2R3YA

Crystal structure of the degs protease in complex with the ywf activating peptide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
311
structure length
280
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGIVVNEVSPDGPAANAGIQVNDLIISVDNKPATMDQVAEIRPGSVIPVVVLQVTIQEYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase activator
molecule keywords Protease degS
publication title Regulation of the sigmaE stress response by DegS: how the PDZ domain keeps the protease inactive in the resting state and allows integration of different OMP-derived stress signals upon folding stress.
pubmed doi rcsb
source organism Escherichia coli
total genus 52
structure length 280
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2r3yA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3yA02
1GI5A 3JZ2B 1N6DA 4QT8C 3GCOA 1GJAB 2OLGA 5E0HA 3LJOA 2KV8A 3KNXA 4O97A 2IOTA 1EJAA 2EEGA 1C1PA 4TPYA 3SFJA 3MO3A 1HAXB 5FAHA 1CA8B 2IN2A 5C1YA 1MFLA 1L0ZA 4FUJA 2LUIA 1AO5A 1B0FA 2XBYA 4IC5A 2YUBA 4AMHA 1OP8A 4Y7AA 4NG9H 4Y71A 1OWEA 2KJPA 3A89A 2H9TH 5LH8A 2BB4A 2ZGJA 4BXSA 5HDYA 3ID1A 1DXPA 1ZRKA 1G2LA 1AE8H 2G2LA 3A80A 1NN6A 2EI8A 2VJ1A 2NWNA 4K69A 1YCPH 5A09A 3GY7A 4ZKOU 3MHWU 3SU2A 1AE5A 1ID5H 1DXWA 1D3QB 1V6DA 1YPHC 3UY9A 2CHAC 1FNIA 2A5IA 1EP6A 3RXPA 1E36B 2DAZA 2H2CA 1HJ8A 2HGAA 2ZHFH 4ZKRU 1YLCA 1HPGA 4XE4A 2HALA 3KQEA 4IMZA 1HIAB 3TLOA 1ZPZA 1C5WB 5HGGA 3CBXA 1OX1A 1LVBA 5T6DA 2LC7A 1BRCE 3EYDA 1S83A 1OYTH 2PKAB 2W26A 3GCHC 3R69A 1ELDE 4YT7H 2XTTB 4XOJA 2PZDA 3KEEA 1T8NA 1ZHRA 1UM1A 1O3HA 1OBYA 1UFXA 3BEIB 1O2GH 1Y3VA 2V0BA 4B2BA 3PDZA 1V2PT 4WMEA 2BQWB 5HF4A 3NCLA 2XBVA 2BDAA 2QF3A 3FZDA 1GVLA 1FC7A 1ELEE 1AI8H 3A7TA 2RA0A 3RXQA 1YPGH 3P95A 3HKJB 3QGJA 3IWMA 5A0BA 4KGAA 3ZVDA 2PLXA 2Q6GA 4J1YA 4LK4A 1Z8GA 1CT2E 2JOAA 1O3KA 4D9QA 1GHXH 3E1XB 3QGNB 2BQ7B 4CHAC 1F5RA 1KLJH 4RI0A 1A4WH 1SI5H 1PPBH 2G4UA 4D7FA 1NU9A 5DTHA 1WFGA 2J92A 1Q3OA 1Q31A 5JPMH 3SUGA 1LHEH 8KME2 1TB6H 1CQQA 2QXGA 5FCRA 3GDVA 5HMAA 3P8OA 9ESTA 2C8ZB 1I16A 1H8DH 3KQDA 1K1OA 1GJ9B 4WH8A 2ZTYA 3ZVGA 3TU7H 2ZG0H 1CSOE 1L1GA 3K9XB 2H9EH 2ZPLA 1BOQA 1YBOA 2QY0B 2VIDA 4NZQA 2HE2A 1DLEA 2OC1A 5DKMA 2BX4A 3CP7A 3GY8A 1ESBA 4WMDA 4JYTA 2I1NA 4Y0ZE 1Z1JA 3Q77A 3SGBE 1HIAA 1J17T 4H6TA 5E11A 3PO1B 4NSVA 4OGXA 5EQQA 4DCDA 1MKXH 4TY7A 4JOHA 2G4TA 1ARBA 1C5PA 5FPSA 1V2JT 3SGAE 2AMQA 3U98H 2K20A 1LPZB 1O5AB 3BTWE 6LPRA 2BY6X 3E17A 1SQAA 1TNJA 3L33A 2SNWA 4JOJA 2QG1A 2OC7A 1HAVB 1EOJA 2ANMH 1C5YB 4KFVA 5HEDA 5DP9A 1RTFB 1V2TT 2ZDMA 1SHYA 2AWWA 4R0IA 2GZ8A 1WBGB 3AW0A 3M3TA 1KDQB 2VH0A 2ZGCA 5IYTA 4RKOB 2Z9IA 4HTCH 1ZJKA 1VAEA 1FY4A 2P93A 2GV6A 2PDZA 1GG6B 1LMWB 2CV3A 1ANDA 4U01A 4A1VA 4NMQA 2ASUB 3NFKA 4Q2NA 1UVTH 2EDVA 2XC5A 4OS5A 3ZZ6A 4LOYH 3ZZDA 1GMHF 5DG6A 4Q2QA 3TGIE 1GI9B 2G00A 5EZ0A 1F5LA 2OCVB 2Y81A 1O36A 2PUQH 3RMOH 4CREA 3NFLA 2ANWA 4X1QU 1MTWA 1P3EA 2CMYA 1AHTH 3QX5H 1UJDA 2A4OA 4NIYA 5F8XA 1CGJE 3S7KB 1GBTA 2ZQ1A 2OCSA 3HGPA 1U37A 4I31A 1T2MA 3SU0A 1QQ4A 4WYUA 3TJNA 1OYQA 3SJ9A 1P06A 4NWKA 4K8BA 4DW2U 1WUNH 2GDEH 2BZAA 1MH0A 5A2PA 1B8QA 3RXMA 3VPKA 2DJTA 4NA7A 1WH1A 4NA8A 4G69A 4OS7A 1C2EA 1UCYE 1C2MA 2TPIZ 2Y5GA 2QXIA 2F3CE 1GI0A 1DITH 2QYIA 2FX6A 1WI2A 3KHFA 3ODDA 1H9HE 1TGCA 1SGYE 2J34A 2BYGA 3MO9A 4UU6A 1ZOMA 3Q3YA 3U8RH 2XC0A 4UFDH 5FCKA 2J2UA 2W5EA 2WV4A 4JYVH 2L97A 1RZXA 3ZZ4A 1MTSA 2WPMS 2H6MA 5GCHF 1UTMA 1G2MA 3BN9A 1T32A 4JZEH 1HAVA 1EATA 1NS3A 1GMCG 1GPZA 1L2EA 2BXTH 8GCHF 1GJ7B 2VNTA 3SZNA 2ZHDA 1KDQA 1CGIE 5ETXA 4IS5A 1XVOA 3RUOA 