZA 1R6JA 3K82A 2WL7A 3VQGA 2YUYA 5DTHA 4YDPA 2OMJA 4Z33A 3R69A 1W9QA 2UZCA 4RI0A 3PV4A 2LC7A 1I92A 1QAVA 2V90A 2FN5A 2R3YA 3PS4A 3JXTA 2KG2A 3OTPA 2M3MA 2AINA 3QJNA 3DORA 2W7RA 2P3WA 4IC6A 2ZPLA 4GHNA 1XZ9A 3GGEA 3KZDA 5HF4A 1I16A 4FGMA 3LNXA 1G9OA 2IWOA 5FHTA 1IHJA 4JJ3A 2EV8A 3RLEA 3NCVA 4K76A 1UM1A 2EEJA 1WI2A 2ENOA 5HEBA 5E22A 3QO6A 2QG1A 2DLSA 1U3BA 2HE2A 1UEPA 1FCFA 5HETA 2KV8A 1W9EA 5JXBA 2KPLA 4JORA 2OQSA 2F0AA 2MHOA 4YYXA 2FNEA 1NTEA 3SOEA 4JOPA 2I4SA 4JL7A 1RGWA 1U38A 2H3LA 2H3MA 2KYLA 1WHAA 1YBOA 3CS0A 1UEQA 2KBSA 2VSVA 5A2PA 3HVQC 1OBYA 1ZUBA 3BPUA 3E17A 5HDYA 2VZ5A 1VA8A 4G69A 2JINA 2IWPA 1N6FA 1OZIA 2REYA 3AXAA 4K78A 2FCFA 1NF3C 3CYYA 1V62A 3CBZA 2L4TA 3TSWA 3RL8A 4OEPA 4Q2PA 4E34A 1WIFA 3PV5A 3GDSA 4NMRA 1IU0A 2K1ZA 1Y8TA 2KJDA 3I4WA 4WYTA 3FY5A 1Q3OA 2VWRA 5G1DA 2IWNA 2YUBA 4JOHA 5FB8C 2AWUA 4PQWA 2BYGA 2M0TA 1X8SA 2KJPA 3GDVA 4NMOA 3WKMA 1GQ5A 3QIKA 4Q6HA 2JXOA 3KDKA 4JOFA 3GABA 4GVDA 3PDVA 1OBZA 2L97A 1MFLA 3HPMA 4L8NA 2AWXA 3EGGC 2O2TA 2CS5A 2Z17A 1WHDA 1V6BA 4WYUA 1K32A 3GCNA 4E3BA 2DJTA 2QKUA 1UHPA 4HOPB 4NNMA 2KOJA 1PDRA 2I1NA 3QE1A 1SOTA 1X9ZA 4NNLA 5EYZA 4NMQA 3TSVA 1N6DA 4KFWA 4LMMA 1QLCA 2I04A 2GEFA 1X5RA 2LUIA 1UJDA 2JREA 3GCOA 5HFEA 4NXRA 3ID1A 3DJAA 2VRFA 2Z9IA 1X5NA 3ID3A 1V1TA 2L4SA 2X7ZA 1GM1A 1UFXA 1U37A 1OBXA 1P1DA 1Q7XA 1QAVB 1MC7A 3KHFA 1T2MA 1P1EA 4Z8JA 2YT8A 4H11A 2EAQA 1UEWA 3MH4A 3ID4A 1UEZA 1LCYA 4UU5A 2F5YA 2FE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D13 A;  1WI4 A;  2IWQ A;  4O06 A;  5HF1 A;  4Q2N A;  3HPK A;  3L4F D;  3PV2 A;  2VPH A;  2EDP A;  3CC0 A;  1ZOK A;  2EGK A;  1N7E A;  4NMT A;  5HJ1 A;  1UJU A;  1V5Q A;  1W9O A;  4KFV A;  1L6O A;  2LA8 A;  4Q2Q A;  1QAU A;  1MFG A;  2DLU A;  5E1Y A;  2QKV A;  2OGP A;  5GND A;  2EEH A;  1UM7 A;  5HFF A;  5F67 A;  3DJ3 A;  3TMH A;  2OZF A;  2PA1 A;  1VB7 A;  1WFV A;  2KRG A;  2RCZ A;  1VCW A;  4AMH A;  3ZRT A;  2CSS A;  2EGN A;  2Q9V A;  1SOZ A;  3I18 A;  2PDZ A;  2M0Z A;  1WH1 A;  2Q3G A;  2MX6 A;  2H2B A;  1N99 A;  2EEI A;  2DC2 A;  4XHV A;  2HGA A;  3WKL A;  2GZV A;  4JOK A;  4F8K A;  2EGO A;  2PKU A;  3OU0 A;  4UU6 A;  2DAZ A;  2JOA A;  3GDU A;  