2LC7A

Solution structure of the isolated par-6 pdz domain
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
ETHRRVRLLKHGSDKPLGFYIRDGTSVRVTASGLEKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITVKPANQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Par-6
publication title A Conformational Switch in the CRIB-PDZ Module of Par-6.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Cell adhesion
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2011-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2lc7A00
1FC9A 1VB7A 2M0TA 2QKVA 3VQGA 2K1ZA 3R69A 3DJAA 3QIKA 3STJA 2M0UA 1TP5A 2EGNA 5FB8C 1RY4A 5B6LA 3MH6A 2HE4A 2GZVA 4PQWA 3RL7A 3QO6A 1VAEA 2E7KA 2KA9A 1V1TA 4L8NA 2CS5A 2KOJA 2M10A 1K32A 1YBOA 3PDVA 2QG1A 2H2BA 5JXBA 2OPGA 3NFKA 1UJDA 5I7ZA 1UEZA 1TE0A 1WIFA 2EDVA 2I4SA 1N6EA 5HEBA 3DJ3A 2KOHA 3QDOA 2QKUA 5F67A 1QAVA 4JL7A 2IWOA 3ZRTA 1W9EA 1NF3C 2KL1A 1Q7XA 1U38A 1X45A 4P2AB 2EEIA 1U37A 1X8SA 4YYXA 1KY9A 3OU0A 2DKRA 5HETA 2LOBA 1BE9A 2CSSA 3RL8A 3O5NA 4JOGA 2L4SA 4KFVA 2I6VA 4Q2OA 3DIWA 3R0HA 2D90A 1WF7A 5HF4A 2JINA 3EGHC 2D8IA 1UJVA 2DLSA 1UEWA 2EJYA 1UHPA 2EHRA 5F3XA 2BYGA 2R4HA 4E35A 2JIKA 1WFGA 3K1RA 2W7RA 5HFCA 5HF1A 1PDRA 1VJ6A 1OBZA 4OAJA 1Q3OA 3NFLA 2F5YA 1IU0A 2DB5A 4NMOA 3PV4A 4JORA 2PKTA 1KWAA 3GGEA 4F8KA 1KEFA 4HOPB 3OTPA 4WYUA 2KPKA 2KJPA 4OEOA 2KYLA 2G5MB 3KHFA 2AWWA 5FHTA 1B8QA 1WG6A 3GSLA 3TSVA 1WJLA 3JXTA 4Q3HA 3CC0A 2PA1A 4WYTA 4KFWA 2KG2A 2JOAA 2MHOA 3KZDA 5E21A 1ZOKA 4JOHA 4UU5A 1N7TA 5DTHA 2D92A 2VSPA 2JXOA 2PNTA 2HGAA 4GVDA 2OGPA 2R3YA 3QJNA 5GNDA 1N99A 5HFEA 3AXAA 4K6YA 3PV5A 3EGGC 2EGKA 4NMPA 1Y7NA 4JOFA 5HJ1A 4Q2NA 3SUZA 1NTEA 5HDYA 1WFVA 2LA8A 1FCFA 1X5RA 1Z87A 2PDZA 5HEDA 2M3MA 4NMVA 3LNXA 2EEGA 3MH4A 1WI4A 3BPUA 3ID1A 2KBSA 2JWEA 4O06A 2YUBA 2H3MA 4N6XA 5EZ0A 1L6OA 4Q6SA 1N6FA 1TP3A 2JILA 2KJDA 2W4FA 3O46A 1X5NA 4NXPA 2X7ZA 5G1DA 2L4TA 2V90A 2VSVA 4Q6HA 1W9QA 2QKTA 2Z17A 4IC6A 4Q2PA 1VCWA 1Q3PA 1MFLA 2WL7A 2EXGA 3SFJA 4Z33A 5A2PA 2F0AA 2G2LA 2KOMA 1WH1A 1WHDA 2ENOA 1RGRA 3CYYA 3L4FD 3TSWA 3CH8A 3PDZA 1UEQA 1FC7A 1IHJA 1SOTA 1M5ZA 5GLJA 2CSJA 2KPLA 4H11A 5G1EA 1GQ4A 3CBXA 5HFFA 3VQFA 2I1NA 1N7EA 2FN5A 2HE2A 2OMJA 1SOZA 2H2CA 4K75A 3I18A 2AINA 2YUYA 3I4WA 3HVQC 2FNEA 2KAWA 2DMZA 2LUIA 4NMTA 3GJ9A 2PZDA 4HOPA 1W9OA 2L97A 1N7FA 4NMQA 2EDPA 1UFXA 2ZPLA 4GVCA 1I92A 2DC2A 2DJTA 1Y8TA 3MH7A 1U3BA 3QE1A 2DAZA 2JREA 1V6BA 2M0ZA 1BFEA 3QJMA 3GDUA 4REYA 2I04A 5EYZA 1WHAA 3GCOA 2KV8A 1P1DA 1QAUA 4NMRA 4RI0A 1R6JA 2VPHA 3SOEA 1QLCA 2REYA 3GDSA 3ID3A 2RCZA 1LCYA 1V62A 2I0LA 3LNYA 4NXRA 4EDJA 1N6DA 3DORA 2O2TA 2IWNA 1XZ9A 4K78A 2ZPMA 2KQFA 1OZIA 2EV8A 1TQ3A 3GCNA 1UITA 2Z9IA 3WKMA 1FC6A 1MC7A 2DLUA 4G69A 5E6PB 2KRGA 1G9OA 3R68A 2QBWA 1UJUA 2AWUA 4K72A 5E1YA 2LC6A 1V5QA 1P1EA 2K20A 4MPAA 3FY5A 1V5LA 3K50A 3NGHA 4R2ZA 2EGOA 2AWXA 1WI2A 4LMMA 2YT8A 3K82A 1VA8A 5HEYA 1UM1A 2IWPA 2IWQA 3KZEA 5H3JA 4Z8JA 1WF8A 1T2MA 2KJKA 4NNLA 3GDVA 4NNMA 