4ISIH 1X6DA 1FY8E 2SGEE 1PQ5A 4INHA 4UDWH 4UFFH 1RS0A 2F91A 1Y3XA 4GUXA 1DSTA 5GPIB 1G32B 4Z33A 3MI4A 1DT2A 1Q2WA 1DANH 2STAE 1VR1H 1QR3E 2ZGXH 5DK1A 4LZ1H 2A7HA 3FP8E 2BVXH 3RU4T 2D8IA 1GJBB 1FUJA 1FZZA 3ID3A 4X8VH 3TGKE 1AQ7A 1V2QT 1O2UA 1TNKA 1RD3B 2C90B 1YYY1 1C5OH 4X2VA 1P1DA 1ORFA 1YM0A 2ZA5A 3GGEA 1IQEA 4X6PA 2PW8H 4X8SH 4UONA 3ZVEA 3PV5A 4XBDA 2J95A 1GCTB 1QAVB 1N99A 5ESBA 2M0UA 3GISB 1JIRA 7KMEH 2OQUA 3H7TA 5CHAC 1LPGB 1V2MT 2K1QA 1GMDG 5I25A 1Y7NA 2Y5FA 4HFPB 3SUDA 3SV2H 1SGDE 1BT7A 5K7RA 3ATLA 3A8BA 3RMMH 3SU3A 1HV7A 2EA3A 2BVSH 4I33A 5EXNA 3SUEA 4PQWA 1O30A 1KTTB 2EEHA 2HRVA 1WTGH 3BG8A 2TBSA 2FOBA 3TMHA 2OPGA 3KHVA 2BDBA 4A6LA 1V2ST 4ZAEA 1KXCA 2GKVE 1D3DB 3EGHC 2IPHA 3BV9B 2QGRA 2SGPE 5L30H 2GMTB 1NU7B 1O3BA 3Q76A 1QTFA 3S7HB 6GCHF 4Q7XA 1RGRA 1CBWC 3HPKA 4XBBA 1PYTD 1T8MA 1BMMH 4JMYA 1C2DA 5T3HA 1C1TA 4K3JA 4AGJA 4AFZA 3SNBA 1TP5A 4FGMA 4WYTA 1CGHA 2RA3A 1NY22 4MPXA 4BNRA 2R3YA 1V2VT 1ETRH 4DIHH 1O33A 1Z6EA 3RXKA 4IN2A 1D9IA 3PTBA 1V5LA 3MNXA 2EI6A 2ESTE 3I78A 2FTLE 2G55A 2VRFA 1S5SA 2DM8A 4E3BA 1EPTA 4K75A 4FUBA 1Z71A 3ZZ7A 1HNEE 1YKTA 3RC5A 1PFXC 2H3LA 2ZDLA 1FC6A 2Z9LA 1BBRH 3TVJB 1TBZH 1TMBH 1FPCH 2KRGA 2GTBA 1QAVA 1LVOA 1W13U 1UTOA 3TJOA 4R2ZA 2F9OA 1HGTH 2CHAB 4ABGA 5B6OA 2ZCHP 1P10A 1GJ6A 1AN1E 1GI3A 3SNDA 3SQHE 2VB0A 2KPLA 3H5CB 1BFEA 1THPB 1VCPA 2KJDA 2ANKH 1K28D 1I92A 1ZHPA 1FQ3A 1WIFA 1O2PA 1YPLH 2XXLA 3BTME 3KGPA 3A7XA 4INKA 4GVCA 4RKJB 3TNSA 3UQOA 1QA7A 2OGPA 2TGDA 6CHAC 1O2NA 2I4SA 2ZHQH 4I8JA 2H5CA 1A0LA 3B8JA 3DJ1A 1QL8A 4AYVB 4GPGA 4OS6A 5ESTE 2DUCA 5HFCA 1LQDB 2EAQA 2JETC 3RLYH 3GCHB 3MH4A 1CVWH 1TONA 4B75A 3K65B 1MMJN 4X6MA 1AVXA 1C4V2 1OWHA 3DJ3A 3S0NA 2I04A 1QURH 1BBRK 2RG3A 3TK9A 3PDVA 3IG6B 3M7QA 3ZVAA 3M5OA 3SQEE 4X1PU 4CRAA 2PHBA 3MTYA 1DM4B 2HNTC 4XHVA 1HAHH 1F0RA 3T28A 2EGNA 2ZFQH 4X8TH 1ELGA 1NTEA 4YLQH 1ELAA 1C5NH 2BD4A 4X0WU 1TRNA 1A7SA 4NIXA 5LPFA 2YNBA 3V3MA 1V2NT 2QKVA 2AIQA 5C67A 2P8OC 2FS8A 4CHAB 1DUAA 2B9LA 3W95A 2BMGB 4WWYA 2GZ7A 1HCGA 1TGSZ 1SB1H 1ZTKA 3SHUA 2GDDA 1OOKB 2CSJA 2V35A 4ISNA 3ZVFA 1JWTA 4IC6A 3A84A 1C5UA 1DLKB 1O2TA 4JOGA 1XUGA 2FX4A 3U69H 4GCHG 2QA9E 2KAIB 2Z9JA 3LC3A 1CU1A 5EXMA 1AY6H 3OX7U 2OINA 3RXAA 3VEQB 5GWZA 2PKUA 1C2JA 1DY9A 4EDJA 2C4FH 4E7NA 3ZRTA 4BAQB 3OU0A 1A3EH 5C1XA 1GI2A 5GLJA 3QE1A 2DC2A 1GBBA 1SFQB 1ELVA 1ACBE 5HEYA 3A86A 1LHGH 4Y7BA 2G5VA 1TLDA 3P8FA 1VGCC 4AZ2B 1OZIA 5JBCS 1DE7H 5A8XA 1V1TA 3HK3B 4M7GA 5FHTA 1TALA 2KPKA 5HFDA 1NRQH 3UNSA 1CHOF 3ELAH 1E38B 1MU8B 4FUEA 3P8NA 3EGKH 5J4SA 1UJVA 1YCPM 2Z3EA 4NFFA 7GCHF 1ABIH 1EAWA 3U8TH 1TABE 2J9NA 3EA7A 3RL8A 3KL6A 3LOXA 3CC0A 1L4DA 1P2IA 3MU1A 5E2PA 3SW2B 2G5MB 1TQ0B 4CRFA 3ATKA 2JREA 3LGVA 1EQ9A 4AYYB 1UTPA 4NIWA 3SV6A 2ZKSA 3BPUA 4CH2B 1GMHG 2FI5E 3WKMA 1YLDA 3MWIU 1TGNA 4K76A 2ZGBH 3SI3H 3KQCA 5HFEA 1DICA 4BAMB 3KN2A 1ZMNA 3OSYA 2ALVA 2VSPA 1LVYA 3TSZA 1KYNA 1MBQA 1O2LA 2M0VA 1UTQA 2WUBA 1TOCB 4H11A 5G1EA 1OWJA 1A5GH 3M3SA 4NCYA 1C2HA 2FPZA 3GCTF 2JXOA 1W7GH 3QLPH 1ARCA 5DPAA 3BEFB 3BG4C 4O3TA 4X8UH 2KAIA 1O5BB 3O8CA 1NFXA 3RXGA 5DP8A 1BTXA 2F9NA 1P2NA 2M5TA 3LGIA 5EGMA 2FO9A 1GHZA 5F8ZA 2ZPQA 1SGCA 3E0NB 1GL0E 2NU0E 3SHWA 5GIBA 1TA6A 2IWPA 1IQMA 1E35B 2AMPA 2BDCA 2H2ZA 1XUJA 4RSPA 1FXYA 1BA8B 4KELA 5DO4H 1NFYA 1O2JA 1K1IA 1YP9A 1W11U 3UNQA 5HM9A 2HPQH 4KKDA 2Z9GA 4NMRA 2I6VA 1Z87A 2BX3A 1GBKA 3M37A 1SPJA 1U3BA 2VIOA 1AWFH 1GBDA 1GCDA 1NTPA 3AASA 3RXTA 2ZIQH 2I6SA 3R0FA 2GMTC 2F9UA 4Y8ZA 1EAXA 3R68A 2R0KA 3OTJE 2PKTA 3A7ZA 3GY3A 1J14A 1ELCA 3IITA 1N7EA 3RMLH 