1TE0 A;  3KZE A;  3R68 A;  2PKT A;  2QT5 A;  2I0I A;  1B8Q A;  4HOP A;  2PZD A;  5HEY A;  3GJ9 A;  5F3X A;  4K72 A;  3ID2 A;  1V5L A;  2EDZ A;  1VJ6 A;  3I1E A;  2OPG A;  2LOB A;  5G1E A;  2W4F A;  2EDV A;  3QGL A;  1TP3 A;  3B76 A;  3SUZ A;  1TP5 A;  2KPK A;  3VQF A;  2LC6 A;  2QKT A;  4P0C A;  5E6P B;  3SHU A;  2AWW A;  4OEO A;  3STJ A;  1WF7 A;  2I6V A;  2I0L A;  2M0U A;  2KJK A;  2H2C A;  3O5N A;  1BFE A;  3EGH C;  2K20 A;  4JOE A;  4NMS A;  5E11 A;  2OSG A;  4P2A B;  5B6L A;  3GSL A;  4GVC A;  1RGR A;  1KY9 A;  2D90 A;  1FC6 A;  3MH6 A;  2YT7 A;  2OS6 A;  4E35 A;  5HFC A;  1KEF A;  1BE9 A;  1FC9 A;  2G2L A;  3CBX A;  1U39 A;  3CBY A;  5E21 A;  4MPA A;  3O46 A;  2KAW A;  2V1W A;  4JOJ A;  3SHW A;  4Q6S A;  4NMP A;  1M5Z A;  4R2Z A;  5I7Z A;  2KQF A;  1Y7N A;  4EDJ A;  4JOG A;  2KOM A;  1X45 A;  3RL7 A;  2KA9 A;  2DKR A;  1WG6 A;  1WJL A;  1WF8 A;  2ZPM A;  2KOH A;  2R4H A;  5EZ0 A;  2EXG A;  2JIL A;  4NMV A;  2M0V A;  3NFK A;  3NGH A;  2OCS A;  3SFJ A;  2EEG A;  5HFD A;  5H3J A;  1IU2 A;  4NXP A;  3PDZ A;  1FC7 A;  1VAE A;  2HE4 A;  4K75 A;  4Q3H A;  1X5Q A;  3QDO A;  3DJ1 A;  4REY A;  3NFL A;  3K1R A;  2KL1 A;  1UJV A;  1TQ3 A;  3LNY A;  1Z87 A;  3R0H A;  3K50 A;  3MH7 A;  2YTW A;  1Q3P A;  5GLJ A;  1X6D A;  4N6X A;  1N7F A;  3CH8 A;  2EJY A;  2QBW A;  2E7K A;  2G5M B;  4K6Y A;  4Q2O A;  2VSP A;  2DMZ A;  2DM8 A;  1UIT A;  2DB5 A;  1Z86 A;  1UF1 A;  2D92 A;  2RRM A;  2JIK A;  4NXQ A;  2M10 A;  3DIW A;  5HFB A;  5HED A;  1WFG A;  2EHR A;  2D8I A;  4OAJ A;  1D5G A;  1RY4 A;  2CSJ A;  1N6E A;  1GQ4 A;  1RZX A;  1KWA A;  3QJM A;  1N7T A;  2PNT A;  2JWE A;  3TSZ A;  1R6J A;  3K82 A;  2WL7 A;  3VQG A;  2YUY A;  5DTH A;  4YDP A;  2OMJ A;  4Z33 A;  3R69 A;  1W9Q A;  2UZC A;  4RI0 A;  3PV4 A;  2LC7 A;  1I92 A;  1QAV A;  2V90 A;  2FN5 A;  2R3Y A;  3PS4 A;  3JXT A;  2KG2 A;  3OTP A;  2M3M A;  2AIN A;  3QJN A;  3DOR A;  2W7R A;  2P3W A;  4IC6 A;  2ZPL A;  4GHN A;  1XZ9 A;  3GGE A;  3KZD A;  5HF4 A;  1I16 A;  4FGM A;  3LNX A;  1G9O A;  2IWO A;  5FHT A;  1IHJ A;  2EV8 A;  3RLE A;  4K76 A;  1UM1 A;  2EEJ A;  1WI2 A;  2ENO A;  5HEB A;  5E22 A;  3QO6 A;  2QG1 