1UM7A 4YDPA 3CS0A 3PV2A 1I16A 4UU6A 4JOJA 2OSGA 1QAVB 1OBYA 1D5GA 4OEPA 4JOPA 5D13A 2YT7A 3TMHA 3RLEA 2VRFA 4Q2QA 2VWRA 2LC7A 2EAQA 2VZ5A 2FCFA 3ID4A 2MX6A 2V1WA 3SHWA 4E34A 2PKUA 1RGWA 4NXQA 1Z86A 1IU2A 1GM1A 4JOEA 3QGLA 1OBXA 1U39A 2H3LA 3B76A 2UZCA 5HFDA 1MFGA 2Q9VA 1ZUBA 4NMSA 2OCSA 2RRMA 3SHUA 1RZXA 2YTWA 2P3WA 2Q3GA 2FE5A 3CBZA 2OS6A 3HPKA 2OZFA 3WKLA 5E11A 3DJ1A 2EEHA 4XHVA 4K76A 4GHNA 1X6DA 2OQSA 2I0IA 2QT5A 4AMHA 5HFBA 3TSZA 3PS4A 3E17A 4P0CA 2EEJA 5E22A 2DM8A 3I1EA 2M0VA 1UF1A 4FGMA 3ID2A 1X5QA 4E3BA 3HPMA 1GQ5A 4JOKA 3CBYA 2EDZA 1UEPA
chains in the Genus database with same CATH superfamily
1FC9A 1VB7A 2M0TA 2QKVA 3VQGA 2K1ZA 3R69A 3DJAA 3QIKA 3STJA 2M0UA 1TP5A 2EGNA 5FB8C 2GEFA 1RY4A 5B6LA 4JJ0A 3MH6A 2HE4A 2GZVA 4PQWA 3RL7A 3QO6A 1VAEA 2E7KA 2KA9A 1V1TA 4L8NA 2CS5A 2KOJA 2M10A 1K32A 1YBOA 3PDVA 2QG1A 2H2BA 5JXBA 2OPGA 3NFKA 1UJDA 5I7ZA 1UEZA 1TE0A 1WIFA 2EDVA 2I4SA 1N6EA 5HEBA 3DJ3A 2KOHA 3QDOA 2QKUA 5F67A 1QAVA 4JL7A 2IWOA 3NCVA 3ZRTA 1W9EA 1NF3C 2KL1A 1Q7XA 1U38A 1X45A 4P2AB 2EEIA 1U37A 1X8SA 4YYXA 1KY9A 3OU0A 2DKRA 5HETA 2LOBA 1BE9A 2CSSA 3RL8A 3O5NA 4JOGA 2L4SA 4KFVA 2I6VA 4Q2OA 3DIWA 3R0HA 2D90A 1WF7A 5HF4A 2JINA 3EGHC 2D8IA 1UJVA 2DLSA 1UEWA 3KDGA 2EJYA 1UHPA 4FLNA 2EHRA 5F3XA 2BYGA 2R4HA 4E35A 2JIKA 1WFGA 3K1RA 2W7RA 5HFCA 5HF1A 1PDRA 1VJ6A 1OBZA 4OAJA 1Q3OA 3NFLA 2F5YA 1IU0A 2DB5A 4NMOA 3PV4A 4JORA 2PKTA 1KWAA 3GGEA 4F8KA 1KEFA 4HOPB 3OTPA 4WYUA 2KPKA 2KJPA 4OEOA 2KYLA 2G5MB 3KHFA 2AWWA 5FHTA 1B8QA 1WG6A 3GSLA 3TSVA 1WJLA 3JXTA 4Q3HA 3CC0A 2PA1A 4WYTA 4KFWA 2KG2A 2JOAA 2MHOA 3KZDA 5E21A 1ZOKA 4JOHA 4UU5A 1N7TA 5DTHA 5ILBA 2D92A 2VSPA 2JXOA 2PNTA 2HGAA 4GVDA 2OGPA 2R3YA 3QJNA 5GNDA 1N99A 5HFEA 3AXAA 4K6YA 3PV5A 3EGGC 2EGKA 4NMPA 1Y7NA 4JOFA 5HJ1A 4Q2NA 3SUZA 1NTEA 5HDYA 1WFVA 2LA8A 1FCFA 1X5RA 1Z87A 2PDZA 5HEDA 2M3MA 4NMVA 3LNXA 2EEGA 3MH4A 1WI4A 3BPUA 3ID1A 2KBSA 2JWEA 4O06A 2YUBA 2H3MA 4N6XA 5EZ0A 1L6OA 4Q6SA 1N6FA 1TP3A 2JILA 2KJDA 2W4FA 3O46A 1X5NA 1X9ZA 4NXPA 5IL9A 2X7ZA 5G1DA 2L4TA 2V90A 2VSVA 4Q6HA 1W9QA 2QKTA 2Z17A 4IC6A 4Q2PA 1VCWA 1Q3PA 1MFLA 2WL7A 2EXGA 3SFJA 4Z33A 5A2PA 2F0AA 2G2LA 2KOMA 1WH1A 1WHDA 2ENOA 1RGRA 3CYYA 3L4FD 3TSWA 3CH8A 3PDZA 1UEQA 1FC7A 1IHJA 1SOTA 1M5ZA 5GLJA 2CSJA 2KPLA 4H11A 5G1EA 1GQ4A 3CBXA 5HFFA 3VQFA 2I1NA 1N7EA 2FN5A 2HE2A 2OMJA 1SOZA 2H2CA 4K75A 3I18A 2AINA 2YUYA 3I4WA 3HVQC 2FNEA 2KAWA 2DMZA 2LUIA 4NMTA 3GJ9A 2PZDA 4HOPA 1W9OA 2L97A 1N7FA 4NMQA 2EDPA 1UFXA 2ZPLA 4GVCA 1I92A 2DC2A 2DJTA 1Y8TA 3MH7A 1U3BA 3QE1A 2DAZA 2JREA 1V6BA 2M0ZA 1BFEA 3QJMA 3GDUA 4REYA 2I04A 5EYZA 1WHAA 3GCOA 2KV8A 1P1DA 1QAUA 4NMRA 4RI0A 1R6JA 2VPHA 3SOEA 1QLCA 2REYA 3GDSA 3ID3A 2RCZA 1LCYA 1V62A 2I0LA 3LNYA 4NXRA 4EDJA 1N6DA 3DORA 2O2TA 2IWNA 1XZ9A 4K78A 2ZPMA 2KQFA 1OZIA 2EV8A 1TQ3A 3GCNA 1UITA 2Z9IA 3WKMA 1FC6A 1MC7A 2DLUA 4G69A 5E6PB 2KRGA 1G9OA 3R68A 2QBWA 1UJUA 2AWUA 4K72A 5E1YA 2LC6A 1V5QA 1P1EA 2K20A 4MPAA 3FY5A 1V5LA 3K50A 3NGHA 