4NMSA 4Z8JA 1O0DH 1L6OA 1EB2A 2H3MA 2BYAX 1IOEA 1GQ5A 1NO9H 1G3DA 3SJ8A 3MMGA 1DX5M 3NGHA 1QQUA 3MNCA 4JK5A 4YO9A 1QIXB 2ODQA 1BTHH 1EUFA 1ZGIA 2QC2A 2BQ6B 2P3WA 1TMUH 1O2MA 2OBQA 3EAJA 1MUEB 3U8OH 3PLBA 1VJ6A 2W4FA 4K6YA 3RXEA 2EJYA 4NNLA 3PMAB 1N6FA 1SGFA 1K1PA 2PUXB 3BIUH 2GVFA 1SOZA 3EA8A 1KXBA 1OXGA 3MH5A 4UU5A 1NRNH 3PS4A 5H3JA 4TY6A 3TNTA 4D7GA 2D8WA 3JZ1B 1SLXB 1QLCA 4D8NA 1C5MD 1YPMH 5T6FA 4BAOB 5G1DA 2C8WB 3PROA 4MPWA 5AHGH 1TWXB 3LH3A 3M7UA 2VGCC 5CHAB 1S6HA 4OS1A 2A32A 1YC0A 1DPOA 4JOKA 2WPIS 1F2SE 1XUIA 5J4QA 1NESE 1RIWB 1T4UH 2VVCA 1FV9A 3BIVH 3LPRA 1C5VA 4NZLA 1GBEA 5DJ7A 5F6MA 7LPRA 1G36A 5I46H 2AGIX 1HAPH 2J94A 1G9OA 1OKXA 1V2RT 1ZMLA 3QJMA 3PB1E 4JOEA 1GI7B 2FIRH 5EU8A 2JWEA 2VPHA 3STJA 4Q7ZA 3SUZA 4KTUA 1M5ZA 1YCPK 2BHGA 1FN8A 1AVWA 1QRXA 2EDPA 2EXGA 1O3FA 1CBWB 4IBLH 1ELBA 4JOPA 1TX7A 1A5HA 4HGCA 5GDSH 2FYRA 1FY5A 3WKLA 3NPSA 3BEUA 5E0JA 3U1IB 1VA8A 2OD3B 1FN6A 3PWCA 1EZXC 2OC0A 5BRRE 4WY3A 1AD8H 3SOSA 1DSUA 2A7CA 4JZDH 5A8YA 3QK1A 1FAXA 3E8LA 5D13A 5HETA 4Q3HA 1J9CH 1O2ZA 1HJAC 1W8BH 4KFWA 4ABAA 4LXBH 3O46A 1S0RA 1LHDH 3SHAH 1VZQH 2FI3E 4Y11E 1O39A 3ZZ9A 1EZSC 2Z9KA 3HPTB 3VFEA 2FOHA 4AB9A 4GHTA 1U6QA 2PNTA 1WCZA 5L2ZH 4MNXA 1KXAA 2W3IA 1SGIB 2O8TA 1WTHD 1Q3XA 4Z0KA 3ZVCA 3LU9B 3M5LA 3T5FH 1GBIA 4ZMAH 5GJ4B 1DFPA 2H5DA 4I8KA 5AFZH 1QY6A 5A0AE 3M35A 1WU1A 2ENOA 1OP0A 1AZ8A 5EXLA 1TNLA 2DB5A 3MYWA 3MH6A 5JXBA 1EP5A 1QBOA 2PKAA 1UO6A 2QV1A 4UD9H 6CHAB 2FMJA 1C5SA 3DD2H 1QB9A 1MZDA 3M61U 2SGQE 2AEIH 1OPHB 2F0AA 1Z1IA 2ZEBA 3P92A 2AWXA 1K2I1 3GY6A 2JETB 2L4TA 2H1UA 4OS2A 1EOLA 1QL7A 1O5CB 3ZVBA 1BTPA 5HJ1A 1RJXB 1BDAA 3KQBA 2TGPZ 3E16B 2ALPA 1OWIA 2ZDVH 4MNVA 3CS0A 4Y79A 4YDPA 4MNWA 2FOCA 1QCPA 1LHFH 3B9FH 5C1UA 1WI4A 2DLSA 3I77A 4JZFH 1Q3PA 4AX9H 4MTBA 1WJLA 1F0TA 3ITIA 4I7YH 3QZQA 1G3CA 1W0YH 1WHAA 3U1JB 3TSWA 1MKXK 7ESTE 4SGAE 1WHDA 1JBUH 3RXCA 1NFWA 2BLOA 1AB9C 1SG8B 1C1QA 3K6YA 1UCYH 3VB5A 1T31A 2P8OB 2ZGHA 4DURA 1EKBB 3VXFH 2FEQH 3LONA 1UHPA 1ZSLA 2ZWLH 1G9IE 4PROA 1OSSA 4YOJA 3RC6A 1WOFA 5F03A 1NRPH 4ISLA 2A5KA 1BTZA 2ZDKA 1IU2A 3R0HA 1TIOA 2ZHEH 1GHBF 1UEPA 3OYPA 2GGVB 1ZR0A 4UEHH 1TYNA 2IWNA 3SN8A 1ELFA 2BLVA 1FC9A 2UWOA 2Y5HA 1ELTA 3VQFA 1TFXA 2XRCA 1O3PB 1CHOG 2CXVA 1SFIA 4UFGH 2M0ZA 1X5QA 2A4GA 1V2WT 3BF6H 1K21H 4JORA 4E06H 1VGCB 2HGTH 3MU5A 1HAGE 3RXLA 1QNJA 3T2NA 3NZIA 3RXDA 1QFKH 2UWLA 1MD8A 2GCTC 3ZZBA 3U9AH 3T62A 2PA1A 4YTAA 3MU0A 4YT6H 3LKWA 5B6LA 1VJ9U 4B2AA 3M5NA 1C5ZB 1UEZA 2EDZA 1P9SA 4YOGA 4CR5A 1THRH 3QUMP 5F67A 2GV7A 1LVMA 3MNBA 3SUFA 2TGAA 1GQ4A 2M0TA 5FB8C 2A5AA 1MD7A 1UITA 4XDEA 2W3KA 4K8YA 2BD3A 2QXHA 3QJNA 3FP7E 5IDKA 4FUCA 2ULLA 1YF4A 1T4VH 2LC6A 2D1JA 1UHBB 8ESTE 2QKTA 1ZRBA 2FNEA 2Q1JA 1TOMH 5C3NA 3PLPA 4H42U 1O2KA 3F68H 1EX3A 2Q6FA 5JBAS 4KTCA 2ZU1A 1KWAA 1ZGVA 4E05H 1C5LH 1P04A 1QJ6B 4NFEA 4AOQA 9LPRA 1C1VH 3NKKA 4B73A 3UWJH 2ODYB 2WPJS 2YT7A 1U39A 1KXEA 1L4ZA 2GZ9A 3PV4A 5C20A 2QT5A 2BVRH 3BG4B 1UTLM 1FONA 3SBKA 1B7XB 2MX6A 3A82A 1O2HA 3AW1A 1G3BA 2AS9A 2ODPA 3ZZ3A 4NGAH 1O5GH 3D49H 1G30B 2O8MA 1TBQH 4KP0A 4FU7A 2BY9X 2ZU4A 1CA0C 4ESTE 1KTSB 1UTNA 2I0LA 1O3GA 2FOFA 2FS9A 3BSQA 3ZZ8A 3A85A 1L1JA 1RIWC 1IQJA 4IN1A 1Z86A 1C1OA 1KXFA 3GDSA 1K9OE 1RTLA 2F9VA 1D3PB 1F7ZA 1Y5AT 2R4HA 1DWCH 4AFQA 1O38A 4K1TA 1IQLA 1N1LA 3O8DA 4DT7B 1O2WA 3I18A 1X8SA 2R9PA 2REYA 3T26A 1LTOA 2P95A 4DIIH 5JBBS 2OZFA 1CHGA 1K1MA 2UUYA 1C1MA 4AG1A 1SC8U 1QJ7B 2J4IA 1O3AA 3LNYA 1TP3A 3O8BA 1BMLA 3SOEA 3I29A 1DWDH 3KZEA 4AFSA 5GXPA 1GBMA 5ABWA 4F8KA 1GI8B 1JOUB 3FFGA 1W0ZU 3EGGC 