A;  2DLS A;  1U3B A;  2HE2 A;  1UEP A;  1FCF A;  5HET A;  2KV8 A;  1W9E A;  5JXB A;  2KPL A;  4JOR A;  2OQS A;  2F0A A;  2MHO A;  4YYX A;  2FNE A;  1NTE A;  3SOE A;  4JOP A;  2I4S A;  4JL7 A;  1RGW A;  1U38 A;  2H3L A;  2H3M A;  2KYL A;  1WHA A;  1YBO A;  3CS0 A;  1UEQ A;  2KBS A;  2VSV A;  5A2P A;  3HVQ C;  1OBY A;  1ZUB A;  3BPU A;  3E17 A;  5HDY A;  2VZ5 A;  1VA8 A;  4G69 A;  2JIN A;  2IWP A;  1N6F A;  1OZI A;  2REY A;  3AXA A;  4K78 A;  2FCF A;  1NF3 C;  3CYY A;  1V62 A;  3CBZ A;  2L4T A;  3TSW A;  3RL8 A;  4OEP A;  4Q2P A;  4E34 A;  1WIF A;  3PV5 A;  3GDS A;  4NMR A;  1IU0 A;  2K1Z A;  1Y8T A;  2KJD A;  3I4W A;  4WYT A;  3FY5 A;  1Q3O A;  2VWR A;  5G1D A;  2IWN A;  2YUB A;  4JOH A;  5FB8 C;  2AWU A;  4PQW A;  2BYG A;  2M0T A;  1X8S A;  2KJP A;  3GDV A;  4NMO A;  3WKM A;  1GQ5 A;  3QIK A;  4Q6H A;  2JXO A;  4JOF A;  4GVD A;  3PDV A;  1OBZ A;  2L97 A;  1MFL A;  3HPM A;  4L8N A;  2AWX A;  3EGG C;  2O2T A;  2CS5 A;  2Z17 A;  1WHD A;  1V6B A;  4WYU A;  1K32 A;  3GCN A;  4E3B A;  2DJT A;  2QKU A;  1UHP A;  4HOP B;  4NNM A;  2KOJ A;  1PDR A;  2I1N A;  3QE1 A;  1SOT A;  4NNL A;  5EYZ A;  4NMQ A;  3TSV A;  1N6D A;  4KFW A;  4LMM A;  1QLC A;  2I04 A;  1X5R A;  2LUI A;  1UJD A;  2JRE A;  3GCO A;  5HFE A;  4NXR A;  3ID1 A;  3DJA A;  2VRF A;  2Z9I A;  1X5N A;  3ID3 A;  1V1T A;  2L4S A;  2X7Z A;  1GM1 A;  1UFX A;  1U37 A;  1OBX A;  1P1D A;  1Q7X A;  1QAV B;  1MC7 A;  3KHF A;  1T2M A;  1P1E A;  4Z8J A;  2YT8 A;  4H11 A;  2EAQ A;  1UEW A;  3MH4 A;  3ID4 A;  1UEZ A;  1LCY A;  4UU5 A;  2F5Y A;  2FE5 A; 
#chains in the Genus database with same CATH topology
 5D13 A;  1WI4 A;  2IWQ A;  4O06 A;  5HF1 A;  4Q2N A;  3HPK A;  3L4F D;  3PV2 A;  2VPH A;  4FLN A;  2EDP A;  3CC0 A;  1ZOK A;  2EGK A;  1N7E A;  4NMT A;  5HJ1 A;  1UJU A;  1V5Q A;  1W9O A;  4KFV A;  1L6O A;  2LA8 A;  4Q2Q A;  1QAU A;  1MFG A;  2DLU A;  5E1Y A;  2QKV A;  2OGP A;  5GND A;  2EEH A;  1UM7 A;  5HFF A;  5F67 A;  3DJ3 A;  3TMH A;  2OZF A;  2PA1 A;  1VB7 A;  1WFV A;  2KRG A;  2RCZ A;  1VCW A;  4AMH A;  3ZRT A;  2CSS A;  2EGN A;  2Q9V A;  1SOZ A;  3I18 A;  2PDZ A;  2M0Z A;  1WH1 A;  2Q3G A;  2MX6 A;  