4R2ZA 2EGOA 2AWXA 1WI2A 4LMMA 2YT8A 3K82A 1VA8A 5HEYA 1UM1A 2IWPA 2IWQA 3KZEA 5H3JA 4Z8JA 1WF8A 1T2MA 2KJKA 4NNLA 3GDVA 4NNMA 1UM7A 4YDPA 3CS0A 3PV2A 1I16A 4UU6A 4JOJA 2OSGA 1QAVB 1OBYA 1D5GA 4OEPA 4JOPA 5D13A 2YT7A 3TMHA 3RLEA 2VRFA 4Q2QA 2VWRA 2LC7A 2EAQA 2VZ5A 3GABA 2FCFA 3ID4A 2MX6A 2V1WA 3SHWA 4E34A 3KDKA 2PKUA 1RGWA 4NXQA 1Z86A 1IU2A 1GM1A 4JOEA 3QGLA 1OBXA 1U39A 2H3LA 3B76A 2UZCA 5HFDA 1MFGA 2Q9VA 1ZUBA 4NMSA 2OCSA 2RRMA 3SHUA 1RZXA 2YTWA 2P3WA 2Q3GA 2FE5A 3CBZA 2OS6A 2JSNA 3HPKA 4JJ3A 2OZFA 3WKLA 5E11A 3DJ1A 2EEHA 4XHVA 4K76A 4GHNA 1X6DA 2OQSA 2I0IA 2QT5A 4AMHA 5HFBA 3TSZA 3PS4A 3E17A 4P0CA 2EEJA 5E22A 2DM8A 3I1EA 2M0VA 1UF1A 4FGMA 3ID2A 1X5QA 5B42A 4E3BA 3HPMA 1GQ5A 4JOKA 3CBYA 2EDZA 1UEPA
chains in the Genus database with same CATH topology
1FC9A 1VB7A 2M0TA 2QKVA 3VQGA 2K1ZA 3R69A 3DJAA 3QIKA 3STJA 2M0UA 1TP5A 2EGNA 5FB8C 2GEFA 1RY4A 5B6LA 4JJ0A 3MH6A 2HE4A 2GZVA 4PQWA 3RL7A 3QO6A 1VAEA 2E7KA 2KA9A 1V1TA 4L8NA 2CS5A 2KOJA 2M10A 1K32A 1YBOA 3PDVA 2QG1A 2H2BA 5JXBA 2OPGA 3NFKA 1UJDA 5I7ZA 1UEZA 1TE0A 1WIFA 2EDVA 2I4SA 1N6EA 5HEBA 3DJ3A 2KOHA 3QDOA 2QKUA 5F67A 1QAVA 4JL7A 2IWOA 3NCVA 3ZRTA 1W9EA 1NF3C 2KL1A 1Q7XA 1U38A 1X45A 4P2AB 2EEIA 1U37A 1X8SA 4YYXA 1KY9A 3OU0A 2DKRA 5HETA 2LOBA 1BE9A 2CSSA 3RL8A 3O5NA 4JOGA 2L4SA 4KFVA 2I6VA 4Q2OA 3DIWA 3R0HA 2D90A 1WF7A 5HF4A 2JINA 3EGHC 2D8IA 1UJVA 2DLSA 1UEWA 3KDGA 2EJYA 1UHPA 4FLNA 2EHRA 5F3XA 2BYGA 2R4HA 4E35A 2JIKA 1WFGA 3K1RA 2W7RA 5HFCA 5HF1A 1PDRA 1VJ6A 1OBZA 4OAJA 1Q3OA 3NFLA 2F5YA 1IU0A 2DB5A 4NMOA 3PV4A 4JORA 2PKTA 1KWAA 3GGEA 4F8KA 1KEFA 4HOPB 3OTPA 4WYUA 2KPKA 2KJPA 4OEOA 2KYLA 2G5MB 3KHFA 2AWWA 5FHTA 1B8QA 1WG6A 3GSLA 3TSVA 1WJLA 3JXTA 4Q3HA 3CC0A 2PA1A 4WYTA 4KFWA 2KG2A 2JOAA 2MHOA 3KZDA 5E21A 1ZOKA 4JOHA 4UU5A 1N7TA 5DTHA 5ILBA 2D92A 2VSPA 2JXOA 2PNTA 2HGAA 4GVDA 2OGPA 2R3YA 3QJNA 5GNDA 1N99A 5HFEA 3AXAA 4K6YA 3PV5A 3EGGC 2EGKA 4NMPA 1Y7NA 4JOFA 5HJ1A 4Q2NA 3SUZA 1NTEA 5HDYA 1WFVA 2LA8A 1FCFA 1X5RA 1Z87A 2PDZA 5HEDA 2M3MA 4NMVA 3LNXA 2EEGA 3MH4A 1WI4A 3BPUA 3ID1A 2KBSA 2JWEA 4O06A 2YUBA 2H3MA 4N6XA 5EZ0A 1L6OA 4Q6SA 1N6FA 1TP3A 2JILA 2KJDA 2W4FA 3O46A 1X5NA 1X9ZA 4NXPA 5IL9A 2X7ZA 5G1DA 2L4TA 2V90A 2VSVA 4Q6HA 1W9QA 2QKTA 2Z17A 4IC6A 4Q2PA 1VCWA 1Q3PA 1MFLA 2WL7A 2EXGA 3SFJA 4Z33A 5A2PA 2F0AA 2G2LA 2KOMA 1WH1A 1WHDA 2ENOA 1RGRA 3CYYA 3L4FD 3TSWA 3CH8A 3PDZA 1UEQA 1FC7A 1IHJA 1SOTA 1M5ZA 5GLJA 2CSJA 2KPLA 4H11A 5G1EA 1GQ4A 3CBXA 5HFFA 3VQFA 2I1NA 1N7EA 2FN5A 2HE2A 2OMJA 1SOZA 2H2CA 4K75A 3I18A 2AINA 2YUYA 3I4WA 3HVQC 2FNEA 2KAWA 2DMZA 2LUIA 4NMTA 3GJ9A 2PZDA 4HOPA 1W9OA 2L97A 1N7FA 4NMQA 2EDPA 1UFXA 2ZPLA 4GVCA 1I92A 2DC2A 2DJTA 1Y8TA 3MH7A 1U3BA 3QE1A 2DAZA 2JREA 1V6BA 2M0ZA 1BFEA 3QJMA 3GDUA 4REYA 2I04A 5EYZA 1WHAA 3GCOA 2KV8A 1P1DA 1QAUA 4NMRA 4RI0A 1R6JA 2VPHA 3SOEA 1QLCA 2REYA 3GDSA 3ID3A 2RCZA 1LCYA 1V62A 2I0LA 3LNYA 4NXRA 4EDJA 1N6DA 3DORA 2O2TA 2IWNA 1XZ9A 4K78A 2ZPMA 2KQFA 1OZIA 2EV8A 1TQ3A 