5G1EA

The complex structure of syntenin-1 pdz domain with c-terminal extension
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
169
structure length
169
Chain Sequence
b'GIREVILCKDQDGKIGLRLKSVDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTVTMHKDSSGHVGFIFKSGKITSIVKDSSAARNGLLTDHHICEINGQNVIGLKDAQIADILSTAGTVVTITIMPAFIFEHII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTENIN-1
publication title New Structural Insight of C-Terminal Region of Syntenin-1, Enhancing the Molecular Dimerization and Inhibitory Function Related on Syndecan-4 Signaling.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 41
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5g1eA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5g1eA01
3RL7A 3CH8A 1FC7A 1N7FA 3JXTA 2KJKA 5B6LA 2EGNA 1X8SA 1Q3OA 3PV2A 2CSSA 2OS6A 2FCFA 2L4SA 5HDYA 4WYUA 4H11A 3CBXA 4GVCA 4YYXA 4HOPB 2X7ZA 3TSVA 1L6OA 3CS0A 1NTEA 2VZ5A 1MFLA 4OEOA 5HFDA 4WYTA 3QJMA 3GSLA 4K78A 5HETA 3E17A 3I4WA 1I16A 5E22A 4NXRA 4L8NA 5E1YA 3TSZA 5HF4A 2JWEA 4Q6HA 3SOEA 3EGHC 3MH6A 4NMPA 2REYA 1MFGA 3GJ9A 4IC6A 1U39A 2M0UA 4R2ZA 3RL8A 4NXPA 2M0TA 1YBOA 2H2CA 2EEJA 4GVDA 4NMQA 2M10A 4NNLA 1GM1A 1RZXA 2EEGA 1UJDA 2OQSA 3QGLA 1X5NA 3GCOA 4K76A 2Z17A 3I1EA 1UFXA 2DKRA 4JORA 3ID4A 1V5QA 3HVQC 3L4FD 1W9QA 2KOJA 2EJYA 5F3XA 3STJA 2D8IA 3TSWA 2PDZA 2PA1A 1T2MA 2K1ZA 2KQFA 4N6XA 1VB7A 1N7EA 1XZ9A 2L4TA 2AINA 3MH7A 2FN5A 2VSVA 4P2AB 5HEBA 4PQWA 3DJAA 4FGMA 1UITA 2EHRA 4F8KA 4P0CA 2VWRA 2WL7A 4NMRA 1Q3PA 4JOHA 4AMHA 2IWOA 2LC6A 2LC7A 4NMVA 4O06A 2H3LA 1FC9A 1MC7A 2E7KA 2FE5A 4MPAA 1UF1A 2PNTA 2EGOA 2QBWA 2RRMA 1PDRA 1KY9A 2I04A 3ID3A 2M0VA 2F5YA 1P1EA 1GQ4A 1UEWA 2K20A 5GLJA 2KA9A 5HF1A 5EYZA 1UEPA 2FNEA 2PZDA 2JILA 4NMTA 4Z8JA 2Q9VA 4K6YA 2DAZA 2ZPMA 4EDJA 1B8QA 1WHAA 1WIFA 4UU6A 2RCZA 2DJTA 2ENOA 2QG1A 2OZFA 3MH4A 1WF7A 5F67A 1X6DA 3GDVA 3QJNA 2CSJA 4NMSA 1UJVA 2YUBA 1IU0A 2YT7A 3I18A 1WI4A 5H3JA 5HEYA 2VRFA 3BPUA 1BE9A 2KOHA 4Q6SA 1IHJA 3QIKA 3K1RA 3QO6A 2V90A 1G9OA 2I6VA 2LA8A 3TMHA 3GCNA 2OMJA 2G2LA 4K75A 2AWXA 4E34A 5D13A 3NFKA 4JL7A 2EDVA 5G1EA 2KJDA 2LOBA 3B76A 2W4FA 3DJ3A 3SFJA 1VJ6A 2I0IA 1RGWA 3VQFA 1Y8TA 4JOPA 5E21A 5HFFA 1OZIA 2AWWA 1RGRA 2YUYA 5DTHA 4OAJA 3KHFA 4NNMA 3SHUA 1UJUA 1D5GA 2Z9IA 5EZ0A 1IU2A 2KAWA 3LNYA 2PKTA 2PKUA 2I1NA 2EEHA 1X45A 2AWUA 1WFVA 2JOAA 2ZPLA 2D90A 1VAEA 5GNDA 4KFWA 1TP5A 2P3WA 4Q2OA 2KBSA 2W7RA 1Y7NA 1M5ZA 2JREA 4LMMA 3PS4A 1FCFA 2O2TA 1BFEA 3K50A 4JOEA 4GHNA 2DB5A 4E3BA 4NMOA 1V1TA 4E35A 4UU5A 3HPMA 4Q2NA 2IWPA 2EAQA 1WG6A 5E6PB 1Q7XA 3R68A 4RI0A 2EEIA 3QDOA 1QAVA 4REYA 2BYGA 3PDVA 5A2PA 1N7TA 1RY4A 5HFEA 2DM8A 3DIWA 5HFCA 1R6JA 3ZRTA 3DJ1A 3LNXA 3SHWA 2QT5A 3NFLA 3PDZA 2MHOA 1UHPA 2G5MB 1SOTA 2OSGA 1UEQA 5G1DA 1LCYA 2KL1A 2R4HA 2KJPA 4YDPA 1QAUA 2V1WA 1QAVB 2QKVA 2H2BA 2YTWA 3DORA 2I4SA 2EDPA 3NGHA 3VQGA 2KOMA 1VCWA 2M3MA 3ID2A 1K32A 1Z87A 1SOZA 3CBZA 1TQ3A 1N6DA 2LUIA 4JOGA 1UM1A 2KPKA 3GGEA 3CBYA 1P1DA 2IWNA 1KWAA 