2H2B A;  1N99 A;  2EEI A;  2DC2 A;  4XHV A;  5B42 A;  2HGA A;  3WKL A;  2GZV A;  4JOK A;  4F8K A;  2EGO A;  2PKU A;  3OU0 A;  4UU6 A;  2DAZ A;  2JOA A;  3GDU A;  1TE0 A;  3KZE A;  3R68 A;  2PKT A;  2QT5 A;  2I0I A;  1B8Q A;  4HOP A;  2PZD A;  5HEY A;  3GJ9 A;  5F3X A;  4K72 A;  3ID2 A;  4JJ0 A;  1V5L A;  2EDZ A;  5IL9 A;  3KDG A;  1VJ6 A;  3I1E A;  2OPG A;  2LOB A;  5G1E A;  2W4F A;  2EDV A;  3QGL A;  1TP3 A;  3B76 A;  3SUZ A;  1TP5 A;  2KPK A;  3VQF A;  2LC6 A;  2QKT A;  4P0C A;  5E6P B;  3SHU A;  2AWW A;  4OEO A;  3STJ A;  1WF7 A;  2I6V A;  2I0L A;  2M0U A;  2KJK A;  2H2C A;  3O5N A;  1BFE A;  3EGH C;  2K20 A;  4JOE A;  4NMS A;  5E11 A;  2OSG A;  4P2A B;  5B6L A;  3GSL A;  4GVC A;  1RGR A;  1KY9 A;  2D90 A;  1FC6 A;  3MH6 A;  2YT7 A;  2OS6 A;  4E35 A;  5HFC A;  1KEF A;  1BE9 A;  1FC9 A;  2G2L A;  3CBX A;  1U39 A;  3CBY A;  5E21 A;  4MPA A;  3O46 A;  2KAW A;  2V1W A;  4JOJ A;  3SHW A;  4Q6S A;  4NMP A;  1M5Z A;  4R2Z A;  5I7Z A;  2KQF A;  1Y7N A;  4EDJ A;  4JOG A;  2KOM A;  1X45 A;  3RL7 A;  2KA9 A;  2DKR A;  1WG6 A;  1WJL A;  1WF8 A;  2ZPM A;  2KOH A;  2R4H A;  5EZ0 A;  2EXG A;  2JIL A;  4NMV A;  2M0V A;  3NFK A;  3NGH A;  2OCS A;  3SFJ A;  2EEG A;  5HFD A;  5H3J A;  1IU2 A;  4NXP A;  3PDZ A;  1FC7 A;  1VAE A;  2HE4 A;  4K75 A;  4Q3H A;  1X5Q A;  3QDO A;  3DJ1 A;  4REY A;  3NFL A;  3K1R A;  2KL1 A;  1UJV A;  1TQ3 A;  3LNY A;  1Z87 A;  3R0H A;  3K50 A;  3MH7 A;  2YTW A;  1Q3P A;  5GLJ A;  1X6D A;  4N6X A;  1N7F A;  3CH8 A;  2EJY A;  2QBW A;  2E7K A;  2G5M B;  4K6Y A;  4Q2O A;  2VSP A;  2DMZ A;  2DM8 A;  1UIT A;  2DB5 A;  1Z86 A;  1UF1 A;  2D92 A;  2RRM A;  2JIK A;  4NXQ A;  2M10 A;  3DIW A;  5HFB A;  5HED A;  1WFG A;  2EHR A;  2D8I A;  2JSN A;  4OAJ A;  1D5G A;  1RY4 A;  2CSJ A;  1N6E A;  1GQ4 A;  1RZX A;  1KWA A;  3QJM A;  5ILB A;  1N7T A;  2PNT A;  2JWE A;  3TSZ A;  1R6J A;  3K82 A;  2WL7 A;  3VQG A;  2YUY A;  5DTH A;  4YDP A;  2OMJ A;  4Z33 A;  3R69 A;  1W9Q A;  2UZC A;  4RI0 A;  3PV4 A;  2LC7 A;  1I92 A;  1QAV A;  2V90 A;  2FN5 A;  2R3Y A;  3PS4 A;  3JXT A;  2KG2 A;  3OTP A;  2M3M A;  2AIN A;  3QJN A;  3DOR A;  2W7R A;  2P3W A;  4IC6 A;  2ZPL A;  