3GCNA 1UITA 2Z9IA 3WKMA 1FC6A 1MC7A 2DLUA 4G69A 5E6PB 2KRGA 1G9OA 3R68A 2QBWA 1UJUA 2AWUA 4K72A 5E1YA 2LC6A 1V5QA 1P1EA 2K20A 4MPAA 3FY5A 1V5LA 3K50A 3NGHA 4R2ZA 2EGOA 2AWXA 1WI2A 4LMMA 2YT8A 3K82A 1VA8A 5HEYA 1UM1A 2IWPA 2IWQA 3KZEA 5H3JA 4Z8JA 1WF8A 1T2MA 2KJKA 4NNLA 3GDVA 4NNMA 1UM7A 4YDPA 3CS0A 3PV2A 1I16A 4UU6A 4JOJA 2OSGA 1QAVB 1OBYA 1D5GA 4OEPA 4JOPA 5D13A 2YT7A 3TMHA 3RLEA 2VRFA 4Q2QA 2VWRA 2LC7A 2EAQA 2VZ5A 3GABA 2FCFA 3ID4A 2MX6A 2V1WA 3SHWA 4E34A 3KDKA 2PKUA 1RGWA 4NXQA 1Z86A 1IU2A 1GM1A 4JOEA 3QGLA 1OBXA 1U39A 2H3LA 3B76A 2UZCA 5HFDA 1MFGA 2Q9VA 1ZUBA 4NMSA 2OCSA 2RRMA 3SHUA 1RZXA 2YTWA 2P3WA 2Q3GA 2FE5A 3CBZA 2OS6A 2JSNA 3HPKA 4JJ3A 2OZFA 3WKLA 5E11A 3DJ1A 2EEHA 4XHVA 4K76A 4GHNA 1X6DA 2OQSA 2I0IA 2QT5A 4AMHA 5HFBA 3TSZA 3PS4A 3E17A 4P0CA 2EEJA 5E22A 2DM8A 3I1EA 2M0VA 1UF1A 4FGMA 3ID2A 1X5QA 5B42A 4E3BA 3HPMA 1GQ5A 4JOKA 3CBYA 2EDZA 1UEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC9 A;  1VB7 A;  2M0T A;  2QKV A;  3VQG A;  2K1Z A;  3R69 A;  3DJA A;  3QIK A;  3STJ A;  2M0U A;  1TP5 A;  2EGN A;  5FB8 C;  1RY4 A;  5B6L A;  3MH6 A;  2HE4 A;  2GZV A;  4PQW A;  3RL7 A;  3QO6 A;  1VAE A;  2E7K A;  2KA9 A;  1V1T A;  4L8N A;  2CS5 A;  2KOJ A;  2M10 A;  1K32 A;  1YBO A;  3PDV A;  2QG1 A;  2H2B A;  5JXB A;  2OPG A;  3NFK A;  1UJD A;  5I7Z A;  1UEZ A;  1TE0 A;  1WIF A;  2EDV A;  2I4S A;  1N6E A;  5HEB A;  3DJ3 A;  2KOH A;  3QDO A;  2QKU A;  5F67 A;  1QAV A;  4JL7 A;  2IWO A;  3ZRT A;  1W9E A;  1NF3 C;  2KL1 A;  1Q7X A;  1U38 A;  1X45 A;  4P2A B;  2EEI A;  1U37 A;  1X8S A;  4YYX A;  1KY9 A;  3OU0 A;  2DKR A;  5HET A;  2LOB A;  1BE9 A;  2CSS A;  3RL8 A;  3O5N A;  4JOG A;  2L4S A;  4KFV A;  2I6V A;  4Q2O A;  3DIW A;  3R0H A;  2D90 A;  1WF7 A;  5HF4 A;  2JIN A;  3EGH C;  2D8I A;  1UJV A;  2DLS A;  1UEW A;  2EJY A;  1UHP A;  2EHR A;  5F3X A;  2BYG A;  2R4H A;  4E35 A;  2JIK A;  1WFG A;  3K1R A;  2W7R A;  5HFC A;  5HF1 A;  1PDR A;  1VJ6 A;  1OBZ A;  4OAJ A;  1Q3O A;  3NFL A;  2F5Y A;  1IU0 A;  2DB5 A;  4NMO A;  3PV4 A;  4JOR A;  2PKT A;  1KWA A;  3GGE A;  4F8K A;  1KEF A;  4HOP B;  3OTP A;  4WYU A;  2KPK A;  2KJP A;  4OEO A;  2KYL A;  2G5M B;  3KHF A;  2AWW A;  5FHT A;  1B8Q A;  1WG6 A;  3GSL A;  3TSV A;  1WJL A;  3JXT A;  4Q3H A;  3CC0 A;  2PA1 A;  4WYT A;  4KFW A;  2KG2 A;  2JOA A;  2MHO A;  3KZD A;  5E21 A;  1ZOK A;  4JOH A;  4UU5 A;  1N7T A;  5DTH A;  2D92 A;  2VSP A;  2JXO A;  2PNT A;  2HGA A;  4GVD A;  2OGP A;  2R3Y A;  3QJN A;  5GND A;  1N99 A;  5HFE A;  3AXA A;  4K6Y A;  3PV5 A;  3EGG C;  2EGK A;  4NMP A;  1Y7N A;  4JOF A;  5HJ1 A;  4Q2N A;  3SUZ A;  1NTE A;  5HDY A;  1WFV A;  2LA8 A;  1FCF A;  1X5R A;  1Z87 A;  2PDZ A;  5HED A;  2M3M A;  4NMV A;  3LNX A;  2EEG A;  3MH4 A;  1WI4 A;  3BPU A;  3ID1 A;  2KBS A;  2JWE A;  4O06 A;  2YUB A;  2H3M A;  4N6X A;  5EZ0 A;  1L6O A;  4Q6S A;  1N6F A;  1TP3 A;  2JIL A;  2KJD A;  2W4F A;  3O46 A;  1X5N A;  4NXP A;  2X7Z