3O46A 1WF8A 2CS5A 2VSPA 1ZUBA 2DMZA 1ZOKA 2DC2A 3K82A 5E11A 3PV5A 3SUZA 1Z86A 4JOKA 3GDUA 2MX6A 2IWQA 3R69A 3EGGC 1X5RA 1WJLA 1GQ5A 3R0HA 4Z33A 4K72A 5FB8C 2GZVA 2KV8A 1N6EA 4NXQA 4KFVA 4OEPA 4Q2PA 2H3MA 3PV4A 1WI2A 5FHTA 1N6FA 1KEFA 3WKLA 2M0ZA 3CC0A 3OTPA 4Q3HA 2EDZA 1X5QA 1U3BA 3WKMA 3O5NA 1N99A 1W9OA 2VPHA 2OGPA 1W9EA 1V6BA 3FY5A 1U37A 5HFBA 2DLUA 2L97A 4JOFA 2Q3GA 1UM7A 2R3YA 5HJ1A 1TP3A 2QKUA 1TE0A 1OBXA 3OU0A 3GDSA 3CYYA 2OCSA 2JXOA 2KPLA 3AXAA 3HPKA 4G69A 1U38A 2D92A 2EGKA 1OBYA 1WH1A 2I0LA 2OPGA 1V62A 2KG2A 2JINA 2KRGA 4Q2QA 1FC6A 2DLSA 2JIKA 2EV8A 2EXGA 2KYLA 2F0AA 1NF3C 2HE4A 1WHDA 1QLCA 1V5LA 3QE1A 3ID1A 4HOPA 1UEZA 4JOJA 5HEDA 3KZEA 1WFGA 5JXBA 2UZCA 4XHVA 2HGAA 2YT8A 5I7ZA 3RLEA 1VA8A 1I92A 1OBZA 2QKTA 2HE2A 3KZDA
chains in the Genus database with same CATH superfamily
3RL7A 3CH8A 1FC7A 1N7FA 3JXTA 2KJKA 5B6LA 2EGNA 1X8SA 1Q3OA 3PV2A 2CSSA 2OS6A 2FCFA 2L4SA 5HDYA 4WYUA 4H11A 3CBXA 4GVCA 4YYXA 4HOPB 2X7ZA 3TSVA 1L6OA 3CS0A 1NTEA 2VZ5A 1MFLA 4OEOA 5HFDA 4WYTA 3QJMA 3GABA 3GSLA 4K78A 5HETA 3E17A 3I4WA 1I16A 5E22A 4NXRA 4L8NA 5E1YA 3TSZA 5HF4A 2JWEA 4Q6HA 3SOEA 3EGHC 3MH6A 4NMPA 2REYA 1MFGA 3GJ9A 4IC6A 1U39A 2M0UA 4R2ZA 3RL8A 4NXPA 2M0TA 1YBOA 2H2CA 2EEJA 4GVDA 4NMQA 2M10A 4NNLA 1GM1A 1RZXA 2EEGA 1UJDA 2OQSA 3QGLA 1X5NA 3GCOA 4K76A 2Z17A 3I1EA 1UFXA 2DKRA 4JORA 3ID4A 1V5QA 3HVQC 3L4FD 1W9QA 2KOJA 2EJYA 5F3XA 3STJA 2D8IA 3TSWA 2PDZA 2PA1A 1T2MA 2K1ZA 2KQFA 4N6XA 1VB7A 1N7EA 1XZ9A 2L4TA 2AINA 3MH7A 2FN5A 2VSVA 4P2AB 5HEBA 4PQWA 3DJAA 4FGMA 1UITA 2EHRA 4F8KA 4P0CA 2VWRA 2WL7A 4NMRA 1Q3PA 4JOHA 4AMHA 2IWOA 2LC6A 2LC7A 4NMVA 4O06A 2H3LA 1FC9A 1MC7A 2E7KA 2FE5A 4MPAA 1UF1A 2PNTA 2EGOA 2QBWA 2RRMA 1PDRA 1KY9A 2I04A 3ID3A 2M0VA 2F5YA 1P1EA 1GQ4A 1UEWA 2K20A 5GLJA 2KA9A 5HF1A 5EYZA 1UEPA 2FNEA 2PZDA 2JILA 4NMTA 4Z8JA 2Q9VA 4K6YA 2DAZA 2ZPMA 4EDJA 1B8QA 1WHAA 1WIFA 4UU6A 2RCZA 2DJTA 2ENOA 2QG1A 2OZFA 3MH4A 1WF7A 5F67A 1X6DA 3GDVA 3QJNA 2CSJA 4NMSA 1UJVA 2YUBA 1IU0A 2YT7A 3KDGA 3I18A 1WI4A 5H3JA 5HEYA 2VRFA 3BPUA 1BE9A 2KOHA 4Q6SA 2GEFA 1IHJA 3QIKA 2JSNA 3K1RA 3QO6A 2V90A 1G9OA 2I6VA 4FLNA 2LA8A 3TMHA 3GCNA 2OMJA 2G2LA 4K75A 2AWXA 4E34A 5D13A 3NFKA 4JL7A 2EDVA 5G1EA 2KJDA 2LOBA 3B76A 2W4FA 3DJ3A 3SFJA 1VJ6A 2I0IA 1RGWA 3VQFA 1Y8TA 4JOPA 5E21A 5HFFA 1OZIA 2AWWA 1RGRA 2YUYA 5DTHA 4OAJA 3KHFA 4NNMA 3SHUA 1UJUA 1D5GA 2Z9IA 5EZ0A 1IU2A 2KAWA 3LNYA 2PKTA 2PKUA 2I1NA 2EEHA 1X45A 2AWUA 1WFVA 2JOAA 2ZPLA 2D90A 1VAEA 5GNDA 4KFWA 1TP5A 2P3WA 4Q2OA 2KBSA 2W7RA 1Y7NA 1M5ZA 2JREA 4LMMA 3PS4A 1FCFA 2O2TA 1BFEA 3K50A 4JOEA 4GHNA 2DB5A 4E3BA 4NMOA 1V1TA 4E35A 4UU5A 3HPMA 4Q2NA 2IWPA 2EAQA 1WG6A 5E6PB 1Q7XA 3R68A 4RI0A 2EEIA 3QDOA 1QAVA 4REYA 2BYGA 3PDVA 5A2PA 1N7TA 1RY4A 5HFEA 2DM8A 3DIWA 5HFCA 1R6JA 3ZRTA 3DJ1A 3LNXA 3SHWA 2QT5A 5B42A 3NFLA 3PDZA 2MHOA 1UHPA 2G5MB 1SOTA 2OSGA 1UEQA 5G1DA 1LCYA 2KL1A 2R4HA 2KJPA 4YDPA 1QAUA 2V1WA 1QAVB 2QKVA 2H2BA 2YTWA 3DORA 2I4SA 5IL9A 2EDPA 3NGHA 3VQGA 2KOMA 3NCVA 1VCWA 