4GHN A;  1XZ9 A;  3GGE A;  3KZD A;  5HF4 A;  1I16 A;  4FGM A;  3LNX A;  1G9O A;  2IWO A;  5FHT A;  1IHJ A;  4JJ3 A;  2EV8 A;  3RLE A;  3NCV A;  4K76 A;  1UM1 A;  2EEJ A;  1WI2 A;  2ENO A;  5HEB A;  5E22 A;  3QO6 A;  2QG1 A;  2DLS A;  1U3B A;  2HE2 A;  1UEP A;  1FCF A;  5HET A;  2KV8 A;  1W9E A;  5JXB A;  2KPL A;  4JOR A;  2OQS A;  2F0A A;  2MHO A;  4YYX A;  2FNE A;  1NTE A;  3SOE A;  4JOP A;  2I4S A;  4JL7 A;  1RGW A;  1U38 A;  2H3L A;  2H3M A;  2KYL A;  1WHA A;  1YBO A;  3CS0 A;  1UEQ A;  2KBS A;  2VSV A;  5A2P A;  3HVQ C;  1OBY A;  1ZUB A;  3BPU A;  3E17 A;  5HDY A;  2VZ5 A;  1VA8 A;  4G69 A;  2JIN A;  2IWP A;  1N6F A;  1OZI A;  2REY A;  3AXA A;  4K78 A;  2FCF A;  1NF3 C;  3CYY A;  1V62 A;  3CBZ A;  2L4T A;  3TSW A;  3RL8 A;  4OEP A;  4Q2P A;  4E34 A;  1WIF A;  3PV5 A;  3GDS A;  4NMR A;  1IU0 A;  2K1Z A;  1Y8T A;  2KJD A;  3I4W A;  4WYT A;  3FY5 A;  1Q3O A;  2VWR A;  5G1D A;  2IWN A;  2YUB A;  4JOH A;  5FB8 C;  2AWU A;  4PQW A;  2BYG A;  2M0T A;  1X8S A;  2KJP A;  3GDV A;  4NMO A;  3WKM A;  1GQ5 A;  3QIK A;  4Q6H A;  2JXO A;  3KDK A;  4JOF A;  3GAB A;  4GVD A;  3PDV A;  1OBZ A;  2L97 A;  1MFL A;  3HPM A;  4L8N A;  2AWX A;  3EGG C;  2O2T A;  2CS5 A;  2Z17 A;  1WHD A;  1V6B A;  4WYU A;  1K32 A;  3GCN A;  4E3B A;  2DJT A;  2QKU A;  1UHP A;  4HOP B;  4NNM A;  2KOJ A;  1PDR A;  2I1N A;  3QE1 A;  1SOT A;  1X9Z A;  4NNL A;  5EYZ A;  4NMQ A;  3TSV A;  1N6D A;  4KFW A;  4LMM A;  1QLC A;  2I04 A;  2GEF A;  1X5R A;  2LUI A;  1UJD A;  2JRE A;  3GCO A;  5HFE A;  4NXR A;  3ID1 A;  3DJA A;  2VRF A;  2Z9I A;  1X5N A;  3ID3 A;  1V1T A;  2L4S A;  2X7Z A;  1GM1 A;  1UFX A;  1U37 A;  1OBX A;  1P1D A;  1Q7X A;  1QAV B;  1MC7 A;  3KHF A;  1T2M A;  1P1E A;  4Z8J A;  2YT8 A;  4H11 A;  2EAQ A;  1UEW A;  3MH4 A;  3ID4 A;  1UEZ A;  1LCY A;  4UU5 A;  2F5Y A;  2FE5 A; 
#chains in the Genus database with same CATH homology