A;  5G1D A;  2L4T A;  2V90 A;  2VSV A;  4Q6H A;  1W9Q A;  2QKT A;  2Z17 A;  4IC6 A;  4Q2P A;  1VCW A;  1Q3P A;  1MFL A;  2WL7 A;  2EXG A;  3SFJ A;  4Z33 A;  5A2P A;  2F0A A;  2G2L A;  2KOM A;  1WH1 A;  1WHD A;  2ENO A;  1RGR A;  3CYY A;  3L4F D;  3TSW A;  3CH8 A;  3PDZ A;  1UEQ A;  1FC7 A;  1IHJ A;  1SOT A;  1M5Z A;  5GLJ A;  2CSJ A;  2KPL A;  4H11 A;  5G1E A;  1GQ4 A;  3CBX A;  5HFF A;  3VQF A;  2I1N A;  1N7E A;  2FN5 A;  2HE2 A;  2OMJ A;  1SOZ A;  2H2C A;  4K75 A;  3I18 A;  2AIN A;  2YUY A;  3I4W A;  3HVQ C;  2FNE A;  2KAW A;  2DMZ A;  2LUI A;  4NMT A;  3GJ9 A;  2PZD A;  4HOP A;  1W9O A;  2L97 A;  1N7F A;  4NMQ A;  2EDP A;  1UFX A;  2ZPL A;  4GVC A;  1I92 A;  2DC2 A;  2DJT A;  1Y8T A;  3MH7 A;  1U3B A;  3QE1 A;  2DAZ A;  2JRE A;  1V6B A;  2M0Z A;  1BFE A;  3QJM A;  3GDU A;  4REY A;  2I04 A;  5EYZ A;  1WHA A;  3GCO A;  2KV8 A;  1P1D A;  1QAU A;  4NMR A;  4RI0 A;  1R6J A;  2VPH A;  3SOE A;  1QLC A;  2REY A;  3GDS A;  3ID3 A;  2RCZ A;  1LCY A;  1V62 A;  2I0L A;  3LNY A;  4NXR A;  4EDJ A;  1N6D A;  3DOR A;  2O2T A;  2IWN A;  1XZ9 A;  4K78 A;  2ZPM A;  2KQF A;  1OZI A;  2EV8 A;  1TQ3 A;  3GCN A;  1UIT A;  2Z9I A;  3WKM A;  1FC6 A;  1MC7 A;  2DLU A;  4G69 A;  5E6P B;  2KRG A;  1G9O A;  3R68 A;  2QBW A;  1UJU A;  2AWU A;  4K72 A;  5E1Y A;  2LC6 A;  1V5Q A;  1P1E A;  2K20 A;  4MPA A;  3FY5 A;  1V5L A;  3K50 A;  3NGH A;  4R2Z A;  2EGO A;  2AWX A;  1WI2 A;  4LMM A;  2YT8 A;  3K82 A;  1VA8 A;  5HEY A;  1UM1 A;  2IWP A;  2IWQ A;  3KZE A;  5H3J A;  4Z8J A;  1WF8 A;  1T2M A;  2KJK A;  4NNL A;  3GDV A;  4NNM A;  1UM7 A;  4YDP A;  3CS0 A;  3PV2 A;  1I16 A;  4UU6 A;  4JOJ A;  2OSG A;  1QAV B;  1OBY A;  1D5G A;  4OEP A;  4JOP A;  5D13 A;  2YT7 A;  3TMH A;  3RLE A;  2VRF A;  4Q2Q A;  2VWR A;  2LC7 A;  2EAQ A;  2VZ5 A;  2FCF A;  3ID4 A;  2MX6 A;  2V1W A;  3SHW A;  4E34 A;  2PKU A;  1RGW A;  4NXQ A;  1Z86 A;  1IU2 A;  1GM1 A;  4JOE A;  3QGL A;  1OBX A;  1U39 A;  2H3L A;  3B76 A;  2UZC A;  5HFD A;  1MFG A;  2Q9V A;  1ZUB A;  4NMS A;  2OCS A;  2RRM A;  3SHU A;  1RZX A;  2YTW A;  2P3W A;  2Q3G A;  2FE5 A;  3CBZ A;  2OS6 A;  3HPK A;  2OZF A;  3WKL A;  5E11 A;  3DJ1 A;  2EEH A;  4XHV A;  4K76 A;  4GHN A;  1X6D A;  2OQS A;  2I0I A;  2QT5 A;  4AMH A;  5HFB A;  3TSZ A;  3PS4 A;  3E17 A;  4P0C A;  2EEJ A;  5E22 A;  2DM8 A;  3I1E A;  2M0V A;  1UF1 A;  4FGM A;  3ID2 A;  1X5Q A;  4E3B A;  3HPM A;  1GQ5 A;  4JOK A;  3CBY A;  2EDZ A;  1UEP A; 
#chains in the Genus database with same CATH topology