2M3MA 3ID2A 1K32A 1Z87A 1SOZA 3CBZA 1TQ3A 1N6DA 2LUIA 4JOGA 1UM1A 2KPKA 3GGEA 3CBYA 1P1DA 4JJ0A 2IWNA 1KWAA 3KDKA 3O46A 1WF8A 2CS5A 2VSPA 1ZUBA 2DMZA 1ZOKA 2DC2A 3K82A 5E11A 3PV5A 3SUZA 1Z86A 1X9ZA 4JOKA 3GDUA 2MX6A 2IWQA 3R69A 3EGGC 1X5RA 1WJLA 1GQ5A 3R0HA 4Z33A 4K72A 5FB8C 2GZVA 2KV8A 1N6EA 4NXQA 4KFVA 4OEPA 4Q2PA 2H3MA 3PV4A 1WI2A 5FHTA 1N6FA 1KEFA 3WKLA 2M0ZA 3CC0A 3OTPA 4Q3HA 2EDZA 1X5QA 1U3BA 3WKMA 3O5NA 1N99A 1W9OA 2VPHA 2OGPA 1W9EA 1V6BA 3FY5A 1U37A 5HFBA 2DLUA 2L97A 4JOFA 2Q3GA 1UM7A 2R3YA 5HJ1A 1TP3A 2QKUA 1TE0A 1OBXA 3OU0A 3GDSA 3CYYA 4JJ3A 2OCSA 2JXOA 2KPLA 3AXAA 3HPKA 4G69A 1U38A 2D92A 2EGKA 1OBYA 1WH1A 2I0LA 2OPGA 1V62A 2KG2A 2JINA 2KRGA 4Q2QA 1FC6A 2DLSA 2JIKA 2EV8A 2EXGA 2KYLA 2F0AA 1NF3C 2HE4A 1WHDA 1QLCA 1V5LA 3QE1A 3ID1A 4HOPA 1UEZA 4JOJA 5HEDA 5ILBA 3KZEA 1WFGA 5JXBA 2UZCA 4XHVA 2HGAA 2YT8A 5I7ZA 3RLEA 1VA8A 1I92A 1OBZA 2QKTA 2HE2A 3KZDA
chains in the Genus database with same CATH topology
3RL7A 3CH8A 1FC7A 1N7FA 3JXTA 2KJKA 5B6LA 2EGNA 1X8SA 1Q3OA 3PV2A 2CSSA 2OS6A 2FCFA 2L4SA 5HDYA 4WYUA 4H11A 3CBXA 4GVCA 4YYXA 4HOPB 2X7ZA 3TSVA 1L6OA 3CS0A 1NTEA 2VZ5A 1MFLA 4OEOA 5HFDA 4WYTA 3QJMA 3GABA 3GSLA 4K78A 5HETA 3E17A 3I4WA 1I16A 5E22A 4NXRA 4L8NA 5E1YA 3TSZA 5HF4A 2JWEA 4Q6HA 3SOEA 3EGHC 3MH6A 4NMPA 2REYA 1MFGA 3GJ9A 4IC6A 1U39A 2M0UA 4R2ZA 3RL8A 4NXPA 2M0TA 1YBOA 2H2CA 2EEJA 4GVDA 4NMQA 2M10A 4NNLA 1GM1A 1RZXA 2EEGA 1UJDA 2OQSA 3QGLA 1X5NA 3GCOA 4K76A 2Z17A 3I1EA 1UFXA 2DKRA 4JORA 3ID4A 1V5QA 3HVQC 3L4FD 1W9QA 2KOJA 2EJYA 5F3XA 3STJA 2D8IA 3TSWA 2PDZA 2PA1A 1T2MA 2K1ZA 2KQFA 4N6XA 1VB7A 1N7EA 1XZ9A 2L4TA 2AINA 3MH7A 2FN5A 2VSVA 4P2AB 5HEBA 4PQWA 3DJAA 4FGMA 1UITA 2EHRA 4F8KA 4P0CA 2VWRA 2WL7A 4NMRA 1Q3PA 4JOHA 4AMHA 2IWOA 2LC6A 2LC7A 4NMVA 4O06A 2H3LA 1FC9A 1MC7A 2E7KA 2FE5A 4MPAA 1UF1A 2PNTA 2EGOA 2QBWA 2RRMA 1PDRA 1KY9A 2I04A 3ID3A 2M0VA 2F5YA 1P1EA 1GQ4A 1UEWA 2K20A 5GLJA 2KA9A 5HF1A 5EYZA 1UEPA 2FNEA 2PZDA 2JILA 4NMTA 4Z8JA 2Q9VA 4K6YA 2DAZA 2ZPMA 4EDJA 1B8QA 1WHAA 1WIFA 4UU6A 2RCZA 2DJTA 2ENOA 2QG1A 2OZFA 3MH4A 1WF7A 5F67A 1X6DA 3GDVA 3QJNA 2CSJA 4NMSA 1UJVA 2YUBA 1IU0A 2YT7A 3KDGA 3I18A 1WI4A 5H3JA 5HEYA 2VRFA 3BPUA 1BE9A 2KOHA 4Q6SA 2GEFA 1IHJA 3QIKA 2JSNA 3K1RA 3QO6A 2V90A 1G9OA 2I6VA 4FLNA 2LA8A 3TMHA 3GCNA 2OMJA 2G2LA 4K75A 2AWXA 4E34A 5D13A 3NFKA 4JL7A 2EDVA 5G1EA 2KJDA 2LOBA 3B76A 2W4FA 3DJ3A 3SFJA 1VJ6A 2I0IA 1RGWA 3VQFA 1Y8TA 4JOPA 5E21A 5HFFA 1OZIA 2AWWA 1RGRA 2YUYA 5DTHA 4OAJA 3KHFA 4NNMA 3SHUA 1UJUA 1D5GA 2Z9IA 5EZ0A 1IU2A 2KAWA 3LNYA 2PKTA 2PKUA 2I1NA 2EEHA 1X45A 2AWUA 1WFVA 2JOAA 2ZPLA 2D90A 1VAEA 5GNDA 4KFWA 1TP5A 2P3WA 4Q2OA 2KBSA 2W7RA 1Y7NA 1M5ZA 2JREA 4LMMA 3PS4A 1FCFA 2O2TA 1BFEA 3K50A 4JOEA 4GHNA 2DB5A 4E3BA 4NMOA 1V1TA 4E35A 4UU5A 3HPMA 4Q2NA 2IWPA 2EAQA 1WG6A 5E6PB 1Q7XA 3R68A 4RI0A 2EEIA 3QDOA 1QAVA 4REYA 2BYGA 3PDVA 5A2PA 1N7TA 1RY4A 5HFEA 2DM8A 3DIWA 5HFCA 1R6JA 3ZRTA 3DJ1A 3LNXA 3SHWA 2QT5A 5B42A 3NFLA 3PDZA 2MHOA 1UHPA 2G5MB 1SOTA 2OSGA 1UEQA 