2WPLS 2H2BA 2V90A 3K50A 5L6NH 2AYWA 5EPYA 1UHBA 3RXVA 4KTSA 5HYOA 3BTFE 1OP2A 2A31A 3OY6U 2AINA 1QHRB 3TH2H 4ZROA 3O5NA 2VIWA 4AFUA 1O2RA 4FUIA 2MHOA 3F6UH 3ZV8A 1UK4A 3BTKE 1GBHA 1E0FD 3M5MA 4CBNA 1PPHE 2P16A 1P1EA 1PQ7A 1G37A 2DE9A 3UWIA 1O3IA 4IMQA 2EV8A 4DJZB 1GVKB 5SGAE 2F9PA 1GDQA 2HLCA 3HGNA 1P9UA 3DFLA 2FCFA 2SFAA 2VGCB 1QGFA 3BTGE 4K72A 3UTUH 2B0FA 1NC6A 5A0CA 1IQNA 4P0CA 2P94A 2VZ5A 1XXFA 1ETTH 2ZTXA 1H4WA 1QBNA 3ZV9A 2AMDA 2ZZUH 1ZHMA 2BD9A 5JYIA 3QIKA 1SGEE 1HB0B 2DMZA 1O5FH 3I1EA 2ZFSA 4ABJA 1XUHA 1RGWA 2ZQ2A 1AFQC 1AMHA 2FE5A 4WXVA 4ZKSU 2QN5T 1KLIH 2P59A 3HK6B 1QJ1B 3BTHE 1N7TA 1A3BH 3BTDE 2VU8E 2EGKA 1AKSB 3FP6E 4K2YA 3RC4A 1JRSA 1ZOKA 1INCA 1UMAH 2F5YA 1IHJA 1NFUA 2C93B 1O2QA 3ZZ5A 1MAYA 1BRBE 1SGPE 3HKIB 2UUFB 5DP5A 3K2UA 3A7WA 3E0PB 1N6YA 1O2OA 5A8ZA 2PFEA 1YPEH 3PMHB 2D90A 5EW1H 1HXEH 4ZHMU 2FOAA 2P3UB 5HEBA 5HXFA 1UEWA 4R8TB 2I0IA 1HJAB 4MPVA 3SU1A 3M36A 1K1LA 4YLUA 1HAYB 3VXEH 1UVUH 2FOMB 1KIGH 2UWPA 2LOBA 2AIPA 1GDNA 3KZDA 2V3HH 1VITF 4NXQA 1VCQA 3G01A 1ZSKA 1GL1A 4Y8YA 2VIPA 5LPEA 2AWUA 4B74A 1Y3WA 1UF1A 3DORA 2ZU3A 2RRMA 2G81E 4ZKNU 3D23A 1D6WA 2B8OH 2OBOA 4FVDA 5HM2A 4ASHA 1WF8A 1BJVA 3A87A 1NPMA 3OY5U 1W3CA 1TPSA 2KOMA 4TYDA 3GSLA 1LPKB 5FPYA 1P0SH 2XWAA 3UUZA 1MQ5A 4IGDA 3SV9A 4BXWA 2QIQA 3K1RA 2CGAA 2YOLA 4ZH8A 4NMTA 4A7IB 1R6JA 1TPOA 1ZSJA 2BD5A 2BD8A 1DWEH 1IHSH 1BZXE 2BXUH 1GGDC 2STBE 3UQVA 3PTNA 1FPHH 5FBEA 3OTPA 2G51A 5EPNA 4D76A 4DOQA 2O2TA 2A4QA 4JK6A 5E8EH 2BDIA 3AVZA 1AZZA 1T7CA 3PM3A 4GVDA 4WMFA 5DP6A 3MFJA 4CR9A 3F9GA 3A88A 1N6XA 1AKSA 3GYMA 1HYLA 3SU5A 1AFEH 1NF3C 1SSXA 2Z7FE 1PDRA 4ABDA 5L2YH 1PQ8A 4NXRA 1A1RA 3HPMA 3F1SB 2RDLA 2XWBI 1W12U 2OP9A 1XX9A 1V2UT 1TQ7B 2BD7A 5AVDA 3CS7A 1V62A 4ABBA 1AGJA 1V2OT 2P3FH 1BHXB 1THSH 2WYGA 5DP4A 1AB9B 1Y59T 1GMCF 1EAIA 3UR6A 1ZPCA 3GICB 1AIXH 1C2KA 1BUIA 1C4Y2 3CYYA 1XKAC 4X6NA 1ZMJA 2H9HA 2ZP0H 1Y5BT 2TGTA 4HI3A 2LPRA 2W7UA 3TH4H 4BTTB 2ILNA 2OC8A 4Y10E 5PTPA 3ID2A 3RM0H 2JH5D 2WUCA 2AGGX 2IWQA 1EPTC 2Z94A 2FP7B 4N6XA 2Q3GA 2QCYA 4B76A 3DUXH 3V0XA 1N8OC 3EQ0H 3LGYA 1GBCA 3N7OA 1UJUA 3DJAA 2FYQA 3TH3H 1C5QA 2NU3E 5GCHG 4B2CA 1W7XH 1SLWB 1WQVH 2WV5A 4JL7A 1GJ8B 1C2IA 4FXGH 1P3CA 8GCHG 3URCA 3RXFA 4MQAA 3QDZB 2V6NA 3AAUA 1HJ9A 3PLKA 3FY5A 3VGCC 1UJ1A 3BTQE 2BD2A 2OXSA 3SNEA 1FCFA 2GCTB 1MC7A 1PPCE 2SGAA 2KYLA 4A5TS 2JIKA 2RCEA 2YT8A 3HVQC 1FJSA 3S9CA 1ESTA 1SGFG 1S84A 1GMDF 1TAWA 1EASA 2ZF0H 3ID4A 2FLBH 1TPPA 1C2LA 2M10A 4AG2A 4NMOA 2CS5A 1MAXA 1UEQA 2GT7A 1QAUA 3NWUA 5EQSA 1W14U 1P09A 4BOHA 2XW9A 1OS8A 3T25A 4X1NU 1NT1A 2C8XB 1ANBA 2R3UA 4GVUA 4SGBE 1MU6B 2BY7X 1FIWA 4NIVA 2ZNKH 4Y8XA 3TPIZ 5H4IB 3RMNH 1TA2A 4AORA 1O3JA 3F9FA 2ZI2H 4MG3A 2HE4A 3UNRA 2ZTZA 3T27A 4OS4A 3V12A 1H1BA 3SJOA 1Z8JB 1LDTT 1SGRE 4X2YA 1WV7H 4XBCA 3VB7A 1MCTA 5EODA 2G5NA 4UFEH 3K6ZA 2SNVA 2O8LA 4H4FA 4NXPA 2JH6D 5DP3A 1GHAF 5F3XA 1O3MA 1Y3YA 3SJKA 1YPHE 3C1KA 1W9OA 1CA0B 3B23B 3UOPA 5DP7A 4MPAA 2VH6A 4FUFA 1TRMA 1HDTH 4FVBA 2A45B 1C1RA 2WINI 5FBIA 4U2WA 4WJG2 1UVOA 2FLRH 3DIWA 6GCHG 4X6OA 2EI7A 1K32A 1BRAA 1SGTA 2EHRA 4OAJA 3TIUA 3L6PA 1SGNE 2OUAA 2I6QA 1CO7E 1XKBC 2C3SA 2PSYA 2AGEX 2KOJA 2PR3A 3V7TA 3SV7A 3D62A 5G4BA 1C2FA 5EW2H 1UTJA 1NM6A 1W9QA 1O3OA 2D92A 1O2YA 1WF7A 1FMGA 4Q2PA 4YESB 5TJXA 2Q6DA 5LPRA 2PKSC 1W9EA 3NK8A 3SGQE 1ANEA 1EJMA 2ZCKP 1GJDB 1ZYOA 3NUMA 1MTNC 6ESTA 1LCYA 1S81A 4K5ZA 2EEKA 1DWBH 1JRTA 4O03A 3VB4A 4Y0YE 1BMAA 1S6FA 1C2GA 3GY2A 1S0QA 4ISOA 5A2MH 1SL3A 1SOTA 2JINA 3RXUA 1PPGE 2IJOB 2PTNA 3KF2A 1P02A 4ZXYH 2LA8A 2P3TB 3GJ9A 