 1FC9 A;  1VB7 A;  2M0T A;  2QKV A;  3VQG A;  2K1Z A;  3R69 A;  3DJA A;  3QIK A;  3STJ A;  2M0U A;  1TP5 A;  2EGN A;  5FB8 C;  2GEF A;  1RY4 A;  5B6L A;  4JJ0 A;  3MH6 A;  2HE4 A;  2GZV A;  4PQW A;  3RL7 A;  3QO6 A;  1VAE A;  2E7K A;  2KA9 A;  1V1T A;  4L8N A;  2CS5 A;  2KOJ A;  2M10 A;  1K32 A;  1YBO A;  3PDV A;  2QG1 A;  2H2B A;  5JXB A;  2OPG A;  3NFK A;  1UJD A;  5I7Z A;  1UEZ A;  1TE0 A;  1WIF A;  2EDV A;  2I4S A;  1N6E A;  5HEB A;  3DJ3 A;  2KOH A;  3QDO A;  2QKU A;  5F67 A;  1QAV A;  4JL7 A;  2IWO A;  3NCV A;  3ZRT A;  1W9E A;  1NF3 C;  2KL1 A;  1Q7X A;  1U38 A;  1X45 A;  4P2A B;  2EEI A;  1U37 A;  1X8S A;  4YYX A;  1KY9 A;  3OU0 A;  2DKR A;  5HET A;  2LOB A;  1BE9 A;  2CSS A;  3RL8 A;  3O5N A;  4JOG A;  2L4S A;  4KFV A;  2I6V A;  4Q2O A;  3DIW A;  3R0H A;  2D90 A;  1WF7 A;  5HF4 A;  2JIN A;  3EGH C;  2D8I A;  1UJV A;  2DLS A;  1UEW A;  3KDG A;  2EJY A;  1UHP A;  4FLN A;  2EHR A;  5F3X A;  2BYG A;  2R4H A;  4E35 A;  2JIK A;  1WFG A;  3K1R A;  2W7R A;  5HFC A;  5HF1 A;  1PDR A;  1VJ6 A;  1OBZ A;  4OAJ A;  1Q3O A;  3NFL A;  2F5Y A;  1IU0 A;  2DB5 A;  4NMO A;  3PV4 A;  4JOR A;  2PKT A;  1KWA A;  3GGE A;  4F8K A;  1KEF A;  4HOP B;  3OTP A;  4WYU A;  2KPK A;  2KJP A;  4OEO A;  2KYL A;  2G5M B;  3KHF A;  2AWW A;  5FHT A;  1B8Q A;  1WG6 A;  3GSL A;  3TSV A;  1WJL A;  3JXT A;  4Q3H A;  3CC0 A;  2PA1 A;  4WYT A;  4KFW A;  2KG2 A;  2JOA A;  2MHO A;  3KZD A;  5E21 A;  1ZOK A;  4JOH A;  4UU5 A;  1N7T A;  5DTH A;  5ILB A;  2D92 A;  2VSP A;  2JXO A;  2PNT A;  2HGA A;  4GVD A;  2OGP A;  2R3Y A;  3QJN A;  5GND A;  1N99 A;  5HFE A;  3AXA A;  4K6Y A;  3PV5 A;  3EGG C;  2EGK A;  4NMP A;  1Y7N A;  4JOF A;  5HJ1 A;  4Q2N A;  3SUZ A;  1NTE A;  5HDY A;  1WFV A;  2LA8 A;  1FCF A;  1X5R A;  1Z87 A;  2PDZ A;  5HED A;  2M3M A;  4NMV A;  3LNX A;  2EEG A;  3MH4 A;  1WI4 A;  3BPU A;  3ID1 A;  2KBS A;  2JWE A;  4O06 A;  2YUB A;  2H3M A;  4N6X A;  5EZ0 A;  1L6O A;  4Q6S A;  1N6F A;  1TP3 A;  2JIL A;  2KJD A;  2W4F A;  3O46 A;  1X5N A;  1X9Z A;  4NXP A;  5IL9 A;  2X7Z A;  5G1D A;  2L4T A;  2V90 A;  2VSV A;  4Q6H A;  1W9Q A;  2QKT A;  2Z17 A;  4IC6 A;  4Q2P A;  1VCW A;  1Q3P A;  1MFL A;  2WL7 A;  2EXG A;  3SFJ A;  4Z33 A;  5A2P A;  2F0A A;  2G2L A;  2KOM A;  1WH1 A;  1WHD A;  2ENO A;  1RGR A;  3CYY A;  3L4F D;  3TSW A;  3CH8 A;  3PDZ A;  1UEQ A;  1FC7 A;  1IHJ A;  1SOT A;  1M5Z A;  5GLJ A;  2CSJ A;  2KPL A;  4H11 A;  5G1E A;  1GQ4 A;  3CBX A;  5HFF A;  3VQF A;  2I1N A;  1N7E A;  2FN5 A;  2HE2 A;  2OMJ A;  1SOZ A;  2H2C A;  4K75 A;  3I18 A;  2AIN A;  2YUY A;  3I4W A;  3HVQ C;  2FNE A;  2KAW A;  2DMZ A;  2LUI A;  4NMT A;  3GJ9 A;  2PZD A;  4HOP A;  1W9O A;  2L97 A;  1N7F A;  4NMQ A;  2EDP A;  1UFX A;  2ZPL A;  4GVC A;  1I92 A;  2DC2 A;  2DJT A;  1Y8T A;  3MH7 A;  1U3B A;  3QE1 A;  2DAZ A;  2JRE A;  1V6B A;  2M0Z A;  1BFE A;  3QJM A;  3GDU A;  4REY A;  2I04 A;  5EYZ A;  1WHA A;  3GCO A;  2KV8 A;  1P1D A;  1QAU A;  4NMR A;  4RI0 A;  1R6J A;  2VPH A;  3SOE A;  1QLC A;  2REY A;  3GDS A;  3ID3 A;  2RCZ A;  1LCY A;  1V62 A;  2I0L A;  3LNY A;  4NXR A;  4EDJ A;  1N6D A;  3DOR A;  2O2T A;  2IWN A;  1XZ9 A;  4K78 A;  2ZPM A;  2KQF A;  1OZI A;  2EV8 A;  1TQ3 A;  3GCN A;  1UIT A;  2Z9I A;  3WKM A;  1FC6 A;  1MC7 A;  2DLU A;  4G69 A;  5E6P B;  2KRG A;  1G9O A;  3R68 A;  2QBW A;  1UJU A;  2AWU A;  4K72 A;  