5G1DA 1LCYA 2KL1A 2R4HA 2KJPA 4YDPA 1QAUA 2V1WA 1QAVB 2QKVA 2H2BA 2YTWA 3DORA 2I4SA 5IL9A 2EDPA 3NGHA 3VQGA 2KOMA 3NCVA 1VCWA 2M3MA 3ID2A 1K32A 1Z87A 1SOZA 3CBZA 1TQ3A 1N6DA 2LUIA 4JOGA 1UM1A 2KPKA 3GGEA 3CBYA 1P1DA 4JJ0A 2IWNA 1KWAA 3KDKA 3O46A 1WF8A 2CS5A 2VSPA 1ZUBA 2DMZA 1ZOKA 2DC2A 3K82A 5E11A 3PV5A 3SUZA 1Z86A 1X9ZA 4JOKA 3GDUA 2MX6A 2IWQA 3R69A 3EGGC 1X5RA 1WJLA 1GQ5A 3R0HA 4Z33A 4K72A 5FB8C 2GZVA 2KV8A 1N6EA 4NXQA 4KFVA 4OEPA 4Q2PA 2H3MA 3PV4A 1WI2A 5FHTA 1N6FA 1KEFA 3WKLA 2M0ZA 3CC0A 3OTPA 4Q3HA 2EDZA 1X5QA 1U3BA 3WKMA 3O5NA 1N99A 1W9OA 2VPHA 2OGPA 1W9EA 1V6BA 3FY5A 1U37A 5HFBA 2DLUA 2L97A 4JOFA 2Q3GA 1UM7A 2R3YA 5HJ1A 1TP3A 2QKUA 1TE0A 1OBXA 3OU0A 3GDSA 3CYYA 4JJ3A 2OCSA 2JXOA 2KPLA 3AXAA 3HPKA 4G69A 1U38A 2D92A 2EGKA 1OBYA 1WH1A 2I0LA 2OPGA 1V62A 2KG2A 2JINA 2KRGA 4Q2QA 1FC6A 2DLSA 2JIKA 2EV8A 2EXGA 2KYLA 2F0AA 1NF3C 2HE4A 1WHDA 1QLCA 1V5LA 3QE1A 3ID1A 4HOPA 1UEZA 4JOJA 5HEDA 5ILBA 3KZEA 1WFGA 5JXBA 2UZCA 4XHVA 2HGAA 2YT8A 5I7ZA 3RLEA 1VA8A 1I92A 1OBZA 2QKTA 2HE2A 3KZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL7 A;  3CH8 A;  1FC7 A;  1N7F A;  3JXT A;  2KJK A;  5B6L A;  2EGN A;  1X8S A;  1Q3O A;  3PV2 A;  2CSS A;  2OS6 A;  2FCF A;  2L4S A;  5HDY A;  4WYU A;  4H11 A;  3CBX A;  4GVC A;  4YYX A;  4HOP B;  2X7Z A;  3TSV A;  1L6O A;  3CS0 A;  1NTE A;  2VZ5 A;  1MFL A;  4OEO A;  5HFD A;  4WYT A;  3QJM A;  3GSL A;  4K78 A;  5HET A;  3E17 A;  3I4W A;  1I16 A;  5E22 A;  4NXR A;  4L8N A;  5E1Y A;  3TSZ A;  5HF4 A;  2JWE A;  4Q6H A;  3SOE A;  3EGH C;  3MH6 A;  4NMP A;  2REY A;  1MFG A;  3GJ9 A;  4IC6 A;  1U39 A;  2M0U A;  4R2Z A;  3RL8 A;  4NXP A;  2M0T A;  1YBO A;  2H2C A;  2EEJ A;  4GVD A;  4NMQ A;  2M10 A;  4NNL A;  1GM1 A;  1RZX A;  2EEG A;  1UJD A;  2OQS A;  3QGL A;  1X5N A;  3GCO A;  4K76 A;  2Z17 A;  3I1E A;  1UFX A;  2DKR A;  4JOR A;  3ID4 A;  1V5Q A;  3HVQ C;  3L4F D;  1W9Q A;  2KOJ A;  2EJY A;  5F3X A;  3STJ A;  2D8I A;  3TSW A;  2PDZ A;  2PA1 A;  1T2M A;  2K1Z A;  2KQF A;  4N6X A;  1VB7 A;  1N7E A;  1XZ9 A;  2L4T A;  2AIN A;  3MH7 A;  2FN5 A;  2VSV A;  4P2A B;  5HEB A;  4PQW A;  3DJA A;  4FGM A;  1UIT A;  2EHR A;  4F8K A;  4P0C A;  2VWR A;  2WL7 A;  4NMR A;  1Q3P A;  4JOH A;  4AMH A;  2IWO A;  2LC6 A;  2LC7 A;  4NMV A;  4O06 A;  2H3L A;  1FC9 A;  1MC7 A;  2E7K A;  2FE5 A;  4MPA A;  1UF1 A;  2PNT A;  2EGO A;  2QBW A;  2RRM A;  1PDR A;  1KY9 A;  2I04 A;  3ID3 A;  2M0V A;  2F5Y A;  1P1E A;  1GQ4 A;  1UEW A;  2K20 A;  5GLJ A;  2KA9 A;  5HF1 A;  5EYZ A;  1UEP A;  2FNE A;  2PZD A;  2JIL A;  4NMT A;  4Z8J A;  2Q9V A;  4K6Y A;  2DAZ A;  2ZPM A;  4EDJ A;  1B8Q A;  1WHA A;  1WIF A;  4UU6 A;  2RCZ A;  2DJT A;  2ENO A;  2QG1 A;  2OZF A;  3MH4 A;  1WF7 A;  5F67 A;  1X6D A;  3GDV A;  3QJN A;  2CSJ A;  4NMS A;  1UJV A;  2YUB A;  1IU0 A;  2YT7 A;  3I18 A;  1WI4 A;  5H3J A;  5HEY A;  2VRF A;  3BPU A;  1BE9 A;  2KOH A;  4Q6S A;  1IHJ A;  3QIK A;  3K1R A;  3QO6 A;  2V90 A;  1G9O A;  2I6V A;  