2KA9A 1TX8A 1P2KA 4WF8A 1J16A 4X1SU 1FY1A 3NXPA 3QWCH 1V6BA 4CRBA 4I8GA 5EQRA 3PWBA 2PTCE 2XC4A 2PGBB 3TITA 3V13A 1QRZA 1NZQH 1BITA 4OEPA 3A7YA 1SBWA 4ZHLU 2M3MA 3T29A 2QBWA 2YTWA 1QBVH 3MNSA 4WXIA 3QZRA 4FUDA 3A83A 5C5NA 4GCHF 1V2KT 2V3OH 4JOFA 1JIMA 4F4OC 8LPRA 1S82A 2JH0D 2XBXA 1O3EA 2NU1E 3QTOH 2ANYA 3STIA 3QN7A 1AFQB 1SQOA 3MOCA 1C9TA 1LHCH 4MPUA 3O8RA 1BJUA 1MTVA 1IQGA 1TPAE 4Q6SA 3CBZA 4OGYA 5FPTA 4CRGA 4CBOA 5JB9S 2G52A 1XZ9A 1TX6A 1GBAA 3ZYDA 2OSGA 1XM1A 4K78A 4I8HA 1PPEE 1BIOA 5JDUB 4J2YB 3VB3A 1TNIA 2FWWA 2GD4B 4UE7H 3UR9A 1D3TB 2AH4X 4LMMA 2GP9B 4BTUB 1JMOH 1C1SA 2GCHF 1VB7A 4VGCC 3R3GB 1FI8A 5FXLA 3PYHA 1IHTH 1GM1A 1VITG 3QDOA 2EGOA 1HXFH 5FX6A 1MZAA 4I8LA 1XXDA 1C1UH 2Z3DA 1QL9A 2PSXA 1EXFA 4IW4E 1TGBA 2A2XH 2F9BH 1AWHB 1HAOH 5EOKA 2CSSA 3ZZCA 4Y6DA 3LGWA 2ZU5A 5HF1A 1P2JA 1CT0E 1FDPA 1P57B 2HWLB 1C5TA 5HFBA 1CT4E 1RY4A 1O3NA 1WSSH 1YPKH 2ZCLP 3QTVH 1FAKH 3UPEA 1HRTH 3Q3KA 7GCHG 1A0JA 4Q6HA 1UCYK 1UM7A 1XUFA 2B5TB 4DG4A 1TQ3A 2BM2A 4P2AB 1Q7XA 5E22A 1O31A 4O06A 1O2SA 5E1YA 1O2VA 1F0UA 1O3CA 1BTWA 5F8TA 2QF0A 1BTYA 4H6SB 1GGDB 5GNDA 1E34B 4A1XA 1SMFE 1QB6A 1KEFA 3A8AA 3MU8A 3ZYEA 1GI4A 2O8UA 2OS6A 4XSKU 2A0QB 3TK6A 3LT3A 3RXIA 1D4PB 3Q3XA 1ZUBA 1A2CH 4AGKA 1NRSH 4NMPA 4CH8B 1U38A 1BHXF 2BTCE 2BY5X 1H8IH 1T8LA 1ABJH 1BE9A 1KLTA 1GI1A 3M7TA 2KQFA 3GCTG 1PQAA 3KIDU 4DVAU 1GHVH 2ZO3H 1WYKA 3SORA 1WFVA 3PV2A 5C2ZA 3LC5A 3RXHA 3LDXH 2THFB 2JILA 3GY5A 1C9PA 5E6PB 3RL7A 2PGQB 2K1ZA 1RGQA 5E0GA 1X7AC 2WYJA 3H7OA 1S85A 1Z6JH 3RU4D 1RXPA 3RP2A 3E91A 4B1TA 2OMJA 3EA9A 2CN0H 2XNIA 4Q80A 1UTKA 4BTIB 1EZUC 4MLFB 1SR5C 1GBJA 2HOBA 4DGJA 2W7SA 3ESTA 1W2KH 1GBLA 1D5GA 2ZFRH 3RM2H 3P70B 1EPTB 4FU8A 1B5GH 2V1WA 1BQYA 1XUKA 3LNXA 3FZZA 1SQTA 1N8OB 5CMXH 1RTKA 1SHHB 2A2QH 2KBSA 3TJUA 2FM2A 2VVUA 2UZCA 1D6RA 4MVNA 4BANB 3S9BA 4NWLA 3ODFA 2KL1A 1BRUP 1JXPA 3MH7A 1BB0B 2VINA 2VIVA 1IAUA 3C27B 1GVZA 3KCGH 2SGFE 2ZPMA 2BOKA 4GLYA 1RRKA 2GT8A 1P03A 1KY9A 3VGCB 4AB8A 2FXRA 2A7JA 4XFQA 2TRMA 2ZDAH 2YUYA 1XVMA 3P6ZB 3SNAA 1QB1A 4U32A 1K22H 1IU0A 3UREA 4YM9A 5FX5A 2QAAA 2ZFTA 5TCAA 2ZFFH 1HUTH 1MFGA 1IQIA 1TMTH 1TNGA 4AN7A 1A61H 3SHCH 2FESH 3LJJA 4BAHB 1FIZA 5AFYH 2UUJB 2W7RA 2ZECA 4U30A 3ATWA 4B71A 2VSVA 3I4WA 4I32A 1C5RA 2ZHWH 1SGQE 2XCNA 2R2WU 2X7ZA 1ESAA 3LH1A 2VWNA 1QA0A 3WY8A 3DT0H 4ABIA 1OWDA 2Y6TA 3AAVA 4FU9A 2VWRA 2NU4E 1KXDA 4GAWA 4THNH 4MNYA 5BPEA 2XYAA 1P2OA 5LGOA 2HPPH 4HZHA 1UVPA 4JZ1A 1WQSA 1GHWH 1O32A 3CH8A 1F92A 1P2MA 2FN5A 1EZQA 1ZTLA 2A1DB 1GJ5H 4F49A 2FZZA 2OTVA 1NRRH 1B0EA 4GHQA 4A1TA 1V2LT 5EYZA 1GHAG 2SGDE 1HFDA 2Y80A 1VITH 4CRCA 3PMBB 1A46H 2FOEA 1PPZA 4O9VA 1VCWA 2BLQA 3SI4H 1ZTJA 5TCCA 5EG4A 3RXRA 2JKHA 1F0SA 1GBFA 1C4U2 1GHYH 4NSYA 1O5EH 2WL7A 1KSNA 2ZFPH 5DGJA 4X2WA 1P8VC 1GWAA 2O8WA 1L1NA 1O3LA 3BTTE 1DY8A 4GSOA 5CE1A 2L4SA 4TWWA 2ZU2A 4ABHA 1HAZB 5E21A 3DFJA 5HFFA 1A0HB 1HBTH 1PPFE 1ZLRA 3AXAA 2GZVA 1WAYB 4OEOA 4E34A 3F9HA 4TWYA 1H9LB 3QGLA 1YGCH 1MQ6A 2G8TA 3PO1C 2IWOA 4WVPE 2Z6BD 2VVVA 1QRWA 1GJ4H 2VWMA 1BBRE 1Y5UT 4TPIZ 1H9IE 3ATMA 2VIQA 2ZDNA 3A81A 1GI6A 1Z7KA 2XCFA 2O9QA 2KOHA 5K0HA 1P2QA 2QKUA 4K1SA 2OQ5A 4ISHH 4NNMA 3TJVA 4D9RA 1NROH 1LKBA 1IQKA 1O2XA 4BAKB 2WPKS 3JXTA 2BOHB 4JCNA 2FDAA 1W10U 2PKSB 2NU2E 2RCZA 2HNTE 3SU6A 1EAUA 1N6EA 4GHNA 1YBWA 2YNAA 2KJKA 3LIWA 4CRDA 4ZHAA 1UK2A 1Z8IB 1GG6C 1DOJA 1MTNB 3TSVA 3DHKH 2XBWA 1YPJH 3FANA 3EDXB 2CF9H 4Y76A 1AUJA 3RXSA 2ZPSA 1O34A 1MBMA 4A92A 4REYA 1EB1H 1J15A 4HOPB 2BY8X 2CF8H 1P01A 1AUTC 4RN6A 1GJCB 2CJIA 3URDA 4ABEA 3RLWH 1P11E 