 5D13 A;  1WI4 A;  2IWQ A;  4O06 A;  5HF1 A;  4Q2N A;  3HPK A;  3L4F D;  3PV2 A;  2VPH A;  4FLN A;  2EDP A;  3CC0 A;  1ZOK A;  2EGK A;  1N7E A;  4NMT A;  5HJ1 A;  1UJU A;  1V5Q A;  1W9O A;  4KFV A;  1L6O A;  2LA8 A;  4Q2Q A;  1QAU A;  1MFG A;  2DLU A;  5E1Y A;  2QKV A;  2OGP A;  5GND A;  2EEH A;  1UM7 A;  5HFF A;  5F67 A;  3DJ3 A;  3TMH A;  2OZF A;  2PA1 A;  1VB7 A;  1WFV A;  2KRG A;  2RCZ A;  1VCW A;  4AMH A;  3ZRT A;  2CSS A;  2EGN A;  2Q9V A;  1SOZ A;  3I18 A;  2PDZ A;  2M0Z A;  1WH1 A;  2Q3G A;  2MX6 A;  2H2B A;  1N99 A;  2EEI A;  2DC2 A;  4XHV A;  5B42 A;  2HGA A;  3WKL A;  2GZV A;  4JOK A;  4F8K A;  2EGO A;  2PKU A;  3OU0 A;  4UU6 A;  2DAZ A;  2JOA A;  3GDU A;  1TE0 A;  3KZE A;  3R68 A;  2PKT A;  2QT5 A;  2I0I A;  1B8Q A;  4HOP A;  2PZD A;  5HEY A;  3GJ9 A;  5F3X A;  4K72 A;  3ID2 A;  4JJ0 A;  1V5L A;  2EDZ A;  5IL9 A;  3KDG A;  1VJ6 A;  3I1E A;  2OPG A;  2LOB A;  5G1E A;  2W4F A;  2EDV A;  3QGL A;  1TP3 A;  3B76 A;  3SUZ A;  1TP5 A;  2KPK A;  3VQF A;  2LC6 A;  2QKT A;  4P0C A;  5E6P B;  3SHU A;  2AWW A;  4OEO A;  3STJ A;  1WF7 A;  2I6V A;  2I0L A;  2M0U A;  2KJK A;  2H2C A;  3O5N A;  1BFE A;  3EGH C;  2K20 A;  4JOE A;  4NMS A;  5E11 A;  2OSG A;  4P2A B;  5B6L A;  3GSL A;  4GVC A;  1RGR A;  1KY9 A;  2D90 A;  1FC6 A;  3MH6 A;  2YT7 A;  2OS6 A;  4E35 A;  5HFC A;  1KEF A;  1BE9 A;  1FC9 A;  2G2L A;  3CBX A;  1U39 A;  3CBY A;  5E21 A;  4MPA A;  3O46 A;  2KAW A;  2V1W A;  4JOJ A;  3SHW A;  4Q6S A;  4NMP A;  1M5Z A;  4R2Z A;  5I7Z A;  2KQF A;  1Y7N A;  4EDJ A;  4JOG A;  2KOM A;  1X45 A;  3RL7 A;  2KA9 A;  2DKR A;  1WG6 A;  1WJL A;  1WF8 A;  2ZPM A;  2KOH A;  2R4H A;  5EZ0 A;  2EXG A;  2JIL A;  4NMV A;  2M0V A;  3NFK A;  3NGH A;  2OCS A;  3SFJ A;  2EEG A;  5HFD A;  5H3J A;  1IU2 A;  4NXP A;  3PDZ A;  1FC7 A;  1VAE A;  2HE4 A;  4K75 A;  4Q3H A;  1X5Q A;  3QDO A;  3DJ1 A;  4REY A;  3NFL A;  3K1R A;  2KL1 A;  1UJV A;  1TQ3 A;  3LNY A;  1Z87 A;  3R0H A;  3K50 A;  3MH7 A;  2YTW A;  1Q3P A;  5GLJ A;  1X6D A;  4N6X A;  1N7F A;  3CH8 A;  2EJY A;  2QBW A;  2E7K A;  2G5M B;  4K6Y A;  4Q2O A;  2VSP A;  2DMZ A;  2DM8 A;  1UIT A;  2DB5 A;  1Z86 A;  1UF1 A;  2D92 A;  2RRM A;  2JIK A;  4NXQ A;  2M10 A;  3DIW A;  5HFB A;  5HED A;  1WFG A;  2EHR A;  2D8I A;  2JSN A;  4OAJ A;  1D5G A;  1RY4 A;  2CSJ A;  1N6E A;  1GQ4 A;  1RZX A;  1KWA A;  3QJM A;  5ILB A;  1N7T A;  2PNT A;  2JWE A;  3TSZ A;  1R6J A;  3K82 A;  2WL7 A;  