2LA8 A;  3TMH A;  3GCN A;  2OMJ A;  2G2L A;  4K75 A;  2AWX A;  4E34 A;  5D13 A;  3NFK A;  4JL7 A;  2EDV A;  5G1E A;  2KJD A;  2LOB A;  3B76 A;  2W4F A;  3DJ3 A;  3SFJ A;  1VJ6 A;  2I0I A;  1RGW A;  3VQF A;  1Y8T A;  4JOP A;  5E21 A;  5HFF A;  1OZI A;  2AWW A;  1RGR A;  2YUY A;  5DTH A;  4OAJ A;  3KHF A;  4NNM A;  3SHU A;  1UJU A;  1D5G A;  2Z9I A;  5EZ0 A;  1IU2 A;  2KAW A;  3LNY A;  2PKT A;  2PKU A;  2I1N A;  2EEH A;  1X45 A;  2AWU A;  1WFV A;  2JOA A;  2ZPL A;  2D90 A;  1VAE A;  5GND A;  4KFW A;  1TP5 A;  2P3W A;  4Q2O A;  2KBS A;  2W7R A;  1Y7N A;  1M5Z A;  2JRE A;  4LMM A;  3PS4 A;  1FCF A;  2O2T A;  1BFE A;  3K50 A;  4JOE A;  4GHN A;  2DB5 A;  4E3B A;  4NMO A;  1V1T A;  4E35 A;  4UU5 A;  3HPM A;  4Q2N A;  2IWP A;  2EAQ A;  1WG6 A;  5E6P B;  1Q7X A;  3R68 A;  4RI0 A;  2EEI A;  3QDO A;  1QAV A;  4REY A;  2BYG A;  3PDV A;  5A2P A;  1N7T A;  1RY4 A;  5HFE A;  2DM8 A;  3DIW A;  5HFC A;  1R6J A;  3ZRT A;  3DJ1 A;  3LNX A;  3SHW A;  2QT5 A;  3NFL A;  3PDZ A;  2MHO A;  1UHP A;  2G5M B;  1SOT A;  2OSG A;  1UEQ A;  5G1D A;  1LCY A;  2KL1 A;  2R4H A;  2KJP A;  4YDP A;  1QAU A;  2V1W A;  1QAV B;  2QKV A;  2H2B A;  2YTW A;  3DOR A;  2I4S A;  2EDP A;  3NGH A;  3VQG A;  2KOM A;  1VCW A;  2M3M A;  3ID2 A;  1K32 A;  1Z87 A;  1SOZ A;  3CBZ A;  1TQ3 A;  1N6D A;  2LUI A;  4JOG A;  1UM1 A;  2KPK A;  3GGE A;  3CBY A;  1P1D A;  2IWN A;  1KWA A;  3O46 A;  1WF8 A;  2CS5 A;  2VSP A;  1ZUB A;  2DMZ A;  1ZOK A;  2DC2 A;  3K82 A;  5E11 A;  3PV5 A;  3SUZ A;  1Z86 A;  4JOK A;  3GDU A;  2MX6 A;  2IWQ A;  3R69 A;  3EGG C;  1X5R A;  1WJL A;  1GQ5 A;  3R0H A;  4Z33 A;  4K72 A;  5FB8 C;  2GZV A;  2KV8 A;  1N6E A;  4NXQ A;  4KFV A;  4OEP A;  4Q2P A;  2H3M A;  3PV4 A;  1WI2 A;  5FHT A;  1N6F A;  1KEF A;  3WKL A;  2M0Z A;  3CC0 A;  3OTP A;  4Q3H A;  2EDZ A;  1X5Q A;  1U3B A;  3WKM A;  3O5N A;  1N99 A;  1W9O A;  2VPH A;  2OGP A;  1W9E A;  1V6B A;  3FY5 A;  1U37 A;  5HFB A;  2DLU A;  2L97 A;  4JOF A;  2Q3G A;  1UM7 A;  2R3Y A;  5HJ1 A;  1TP3 A;  2QKU A;  1TE0 A;  1OBX A;  3OU0 A;  3GDS A;  3CYY A;  2OCS A;  2JXO A;  2KPL A;  3AXA A;  3HPK A;  4G69 A;  1U38 A;  2D92 A;  2EGK A;  1OBY A;  1WH1 A;  2I0L A;  2OPG A;  1V62 A;  2KG2 A;  2JIN A;  2KRG A;  4Q2Q A;  1FC6 A;  2DLS A;  2JIK A;  2EV8 A;  2EXG A;  2KYL A;  2F0A A;  1NF3 C;  2HE4 A;  1WHD A;  1QLC A;  1V5L A;  3QE1 A;  3ID1 A;  4HOP A;  1UEZ A;  4JOJ A;  5HED A;  3KZE A;  1WFG A;  5JXB A;  2UZC A;  4XHV A;  2HGA A;  2YT8 A;  5I7Z A;  3RLE A;  1VA8 A;  1I92 A;  1OBZ A;  2QKT A;  2HE2 A;  3KZD A; 
#chains in the Genus database with same CATH topology