4ZXXH 1G3EA 4Q7YA 4ABFA 3MU4A 3A7VA 2Y7XA 2Q9VA 3LGTA 1O2IA 1SVPA 1C1WH 4Q2OA 4NMVA 2EEIA 1SLVB 1V3XA 1HLTH 3S69A 1C1NA 3M3VA 2D2DA 1LKAA 1UVSH 2UUKB 3LGUA 1O3DA 1X5RA 3TK5A 1N7FA 4JZIA 2OQSA 2GX4A 1SLUB 3RU4E 2EC9H 1TE0A 2QXJA 1X45A 2R2MB 4Z6AH 4L8NA 1IQFA 3PMJA 1K1NA 2DLUA 3BTEE 3A8CA 2HNTF 3HATH 1MKWH 4E35A 2VWOA 1TGTA 2EEJA 2R0LA 1BMNH 4MDSA 3ZZAA 3ENSB 2PWXA 3UOUA 3RLEA 1IQHA 2BZ6H 3FAOA 2BDYA 3SV8A 1DDJA 1Z8RA 2GCHG 1ZJDA 3S9AA 2A4RA 3W94A 3RXJA 4O3UA 2ZPRA 1LQEA 1Y3UA 2DE8A 1TRYA 1MTUA 3D65E 1FLEE 1OBXA 1EJNA 3VQGA 3DA9B 4ZUHA 1PJPA 3ATIA 4VGCB 1GHBG 5T6GA 1BTUA 3A8DA 3CENA 2VWLA 5E2OA 3L4FD 3MO6A 1DUEA 1O37A 3E3TA 4FUHA 4K1EA 3EE0B 3VB6A 2FOGA 1V5QA 1AVGH 3RDZA 3GY4A 4HOPA 1MKWK 4Q2KA 1PYTC 3TGJE 1BCUH 1CE5A 3GCNA 1MCVA 2ZC9H 2E7KA 3FVFB 1TBRH 2B7DH 5JBTA 3UIRA 4WH6A 1ETSH 1F5KU 1WG6A 2J38A 2KAWA 2BDGA 2BLWA 1FY3A 4X2XA 3P17H 3RXBA 3GYLB 2HVXA 3UFAA 5I7ZA 2C8YB 3E6PH 3P8GA 2AERH 1XMNB 2Y7ZA 1A5IA 1HAIH 1GCTC 2FI4E 1P12E 2KG2A 1DS2E 1GDUA 3L3TA 4JYUH 2Z3CA 1OBZA 1LO6A 1O35A 1OWKA 1P05A 1UK3A 4X1RU 3SO3A 3QO6A 4NA9H 3SNCA 1ANCA 1ZPBA 3GOVB 1J8AA 1T8OA 2AFQB 3SU4A 2FODA 4YYXA 3B76A 1O5DH 1RFNA 2BDHA 4FUGA 2Y82A 1Y8TA 1X5NA 2LNCA 1DVAH 2FTMA 5AF9H 1ZZZA 2WPHS 3F9EA 4LZ4B 1TNHA 1K1JA 3K82A 5JB8S 4E7RG 4DY7B 4YZUA 2Z17A 2PV9B 3E90B 4INLA 3GDUA 1VJAU 2F83A 2TIOA 3CBYA 3Q00A 1M9UA 3RXOA 3SJIA 2D26C 1E37B 5C5OA 4YOIA 2DKRA 4K60A 1AU8A 1C5XB
chains in the Genus database with same CATH superfamily
1SQRA 1GI5A 3JZ2B 1N6DA 4QT8C 3GCOA 1GJAB 2OLGA 5E0HA 3LJOA 2KV8A 3KNXA 4O97A 2IOTA 1EJAA 2EEGA 1C1PA 4TPYA 3SFJA 3MO3A 1HAXB 5FAHA 1CA8B 2IN2A 2KFWA 5C1YA 1MFLA 1L0ZA 4FUJA 2LUIA 1AO5A 1B0FA 2XBYA 4IC5A 2YUBA 4AMHA 1OP8A 4Y7AA 4NG9H 4Y71A 1OWEA 2KJPA 3A89A 2H9TH 5LH8A 2BB4A 2ZGJA 4BXSA 5HDYA 3ID1A 1DXPA 1ZRKA 1G2LA 1AE8H 2G2LA 3A80A 1NN6A 2EI8A 2VJ1A 2NWNA 4K69A 1YCPH 3UAIC 5A09A 3GY7A 4ZKOU 3MHWU 3SU2A 1AE5A 1ID5H 1DXWA 1D3QB 1V6DA 1YPHC 3UY9A 2CHAC 1FNIA 2A5IA 1EP6A 3RXPA 1E36B 2DAZA 2H2CA 1HJ8A 2HGAA 2ZHFH 3DSGA 4ZKRU 1YLCA 1HPGA 4XE4A 2HALA 3KQEA 4IMZA 1HIAB 2LP6A 4Q4LA 3TLOA 1ZPZA 1C5WB 5HGGA 3CBXA 1OX1A 1LVBA 5T6DA 2LC7A 1BRCE 3EYDA 1S83A 1OYTH 2PKAB 2W26A 3GCHC 3R69A 1ELDE 4YT7H 2XTTB 4XOJA 2PZDA 3KEEA 1T8NA 1ZHRA 1UM1A 1O3HA 5EIYA 3F3BA 1OBYA 1UFXA 3BEIB 1O2GH 1Y3VA 2V0BA 4B2BA 3PDZA 2AHME 1WXRA 1V2PT 4WMEA 2BQWB 5HF4A 3NCLA 2XBVA 2BDAA 2QF3A 3FZDA 1GVLA 1FC7A 1ELEE 1AI8H 3A7TA 2RA0A 4M9FA 1YPGH 3P95A 3RXQA 3HKJB 3QGJA 3IWMA 5A0BA 4KGAA 3ZVDA 2PLXA 2Q6GA 4J1YA 3DSOA 4LK4A 4DT4A 1Z8GA 1CT2E 2JOAA 1O3KA 4D9QA 1GHXH 3E1XB 3QGNB 2BQ7B 4CHAC 1F5RA 1KLJH 4RI0A 1A4WH 1SI5H 1PPBH 2G4UA 4D7FA 1NU9A 5DTHA 3FO8D 1WFGA 2J92A 1Q3OA 1Q31A 5JPMH 3SUGA 1LHEH 8KME2 1TB6H 1CQQA 2QXGA 5FCRA 3GDVA 5HMAA 3P8OA 9ESTA 2C8ZB 1I16A 1H8DH 3KQDA 1K1OA 1GJ9B 4WH8A 2ZTYA 3ZVGA 3TU7H 2ZG0H 1CSOE 1L1GA 3K9XB 2H9EH 2ZPLA 1BOQA 1YBOA 2QY0B 2VIDA 4NZQA 2HE2A 1DLEA 2OC1A 5DKMA 2BX4A 3CP7A 3GY8A 1ESBA 4WMDA 4JYTA 2I1NA 4Y0ZE 1Z1JA 3Q77A 3SGBE 1HIAA 1J17T 4H6TA 5E11A 3PO1B 4NSVA 4OGXA 5EQQA 4DCDA 1MKXH 4TY7A 4JOHA 2G4TA 1ARBA 1C5PA 5FPSA 1V2JT 3SGAE 2AMQA 3U98H 2K20A 1LPZB 1O5AB 3BTWE 6LPRA 2BY6X 3E17A 1SQAA 1TNJA 3L33A 2SNWA 4JOJA 2QG1A 2OC7A 1HAVB 1EOJA 2ANMH 2F43B 1C5YB 4KFVA 5HEDA 5DP9A 1RTFB 1V2TT 2ZDMA 1SHYA 2AWWA 4R0IA 2GZ8A 1WBGB 3AW0A 3M3TA 1KDQB 2VH0A 2ZGCA 5IYTA 4RKOB 2Z9IA 3MQKC 4HTCH 1ZJKA 1VAEA 1FY4A 2P93A 2GV6A 2PDZA 1GG6B 1LMWB 2CV3A 1ANDA 4U01A 4A1VA 4NMQA 2ASUB 3NFKA 4Q2NA 1UVTH 2EDVA 2XC5A 3FN8A 4OS5A 2YMSB 3ZZ6A 4LOYH 