3VQG A;  2YUY A;  5DTH A;  4YDP A;  2OMJ A;  4Z33 A;  3R69 A;  1W9Q A;  2UZC A;  4RI0 A;  3PV4 A;  2LC7 A;  1I92 A;  1QAV A;  2V90 A;  2FN5 A;  2R3Y A;  3PS4 A;  3JXT A;  2KG2 A;  3OTP A;  2M3M A;  2AIN A;  3QJN A;  3DOR A;  2W7R A;  2P3W A;  4IC6 A;  2ZPL A;  4GHN A;  1XZ9 A;  3GGE A;  3KZD A;  5HF4 A;  1I16 A;  4FGM A;  3LNX A;  1G9O A;  2IWO A;  5FHT A;  1IHJ A;  4JJ3 A;  2EV8 A;  3RLE A;  3NCV A;  4K76 A;  1UM1 A;  2EEJ A;  1WI2 A;  2ENO A;  5HEB A;  5E22 A;  3QO6 A;  2QG1 A;  2DLS A;  1U3B A;  2HE2 A;  1UEP A;  1FCF A;  5HET A;  2KV8 A;  1W9E A;  5JXB A;  2KPL A;  4JOR A;  2OQS A;  2F0A A;  2MHO A;  4YYX A;  2FNE A;  1NTE A;  3SOE A;  4JOP A;  2I4S A;  4JL7 A;  1RGW A;  1U38 A;  2H3L A;  2H3M A;  2KYL A;  1WHA A;  1YBO A;  3CS0 A;  1UEQ A;  2KBS A;  2VSV A;  5A2P A;  3HVQ C;  1OBY A;  1ZUB A;  3BPU A;  3E17 A;  5HDY A;  2VZ5 A;  1VA8 A;  4G69 A;  2JIN A;  2IWP A;  1N6F A;  1OZI A;  2REY A;  3AXA A;  4K78 A;  2FCF A;  1NF3 C;  3CYY A;  1V62 A;  3CBZ A;  2L4T A;  3TSW A;  3RL8 A;  4OEP A;  4Q2P A;  4E34 A;  1WIF A;  3PV5 A;  3GDS A;  4NMR A;  1IU0 A;  2K1Z A;  1Y8T A;  2KJD A;  3I4W A;  4WYT A;  3FY5 A;  1Q3O A;  2VWR A;  5G1D A;  2IWN A;  2YUB A;  4JOH A;  5FB8 C;  2AWU A;  4PQW A;  2BYG A;  2M0T A;  1X8S A;  2KJP A;  3GDV A;  4NMO A;  3WKM A;  1GQ5 A;  3QIK A;  4Q6H A;  2JXO A;  3KDK A;  4JOF A;  3GAB A;  4GVD A;  3PDV A;  1OBZ A;  2L97 A;  1MFL A;  3HPM A;  4L8N A;  2AWX A;  3EGG C;  2O2T A;  2CS5 A;  2Z17 A;  1WHD A;  1V6B A;  4WYU A;  1K32 A;  3GCN A;  4E3B A;  2DJT A;  2QKU A;  1UHP A;  4HOP B;  4NNM A;  2KOJ A;  1PDR A;  2I1N A;  3QE1 A;  1SOT A;  1X9Z A;  4NNL A;  5EYZ A;  4NMQ A;  3TSV A;  1N6D A;  4KFW A;  4LMM A;  1QLC A;  2I04 A;  2GEF A;  1X5R A;  2LUI A;  1UJD A;  2JRE A;  3GCO A;  5HFE A;  4NXR A;  3ID1 A;  3DJA A;  2VRF A;  2Z9I A;  1X5N A;  3ID3 A;  1V1T A;  2L4S A;  2X7Z A;  1GM1 A;  1UFX A;  1U37 A;  1OBX A;  1P1D A;  1Q7X A;  1QAV B;  1MC7 A;  3KHF A;  1T2M A;  1P1E A;  4Z8J A;  2YT8 A;  4H11 A;  2EAQ A;  1UEW A;  3MH4 A;  3ID4 A;  1UEZ A;  1LCY A;  4UU5 A;  2F5Y A;  2FE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...