 3RL7 A;  3CH8 A;  1FC7 A;  1N7F A;  3JXT A;  2KJK A;  5B6L A;  2EGN A;  1X8S A;  1Q3O A;  3PV2 A;  2CSS A;  2OS6 A;  2FCF A;  2L4S A;  5HDY A;  4WYU A;  4H11 A;  3CBX A;  4GVC A;  4YYX A;  4HOP B;  2X7Z A;  3TSV A;  1L6O A;  3CS0 A;  1NTE A;  2VZ5 A;  1MFL A;  4OEO A;  5HFD A;  4WYT A;  3QJM A;  3GAB A;  3GSL A;  4K78 A;  5HET A;  3E17 A;  3I4W A;  1I16 A;  5E22 A;  4NXR A;  4L8N A;  5E1Y A;  3TSZ A;  5HF4 A;  2JWE A;  4Q6H A;  3SOE A;  3EGH C;  3MH6 A;  4NMP A;  2REY A;  1MFG A;  3GJ9 A;  4IC6 A;  1U39 A;  2M0U A;  4R2Z A;  3RL8 A;  4NXP A;  2M0T A;  1YBO A;  2H2C A;  2EEJ A;  4GVD A;  4NMQ A;  2M10 A;  4NNL A;  1GM1 A;  1RZX A;  2EEG A;  1UJD A;  2OQS A;  3QGL A;  1X5N A;  3GCO A;  4K76 A;  2Z17 A;  3I1E A;  1UFX A;  2DKR A;  4JOR A;  3ID4 A;  1V5Q A;  3HVQ C;  3L4F D;  1W9Q A;  2KOJ A;  2EJY A;  5F3X A;  3STJ A;  2D8I A;  3TSW A;  2PDZ A;  2PA1 A;  1T2M A;  2K1Z A;  2KQF A;  4N6X A;  1VB7 A;  1N7E A;  1XZ9 A;  2L4T A;  2AIN A;  3MH7 A;  2FN5 A;  2VSV A;  4P2A B;  5HEB A;  4PQW A;  3DJA A;  4FGM A;  1UIT A;  2EHR A;  4F8K A;  4P0C A;  2VWR A;  2WL7 A;  4NMR A;  1Q3P A;  4JOH A;  4AMH A;  2IWO A;  2LC6 A;  2LC7 A;  4NMV A;  4O06 A;  2H3L A;  1FC9 A;  1MC7 A;  2E7K A;  2FE5 A;  4MPA A;  1UF1 A;  2PNT A;  2EGO A;  2QBW A;  2RRM A;  1PDR A;  1KY9 A;  2I04 A;  3ID3 A;  2M0V A;  2F5Y A;  1P1E A;  1GQ4 A;  1UEW A;  2K20 A;  5GLJ A;  2KA9 A;  5HF1 A;  5EYZ A;  1UEP A;  2FNE A;  2PZD A;  2JIL A;  4NMT A;  4Z8J A;  2Q9V A;  4K6Y A;  2DAZ A;  2ZPM A;  4EDJ A;  1B8Q A;  1WHA A;  1WIF A;  4UU6 A;  2RCZ A;  2DJT A;  2ENO A;  2QG1 A;  2OZF A;  3MH4 A;  1WF7 A;  5F67 A;  1X6D A;  3GDV A;  3QJN A;  2CSJ A;  4NMS A;  1UJV A;  2YUB A;  1IU0 A;  2YT7 A;  3KDG A;  3I18 A;  1WI4 A;  5H3J A;  5HEY A;  2VRF A;  3BPU A;  1BE9 A;  2KOH A;  4Q6S A;  2GEF A;  1IHJ A;  3QIK A;  2JSN A;  3K1R A;  3QO6 A;  2V90 A;  1G9O A;  2I6V A;  4FLN A;  2LA8 A;  3TMH A;  3GCN A;  2OMJ A;  2G2L A;  4K75 A;  2AWX A;  4E34 A;  5D13 A;  3NFK A;  4JL7 A;  2EDV A;  5G1E A;  2KJD A;  2LOB A;  3B76 A;  2W4F A;  3DJ3 A;  3SFJ A;  1VJ6 A;  2I0I A;  1RGW A;  3VQF A;  1Y8T A;  4JOP A;  5E21 A;  5HFF A;  1OZI A;  2AWW A;  1RGR A;  2YUY A;  5DTH A;  4OAJ A;  3KHF A;  4NNM A;  3SHU A;  1UJU A;  1D5G A;  2Z9I A;  5EZ0 A;  1IU2 A;  2KAW A;  3LNY A;  2PKT A;  2PKU A;  2I1N A;  2EEH A;  1X45 A;  2AWU A;  1WFV A;  2JOA A;  2ZPL A;  2D90 A;  1VAE A;  5GND A;  4KFW A;  1TP5 A;  2P3W A;  4Q2O A;  2KBS A;  2W7R A;  1Y7N A;  1M5Z A;  2JRE A;  4LMM A;  3PS4 A;  1FCF A;  2O2T A;  1BFE A;  3K50 A;  4JOE A;  4GHN A;  2DB5 A;  4E3B A;  4NMO A;  1V1T A;  4E35 A;  4UU5 A;  3HPM A;  4Q2N A;  2IWP A;  2EAQ A;  1WG6 A;  5E6P B;  1Q7X A;  3R68 A;  4RI0 A;  2EEI A;  3QDO A;  1QAV A;  4REY A;  2BYG A;  3PDV A;  5A2P A;  1N7T A;  1RY4 A;  5HFE A;  2DM8 A;  3DIW A;  5HFC A;  1R6J A;  3ZRT A;  3DJ1 A;  3LNX A;  3SHW A;  2QT5 A;  5B42 A;  3NFL A;  3PDZ A;  2MHO A;  1UHP A;  2G5M B;  1SOT A;  2OSG A;  1UEQ A;  5G1D A;  1LCY A;  2KL1 A;  2R4H A;  2KJP A;  4YDP A;  1QAU A;  2V1W A;  1QAV B;  2QKV A;  2H2B A;  2YTW A;  3DOR A;  2I4S A;  5IL9 A;  2EDP A;  3NGH A;  3VQG A;  2KOM A;  3NCV A;  1VCW A;  2M3M A;  3ID2 A;  1K32 A;  1Z87 A;  1SOZ A;  3CBZ A;  1TQ3 A;  1N6D A;  2LUI A;  4JOG A;  1UM1 A;  