5E1Y A;  2LC6 A;  1V5Q A;  1P1E A;  2K20 A;  4MPA A;  3FY5 A;  1V5L A;  3K50 A;  3NGH A;  4R2Z A;  2EGO A;  2AWX A;  1WI2 A;  4LMM A;  2YT8 A;  3K82 A;  1VA8 A;  5HEY A;  1UM1 A;  2IWP A;  2IWQ A;  3KZE A;  5H3J A;  4Z8J A;  1WF8 A;  1T2M A;  2KJK A;  4NNL A;  3GDV A;  4NNM A;  1UM7 A;  4YDP A;  3CS0 A;  3PV2 A;  1I16 A;  4UU6 A;  4JOJ A;  2OSG A;  1QAV B;  1OBY A;  1D5G A;  4OEP A;  4JOP A;  5D13 A;  2YT7 A;  3TMH A;  3RLE A;  2VRF A;  4Q2Q A;  2VWR A;  2LC7 A;  2EAQ A;  2VZ5 A;  3GAB A;  2FCF A;  3ID4 A;  2MX6 A;  2V1W A;  3SHW A;  4E34 A;  3KDK A;  2PKU A;  1RGW A;  4NXQ A;  1Z86 A;  1IU2 A;  1GM1 A;  4JOE A;  3QGL A;  1OBX A;  1U39 A;  2H3L A;  3B76 A;  2UZC A;  5HFD A;  1MFG A;  2Q9V A;  1ZUB A;  4NMS A;  2OCS A;  2RRM A;  3SHU A;  1RZX A;  2YTW A;  2P3W A;  2Q3G A;  2FE5 A;  3CBZ A;  2OS6 A;  2JSN A;  3HPK A;  4JJ3 A;  2OZF A;  3WKL A;  5E11 A;  3DJ1 A;  2EEH A;  4XHV A;  4K76 A;  4GHN A;  1X6D A;  2OQS A;  2I0I A;  2QT5 A;  4AMH A;  5HFB A;  3TSZ A;  3PS4 A;  3E17 A;  4P0C A;  2EEJ A;  5E22 A;  2DM8 A;  3I1E A;  2M0V A;  1UF1 A;  4FGM A;  3ID2 A;  1X5Q A;  5B42 A;  4E3B A;  3HPM A;  1GQ5 A;  4JOK A;  3CBY A;  2EDZ A;  1UEP A; 
#chains in the Genus database with same CATH homology
 1FC9 A;  1VB7 A;  2M0T A;  2QKV A;  3VQG A;  2K1Z A;  3R69 A;  3DJA A;  3QIK A;  3STJ A;  2M0U A;  1TP5 A;  2EGN A;  5FB8 C;  2GEF A;  1RY4 A;  5B6L A;  4JJ0 A;  3MH6 A;  2HE4 A;  2GZV A;  4PQW A;  3RL7 A;  3QO6 A;  1VAE A;  2E7K A;  2KA9 A;  1V1T A;  4L8N A;  2CS5 A;  2KOJ A;  2M10 A;  1K32 A;  1YBO A;  3PDV A;  2QG1 A;  2H2B A;  5JXB A;  2OPG A;  3NFK A;  1UJD A;  5I7Z A;  1UEZ A;  1TE0 A;  1WIF A;  2EDV A;  2I4S A;  1N6E A;  5HEB A;  3DJ3 A;  2KOH A;  3QDO A;  2QKU A;  5F67 A;  1QAV A;  4JL7 A;  2IWO A;  3NCV A;  3ZRT A;  1W9E A;  1NF3 C;  2KL1 A;  1Q7X A;  1U38 A;  1X45 A;  4P2A B;  2EEI A;  1U37 A;  1X8S A;  4YYX A;  1KY9 A;  3OU0 A;  2DKR A;  5HET A;  2LOB A;  1BE9 A;  2CSS A;  3RL8 A;  3O5N A;  4JOG A;  2L4S A;  4KFV A;  2I6V A;  4Q2O A;  3DIW A;  3R0H A;  2D90 A;  1WF7 A;  5HF4 A;  2JIN A;  3EGH C;  2D8I A;  1UJV A;  2DLS A;  1UEW A;  3KDG A;  2EJY A;  1UHP A;  4FLN A;  2EHR A;  5F3X A;  2BYG A;  2R4H A;  4E35 A;  2JIK A;  1WFG A;  3K1R A;  2W7R A;  5HFC A;  5HF1 A;  1PDR A;  1VJ6 A;  1OBZ A;  4OAJ A;  1Q3O A;  3NFL A;  2F5Y A;  1IU0 A;  2DB5 A;  4NMO A;  3PV4 A;  4JOR A;  2PKT A;  1KWA A;  3GGE A;  4F8K A;  1KEF A;  4HOP B;  3OTP A;  4WYU A;  2KPK A;  2KJP A;  4OEO A;  2KYL A;  2G5M B;  3KHF A;  2AWW A;  5FHT A;  1B8Q A;  1WG6 A;  3GSL A;  3TSV A;  1WJL A;  3JXT A;  4Q3H A;  3CC0 A;  2PA1 A;  4WYT A;  4KFW A;  2KG2 A;  2JOA A;  2MHO A;  3KZD A;  5E21 A;  1ZOK A;  4JOH A;  4UU5 A;  1N7T A;  5DTH A;  5ILB A;  2D92 A;  2VSP A;  2JXO A;  2PNT A;  2HGA A;  4GVD A;  2OGP A;  2R3Y A;  3QJN A;  5GND A;  1N99 A;  5HFE A;  3AXA A;  4K6Y A;  3PV5 A;  3EGG C;  2EGK A;  4NMP A;  1Y7N