3ZZDA 1GMHF 5DG6A 4Q2QA 3TGIE 1GI9B 2G00A 5EZ0A 1F5LA 2OCVB 2Y81A 1O36A 2PUQH 3RMOH 4CREA 3NFLA 2ANWA 4X1QU 1MTWA 1P3EA 2CMYA 3FKSD 1AHTH 3QX5H 4F48B 1UJDA 2A4OA 4NIYA 5F8XA 1CGJE 3S7KB 5FL7D 1GBTA 1S6LA 2OCSA 2ZQ1A 3HGPA 1U37A 4I31A 1T2MA 3SU0A 1QQ4A 4WYUA 3TJNA 1OYQA 3SJ9A 1P06A 4NWKA 4K8BA 4DW2U 1WUNH 2WHXA 2QE7D 2GDEH 2BZAA 1MH0A 5A2PA 1B8QA 3RXMA 3VPKA 2DJTA 4NA7A 1WH1A 4NA8A 4G69A 4OS7A 1C2EA 1UCYE 1C2MA 2TPIZ 2Y5GA 2QXIA 2F3CE 1GI0A 1DITH 2QYIA 2FX6A 1WI2A 3KHFA 3ODDA 1H9HE 1TGCA 1SGYE 2J34A 2BYGA 3MO9A 4UU6A 1ZOMA 3Q3YA 3U8RH 2XC0A 1FX0B 4UFDH 5FCKA 2J2UA 2W5EA 2WV4A 4JYVH 2RFKC 2L97A 1RZXA 3ZZ4A 1MTSA 2WPMS 2H6MA 5GCHF 1UTMA 1G2MA 3BN9A 1T32A 4JZEH 1HAVA 1EATA 1NS3A 1GMCG 1GPZA 1L2EA 2BXTH 8GCHF 1GJ7B 2VNTA 3SZNA 2ZHDA 3AK5A 1KDQA 1CGIE 5ETXA 4IS5A 1XVOA 2YMSD 3RUOA 4ISIH 3UB0A 1X6DA 1FY8E 2SGEE 1PQ5A 4INHA 4UDWH 4UFFH 1RS0A 2F91A 1Y3XA 4GUXA 1DSTA 5GPIB 1G32B 4Z33A 3MI4A 1DT2A 1Q2WA 1DANH 2STAE 1VR1H 1QR3E 2ZGXH 5DK1A 4LZ1H 2A7HA 3FP8E 2BVXH 3RU4T 2D8IA 1GJBB 1FUJA 1FZZA 3ID3A 4X8VH 3TGKE 1AQ7A 1V2QT 1O2UA 1TNKA 1RD3B 2C90B 1YYY1 1C5OH 4X2VA 1P1DA 1ORFA 1YM0A 2ZA5A 3GGEA 1IQEA 4X6PA 2PW8H 4X8SH 4UONA 3ZVEA 3PV5A 4XBDA 2J95A 1GCTB 1QAVB 1N99A 5ESBA 2M0UA 3GISB 1JIRA 7KMEH 2OQUA 3H7TA 5CHAC 1LPGB 1E79D 1V2MT 2K1QA 1GMDG 5I25A 1Y7NA 2Y5FA 4HFPB 3SUDA 3SV2H 1SGDE 1BT7A 5K7RA 3ATLA 3A8BA 3RMMH 3SU3A 1HV7A 2EA3A 2BVSH 4I33A 5EXNA 3SUEA 4PQWA 1O30A 1KTTB 2EEHA 2HRVA 1WTGH 3BG8A 2TBSA 2FOBA 3TMHA 2OPGA 3KHVA 2BDBA 4A6LA 1V2ST 4ZAEA 1KXCA 2GKVE 1D3DB 3EGHC 2IPHA 3BV9B 2QGRA 2SGPE 5L30H 2GMTB 1NU7B 1O3BA 3Q76A 1QTFA 3S7HB 6GCHF 4Q7XA 1RGRA 1CBWC 3HPKA 3CNRA 4XBBA 2QF5A 1PYTD 1T8MA 1BMMH 4JMYA 1C2DA 3KDKA 1YWUA 5T3HA 1C1TA 4K3JA 4AGJA 3FOAA 4AFZA 3SNBA 1TP5A 4FGMA 4WYTA 1CGHA 2RA3A 1NY22 4MPXA 4BNRA 2R3YA 1V2VT 1ETRH 4DIHH 1O33A 1Z6EA 3RXKA 4IN2A 1D9IA 3PTBA 1V5LA 3MNXA 2EI6A 2ESTE 3I78A 2FTLE 2G55A 2VRFA 1S5SA 2DM8A 4E3BA 1EPTA 4K75A 4FUBA 1Z71A 3ZZ7A 1HNEE 1YKTA 3RC5A 1PFXC 2H3LA 2ZDLA 1FC6A 2Z9LA 2F4LA 1BBRH 3TVJB 1TBZH 1TMBH 1FPCH 2KRGA 2GTBA 1QAVA 1LVOA 1W13U 1UTOA 2JIZD 3TJOA 4R2ZA 2F9OA 1HGTH 2CHAB 4ABGA 5B6OA 2ZCHP 1P10A 1GJ6A 1AN1E 1GI3A 3SNDA 3SQHE 2VB0A 2KPLA 3H5CB 1BFEA 1THPB 1VCPA 2KJDA 2ANKH 1K28D 1I92A 1ZHPA 1FQ3A 1WIFA 1O2PA 1YPLH 2XXLA 3BTME 3KGPA 3A7XA 4INKA 4GVCA 4RKJB 3TNSA 3UQOA 1QA7A 2OGPA 2TGDA 6CHAC 1O2NA 2I4SA 2ZHQH 4I8JA 2H5CA 1A0LA 3B8JA 3DJ1A 1QL8A 4AYVB 4GPGA 4OS6A 5ESTE 2DUCA 5HFCA 1LQDB 2EAQA 2JETC 3RLYH 3GCHB 3MH4A 1CVWH 1TONA 4B75A 3K65B 1MMJN 4X6MA 1AVXA 1C4V2 1OWHA 3DJ3A 3S0NA 2I04A 1QURH 1BBRK 2RG3A 3TK9A 3PDVA 3IG6B 3M7QA 3ZVAA 3M5OA 3SQEE 4X1PU 4CRAA 2PHBA 3MTYA 3U28C 5HIYA 1DM4B 2HNTC 4XHVA 1HAHH 1F0RA 3T28A 2EGNA 2ZFQH 4X8TH 5C94A 1ELGA 1NTEA 4YLQH 1ELAA 1C5NH 2BD4A 4X0WU 1TRNA 1A7SA 4NIXA 5LPFA 2YNBA 3V3MA 1V2NT 2QKVA 2AIQA 5C67A 2P8OC 2FS8A 4CHAB 1DUAA 2B9LA 3W95A 2BMGB 4WWYA 2GZ7A 1HCGA 1TGSZ 1SB1H 4AC9A 1W0KD 1ZTKA 3SHUA 2GDDA 1OOKB 2CSJA 2V35A 4ISNA 3ZVFA 1JWTA 4IC6A 3A84A 1C5UA 1DLKB 1O2TA 4JOGA 1XUGA 2FX4A 3U69H 4GCHG 4FOUC 2QA9E 2KAIB 2Z9JA 3LC3A 1CU1A 5EXMA 1AY6H 3OX7U 2OINA 3RXAA 3VEQB 5GWZA 2PKUA 1C2JA 1DY9A 4EDJA 2C4FH 4E7NA 3ZRTA 4BAQB 3OU0A 1A3EH 3KYFA 5C1XA 1GI2A 5GLJA 3QE1A 2DC2A 1GBBA 1SFQB 1ELVA 1ACBE 5HEYA 3A86A 1LHGH 4Y7BA 2G5VA 1TLDA 3P8FA 3KDGA 1VGCC 4AZ2B 1OZIA 5JBCS 2J97A 1DE7H 5A8XA 1V1TA 3HK3B 4M7GA 5FHTA 1TALA 2KPKA 5HFDA 1NRQH 3UNSA 1CHOF 3ELAH 1E38B 1MU8B 4FUEA 3P8NA 3EGKH 5J4SA 1UJVA 1YCPM 2Z3EA 4NFFA 7GCHF 1ABIH 1EAWA 3U8TH 1TABE 