2KPK A;  3GGE A;  3CBY A;  1P1D A;  4JJ0 A;  2IWN A;  1KWA A;  3KDK A;  3O46 A;  1WF8 A;  2CS5 A;  2VSP A;  1ZUB A;  2DMZ A;  1ZOK A;  2DC2 A;  3K82 A;  5E11 A;  3PV5 A;  3SUZ A;  1Z86 A;  1X9Z A;  4JOK A;  3GDU A;  2MX6 A;  2IWQ A;  3R69 A;  3EGG C;  1X5R A;  1WJL A;  1GQ5 A;  3R0H A;  4Z33 A;  4K72 A;  5FB8 C;  2GZV A;  2KV8 A;  1N6E A;  4NXQ A;  4KFV A;  4OEP A;  4Q2P A;  2H3M A;  3PV4 A;  1WI2 A;  5FHT A;  1N6F A;  1KEF A;  3WKL A;  2M0Z A;  3CC0 A;  3OTP A;  4Q3H A;  2EDZ A;  1X5Q A;  1U3B A;  3WKM A;  3O5N A;  1N99 A;  1W9O A;  2VPH A;  2OGP A;  1W9E A;  1V6B A;  3FY5 A;  1U37 A;  5HFB A;  2DLU A;  2L97 A;  4JOF A;  2Q3G A;  1UM7 A;  2R3Y A;  5HJ1 A;  1TP3 A;  2QKU A;  1TE0 A;  1OBX A;  3OU0 A;  3GDS A;  3CYY A;  4JJ3 A;  2OCS A;  2JXO A;  2KPL A;  3AXA A;  3HPK A;  4G69 A;  1U38 A;  2D92 A;  2EGK A;  1OBY A;  1WH1 A;  2I0L A;  2OPG A;  1V62 A;  2KG2 A;  2JIN A;  2KRG A;  4Q2Q A;  1FC6 A;  2DLS A;  2JIK A;  2EV8 A;  2EXG A;  2KYL A;  2F0A A;  1NF3 C;  2HE4 A;  1WHD A;  1QLC A;  1V5L A;  3QE1 A;  3ID1 A;  4HOP A;  1UEZ A;  4JOJ A;  5HED A;  5ILB A;  3KZE A;  1WFG A;  5JXB A;  2UZC A;  4XHV A;  2HGA A;  2YT8 A;  5I7Z A;  3RLE A;  1VA8 A;  1I92 A;  1OBZ A;  2QKT A;  2HE2 A;  3KZD A; 
#chains in the Genus database with same CATH homology
 3RL7 A;  3CH8 A;  1FC7 A;  1N7F A;  3JXT A;  2KJK A;  5B6L A;  2EGN A;  1X8S A;  1Q3O A;  3PV2 A;  2CSS A;  2OS6 A;  2FCF A;  2L4S A;  5HDY A;  4WYU A;  4H11 A;  3CBX A;  4GVC A;  4YYX A;  4HOP B;  2X7Z A;  3TSV A;  1L6O A;  3CS0 A;  1NTE A;  2VZ5 A;  1MFL A;  4OEO A;  5HFD A;  4WYT A;  3QJM A;  3GAB A;  3GSL A;  4K78 A;  5HET A;  3E17 A;  3I4W A;  1I16 A;  5E22 A;  4NXR A;  4L8N A;  5E1Y A;  3TSZ A;  5HF4 A;  2JWE A;  4Q6H A;  3SOE A;  3EGH C;  3MH6 A;  4NMP A;  2REY A;  1MFG A;  3GJ9 A;  4IC6 A;  1U39 A;  2M0U A;  4R2Z A;  3RL8 A;  4NXP A;  2M0T A;  1YBO A;  2H2C A;  2EEJ A;  4GVD A;  4NMQ A;  2M10 A;  4NNL A;  1GM1 A;  1RZX A;  2EEG A;  1UJD A;  2OQS A;  3QGL A;  1X5N A;  3GCO A;  4K76 A;  2Z17 A;  3I1E A;  1UFX A;  2DKR A;  4JOR A;  3ID4 A;  1V5Q A;  3HVQ C;  3L4F D;  1W9Q A;  2KOJ A;  2EJY A;  5F3X A;  3STJ A;  2D8I A;  3TSW A;  2PDZ A;  2PA1 A;  1T2M A;  2K1Z A;  2KQF A;  4N6X A;  1VB7 A;  1N7E A;  1XZ9 A;  2L4T A;  2AIN A;  3MH7 A;  2FN5 A;  2VSV A;  4P2A B;  5HEB A;  4PQW A;  3DJA A;  4FGM A;  1UIT A;  2EHR A;  4F8K A;  4P0C A;  2VWR A;  2WL7 A;  4NMR A;  1Q3P A;  4JOH A;  4AMH A;  2IWO A;  2LC6 A;  2LC7 A;  4NMV A;  4O06 A;  2H3L A;  1FC9 A;  1MC7 A;  2E7K A;  2FE5 A;  4MPA A;  1UF1 A;  2PNT A;  2EGO A;  2QBW A;  2RRM A;  1PDR A;  1KY9 A;  2I04 A;  3ID3 A;  2M0V A;  2F5Y A;  1P1E A;  1GQ4 A;  1UEW A;  2K20 A;  5GLJ A;  2KA9 A;  5HF1 A;  5EYZ A;  1UEP A;  2FNE A;  2PZD A;  2JIL A;  4NMT A;  4Z8J A;  2Q9V A;  4K6Y A;  2DAZ A;  2ZPM A;  4EDJ A;  1B8Q A;  1WHA A;  1WIF A;  4UU6 A;  2RCZ A;  2DJT A;  2ENO A;  2QG1 A;  2OZF A;  3MH4 A;  1WF7 A;  5F67 A;  