A;  4JOF A;  5HJ1 A;  4Q2N A;  3SUZ A;  1NTE A;  5HDY A;  1WFV A;  2LA8 A;  1FCF A;  1X5R A;  1Z87 A;  2PDZ A;  5HED A;  2M3M A;  4NMV A;  3LNX A;  2EEG A;  3MH4 A;  1WI4 A;  3BPU A;  3ID1 A;  2KBS A;  2JWE A;  4O06 A;  2YUB A;  2H3M A;  4N6X A;  5EZ0 A;  1L6O A;  4Q6S A;  1N6F A;  1TP3 A;  2JIL A;  2KJD A;  2W4F A;  3O46 A;  1X5N A;  1X9Z A;  4NXP A;  5IL9 A;  2X7Z A;  5G1D A;  2L4T A;  2V90 A;  2VSV A;  4Q6H A;  1W9Q A;  2QKT A;  2Z17 A;  4IC6 A;  4Q2P A;  1VCW A;  1Q3P A;  1MFL A;  2WL7 A;  2EXG A;  3SFJ A;  4Z33 A;  5A2P A;  2F0A A;  2G2L A;  2KOM A;  1WH1 A;  1WHD A;  2ENO A;  1RGR A;  3CYY A;  3L4F D;  3TSW A;  3CH8 A;  3PDZ A;  1UEQ A;  1FC7 A;  1IHJ A;  1SOT A;  1M5Z A;  5GLJ A;  2CSJ A;  2KPL A;  4H11 A;  5G1E A;  1GQ4 A;  3CBX A;  5HFF A;  3VQF A;  2I1N A;  1N7E A;  2FN5 A;  2HE2 A;  2OMJ A;  1SOZ A;  2H2C A;  4K75 A;  3I18 A;  2AIN A;  2YUY A;  3I4W A;  3HVQ C;  2FNE A;  2KAW A;  2DMZ A;  2LUI A;  4NMT A;  3GJ9 A;  2PZD A;  4HOP A;  1W9O A;  2L97 A;  1N7F A;  4NMQ A;  2EDP A;  1UFX A;  2ZPL A;  4GVC A;  1I92 A;  2DC2 A;  2DJT A;  1Y8T A;  3MH7 A;  1U3B A;  3QE1 A;  2DAZ A;  2JRE A;  1V6B A;  2M0Z A;  1BFE A;  3QJM A;  3GDU A;  4REY A;  2I04 A;  5EYZ A;  1WHA A;  3GCO A;  2KV8 A;  1P1D A;  1QAU A;  4NMR A;  4RI0 A;  1R6J A;  2VPH A;  3SOE A;  1QLC A;  2REY A;  3GDS A;  3ID3 A;  2RCZ A;  1LCY A;  1V62 A;  2I0L A;  3LNY A;  4NXR A;  4EDJ A;  1N6D A;  3DOR A;  2O2T A;  2IWN A;  1XZ9 A;  4K78 A;  2ZPM A;  2KQF A;  1OZI A;  2EV8 A;  1TQ3 A;  3GCN A;  1UIT A;  2Z9I A;  3WKM A;  1FC6 A;  1MC7 A;  2DLU A;  4G69 A;  5E6P B;  2KRG A;  1G9O A;  3R68 A;  2QBW A;  1UJU A;  2AWU A;  4K72 A;  5E1Y A;  2LC6 A;  1V5Q A;  1P1E A;  2K20 A;  4MPA A;  3FY5 A;  1V5L A;  3K50 A;  3NGH A;  4R2Z A;  2EGO A;  2AWX A;  1WI2 A;  4LMM A;  2YT8 A;  3K82 A;  1VA8 A;  5HEY A;  1UM1 A;  2IWP A;  2IWQ A;  3KZE A;  5H3J A;  4Z8J A;  1WF8 A;  1T2M A;  2KJK A;  4NNL A;  3GDV A;  4NNM A;  1UM7 A;  4YDP A;  3CS0 A;  3PV2 A;  1I16 A;  4UU6 A;  4JOJ A;  2OSG A;  1QAV B;  1OBY A;  1D5G A;  4OEP A;  4JOP A;  5D13 A;  2YT7 A;  3TMH A;  3RLE A;  2VRF A;  4Q2Q A;  2VWR A;  2LC7 A;  2EAQ A;  2VZ5 A;  3GAB A;  2FCF A;  3ID4 A;  2MX6 A;  2V1W A;  3SHW A;  4E34 A;  3KDK A;  2PKU A;  1RGW A;  4NXQ A;  1Z86 A;  1IU2 A;  1GM1 A;  4JOE A;  3QGL A;  1OBX A;  1U39 A;  2H3L A;  3B76 A;  2UZC A;  5HFD A;  1MFG A;  2Q9V A;  1ZUB A;  4NMS A;  2OCS A;  2RRM A;  3SHU A;  1RZX A;  2YTW A;  2P3W A;  2Q3G A;  2FE5 A;  3CBZ A;  2OS6 A;  2JSN A;  3HPK A;  4JJ3 A;  2OZF A;  3WKL A;  5E11 A;  3DJ1 A;  2EEH A;  4XHV A;  4K76 A;  4GHN A;  1X6D A;  2OQS A;  2I0I A;  2QT5 A;  4AMH A;  5HFB A;  3TSZ A;  3PS4 A;  3E17 A;  4P0C A;  2EEJ A;  5E22 A;  2DM8 A;  3I1E A;  2M0V A;  1UF1 A;  4FGM A;  3ID2 A;  1X5Q A;  5B42 A;  4E3B A;  3HPM A;  1GQ5 A;  4JOK A;  3CBY A;  2EDZ A;  1UEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...