1X6D A;  3GDV A;  3QJN A;  2CSJ A;  4NMS A;  1UJV A;  2YUB A;  1IU0 A;  2YT7 A;  3KDG A;  3I18 A;  1WI4 A;  5H3J A;  5HEY A;  2VRF A;  3BPU A;  1BE9 A;  2KOH A;  4Q6S A;  2GEF A;  1IHJ A;  3QIK A;  2JSN A;  3K1R A;  3QO6 A;  2V90 A;  1G9O A;  2I6V A;  4FLN A;  2LA8 A;  3TMH A;  3GCN A;  2OMJ A;  2G2L A;  4K75 A;  2AWX A;  4E34 A;  5D13 A;  3NFK A;  4JL7 A;  2EDV A;  5G1E A;  2KJD A;  2LOB A;  3B76 A;  2W4F A;  3DJ3 A;  3SFJ A;  1VJ6 A;  2I0I A;  1RGW A;  3VQF A;  1Y8T A;  4JOP A;  5E21 A;  5HFF A;  1OZI A;  2AWW A;  1RGR A;  2YUY A;  5DTH A;  4OAJ A;  3KHF A;  4NNM A;  3SHU A;  1UJU A;  1D5G A;  2Z9I A;  5EZ0 A;  1IU2 A;  2KAW A;  3LNY A;  2PKT A;  2PKU A;  2I1N A;  2EEH A;  1X45 A;  2AWU A;  1WFV A;  2JOA A;  2ZPL A;  2D90 A;  1VAE A;  5GND A;  4KFW A;  1TP5 A;  2P3W A;  4Q2O A;  2KBS A;  2W7R A;  1Y7N A;  1M5Z A;  2JRE A;  4LMM A;  3PS4 A;  1FCF A;  2O2T A;  1BFE A;  3K50 A;  4JOE A;  4GHN A;  2DB5 A;  4E3B A;  4NMO A;  1V1T A;  4E35 A;  4UU5 A;  3HPM A;  4Q2N A;  2IWP A;  2EAQ A;  1WG6 A;  5E6P B;  1Q7X A;  3R68 A;  4RI0 A;  2EEI A;  3QDO A;  1QAV A;  4REY A;  2BYG A;  3PDV A;  5A2P A;  1N7T A;  1RY4 A;  5HFE A;  2DM8 A;  3DIW A;  5HFC A;  1R6J A;  3ZRT A;  3DJ1 A;  3LNX A;  3SHW A;  2QT5 A;  5B42 A;  3NFL A;  3PDZ A;  2MHO A;  1UHP A;  2G5M B;  1SOT A;  2OSG A;  1UEQ A;  5G1D A;  1LCY A;  2KL1 A;  2R4H A;  2KJP A;  4YDP A;  1QAU A;  2V1W A;  1QAV B;  2QKV A;  2H2B A;  2YTW A;  3DOR A;  2I4S A;  5IL9 A;  2EDP A;  3NGH A;  3VQG A;  2KOM A;  3NCV A;  1VCW A;  2M3M A;  3ID2 A;  1K32 A;  1Z87 A;  1SOZ A;  3CBZ A;  1TQ3 A;  1N6D A;  2LUI A;  4JOG A;  1UM1 A;  2KPK A;  3GGE A;  3CBY A;  1P1D A;  4JJ0 A;  2IWN A;  1KWA A;  3KDK A;  3O46 A;  1WF8 A;  2CS5 A;  2VSP A;  1ZUB A;  2DMZ A;  1ZOK A;  2DC2 A;  3K82 A;  5E11 A;  3PV5 A;  3SUZ A;  1Z86 A;  1X9Z A;  4JOK A;  3GDU A;  2MX6 A;  2IWQ A;  3R69 A;  3EGG C;  1X5R A;  1WJL A;  1GQ5 A;  3R0H A;  4Z33 A;  4K72 A;  5FB8 C;  2GZV A;  2KV8 A;  1N6E A;  4NXQ A;  4KFV A;  4OEP A;  4Q2P A;  2H3M A;  3PV4 A;  1WI2 A;  5FHT A;  1N6F A;  1KEF A;  3WKL A;  2M0Z A;  3CC0 A;  3OTP A;  4Q3H A;  2EDZ A;  1X5Q A;  1U3B A;  3WKM A;  3O5N A;  1N99 A;  1W9O A;  2VPH A;  2OGP A;  1W9E A;  1V6B A;  3FY5 A;  1U37 A;  5HFB A;  2DLU A;  2L97 A;  4JOF A;  2Q3G A;  1UM7 A;  2R3Y A;  5HJ1 A;  1TP3 A;  2QKU A;  1TE0 A;  1OBX A;  3OU0 A;  3GDS A;  3CYY A;  4JJ3 A;  2OCS A;  2JXO A;  2KPL A;  3AXA A;  3HPK A;  4G69 A;  1U38 A;  2D92 A;  2EGK A;  1OBY A;  1WH1 A;  2I0L A;  2OPG A;  1V62 A;  2KG2 A;  2JIN A;  2KRG A;  4Q2Q A;  1FC6 A;  2DLS A;  2JIK A;  2EV8 A;  2EXG A;  2KYL A;  2F0A A;  1NF3 C;  2HE4 A;  1WHD A;  1QLC A;  1V5L A;  3QE1 A;  3ID1 A;  4HOP A;  1UEZ A;  4JOJ A;  5HED A;  5ILB A;  3KZE A;  1WFG A;  5JXB A;  2UZC A;  4XHV A;  2HGA A;  2YT8 A;  5I7Z A;  3RLE A;  1VA8 A;  1I92 A;  1OBZ A;  2QKT A;  2HE2 A;  3KZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...