2J9NA 3EA7A 3RL8A 3KL6A 2KCPA 3LOXA 3CC0A 1L4DA 1P2IA 3VG8A 3MU1A 5E2PA 3SW2B 2G5MB 1TQ0B 4CRFA 3ATKA 2JREA 3LGVA 1EQ9A 4AYYB 1UTPA 4NIWA 3SV6A 2ZKSA 3BPUA 4CH2B 1GMHG 2FI5E 3WKMA 1YLDA 3MWIU 1TGNA 4K76A 2ZGBH 3SI3H 3KQCA 5HFEA 1DICA 4BAMB 3KN2A 1ZMNA 3OSYA 2ALVA 2VSPA 1LVYA 3TSZA 1KYNA 1MBQA 1O2LA 2M0VA 1UTQA 2WUBA 1TOCB 4H11A 5G1EA 1OWJA 1A5GH 2WZQA 3M3SA 4NCYA 1C2HA 2FPZA 5C0UA 3GCTF 2JXOA 1W7GH 3QLPH 1ARCA 5DPAA 3BEFB 3BG4C 4O3TA 4X8UH 5ILBA 2KAIA 1O5BB 4TSFD 3O8CA 1NFXA 3RXGA 5DP8A 1BTXA 2F9NA 1P2NA 2M5TA 3LGIA 5EGMA 2FO9A 1GHZA 3F0PA 5F8ZA 2ZPQA 2XNDD 1SGCA 2KCOA 3E0NB 1GL0E 2NU0E 3SHWA 5GIBA 1TA6A 2IWPA 1IQMA 1E35B 2AMPA 2BDCA 2H2ZA 1XUJA 4RSPA 1FXYA 1BA8B 4KELA 5DO4H 1NFYA 1O2JA 1K1IA 1YP9A 1W11U 3UNQA 5HM9A 2HPQH 4KKDA 2Z9GA 4NMRA 2I6VA 1Z87A 2BX3A 1GBKA 3M37A 1SPJA 1U3BA 2VIOA 1AWFH 1GBDA 1GCDA 1NTPA 3AASA 3RXTA 2ZIQH 2I6SA 3R0FA 2GMTC 2F9UA 4Y8ZA 1EAXA 3R68A 2R0KA 3OTJE 2PKTA 3A7ZA 3GY3A 1J14A 1ELCA 3IITA 1N7EA 2HLDD 3RMLH 4NMSA 4Z8JA 1O0DH 1L6OA 1EB2A 2H3MA 2BYAX 3W1EA 1IOEA 1GQ5A 1NO9H 1G3DA 3SJ8A 3MMGA 1DX5M 3NGHA 1QQUA 3MNCA 4JK5A 4YO9A 1QIXB 2ODQA 1BTHH 1EUFA 1ZGIA 2QC2A 2WSSD 2BQ6B 2P3WA 1TMUH 1O2MA 2OBQA 3EAJA 1MUEB 3U8OH 3PLBA 1VJ6A 2W4FA 2K8IA 4K6YA 3RXEA 2EJYA 4NNLA 3PMAB 1N6FA 1SGFA 5KGOA 1K1PA 2PUXB 3BIUH 2GVFA 1SOZA 3EA8A 1KXBA 1OXGA 3MH5A 4UU5A 1NRNH 3PS4A 5H3JA 4TY6A 3TNTA 4D7GA 2D8WA 3JZ1B 1SLXB 1QLCA 4D8NA 1C5MD 1W0JD 1YPMH 5T6FA 4BAOB 5G1DA 2C8WB 1SKYE 2KCYA 3PROA 4MPWA 5AHGH 1TWXB 3LH3A 3M7UA 2VGCC 5CHAB 1S6HA 4OS1A 2A32A 1YC0A 1DPOA 4JOKA 2WPIS 1F2SE 1XUIA 5J4QA 1NESE 1RIWB 1T4UH 2VVCA 1FV9A 3BIVH 3LPRA 1C5VA 4NZLA 1GBEA 5DJ7A 5F6MA 7LPRA 1G36A 5I46H 2AGIX 1HAPH 2J94A 1G9OA 1OKXA 1V2RT 1ZMLA 3QJMA 3PB1E 4JOEA 1GI7B 2FIRH 5EU8A 2JWEA 2VPHA 3STJA 2RDEA 4Q7ZA 3SUZA 4KTUA 1M5ZA 1YCPK 2BHGA 1COWD 1FN8A 1AVWA 1QRXA 2EDPA 2EXGA 1O3FA 1CBWB 4IBLH 1ELBA 4JJ0A 4JOPA 1TX7A 1A5HA 4HGCA 5GDSH 2FYRA 1FY5A 3WKLA 3NPSA 3BEUA 5E0JA 3U1IB 1VA8A 2OD3B 1FN6A 3PWCA 1EZXC 2OC0A 5BRRE 4WY3A 3KYGA 1AD8H 3SOSA 1DSUA 2A7CA 4JZDH 5A8YA 3QK1A 1FAXA 3E8LA 3N99A 5D13A 5HETA 4Q3HA 1J9CH 1O2ZA 1HJAC 1W8BH 4KFWA 4ABAA 4LXBH 3O46A 1S0RA 1LHDH 3SHAH 1VZQH 2FI3E 4Y11E 1O39A 3ZZ9A 1EZSC 2KX4A 2Z9KA 3HPTB 3VFEA 2FOHA 4AB9A 4GHTA 1U6QA 2PNTA 1WCZA 5L2ZH 4MNXA 1KXAA 2W3IA 1SGIB 2O8TA 1WTHD 1Q3XA 4Z0KA 3ZVCA 3LU9B 3M5LA 3T5FH 1GBIA 4ZMAH 5GJ4B 1DFPA 2H5DA 4I8KA 5AFZH 1QY6A 5A0AE 3M35A 1WU1A 2ENOA 1OP0A 1AZ8A 5EXLA 1E1RD 1TNLA 2JDID 2DB5A 3MYWA 3MH6A 5JXBA 1EP5A 1QBOA 2PKAA 1UO6A 2QV1A 4UD9H 6CHAB 2FMJA 1C5SA 3DD2H 1QB9A 1MZDA 3M61U 2SGQE 2J98B 2AEIH 1OPHB 2F0AA 1Z1IA 2ZEBA 3P92A 2AWXA 1K2I1 3GY6A 2JETB 2L4TA 2H1UA 4OS2A 1EOLA 1QL7A 1O5CB 3ZVBA 1BTPA 5HJ1A 1RJXB 1BDAA 3KQBA 4RT0A 2TGPZ 3E16B 2ALPA 1OWIA 2ZDVH 1OHHD 3CS0A 4MNVA 4YDPA 4MNWA 2FOCA 1QCPA 1LHFH 3B9FH 5C1UA 1WI4A 2DLSA 3I77A 4JZFH 4YXWD 1Q3PA 4AX9H 4MTBA 1WJLA 1F0TA 3ITIA 4I7YH 3QZQA 1G3CA 1W0YH 1WHAA 5DN6D 3U1JB 3TSWA 1MKXK 7ESTE 4SGAE 1WHDA 1JBUH 3RXCA 3WW7A 1NFWA 2BLOA 1AB9C 1SG8B 1C1QA 3K6YA 1UCYH 3VB5A 1T31A 2P8OB 2ZGHA 4DURA 1EKBB 3VXFH 2FEQH 3LONA 1UHPA 1ZSLA 2ZWLH 1G9IE 4PROA 1OSSA 4YOJA 3RC6A 5EJZA 1WOFA 5F03A 1NRPH 4ISLA 2A5KA 1BTZA 2ZDKA 1IU2A 3R0HA 1TIOA 2ZHEH 1GHBF 1UEPA 3OYPA 2GGVB 1ZR0A 4UEHH 3N7DA 1TYNA 2IWNA 3SN8A 1ELFA 2BLVA 1FC9A 2UWOA 5F53A 2Y5HA 1ELTA 3VQFA 1H8HD 1TFXA 2XRCA 1O3PB 1CHOG 2CXVA 1SFIA 4UFGH 2M0ZA 1X5QA 2A4GA 1V2WT 3BF6H 1K21H 4JORA 4E06H 1VGCB 2HGTH 3MU5A 2J98A 1HAGE 3RXLA 1QNJA 3T2NA 3NZIA 3RXDA 1QFKH 2UWLA 1MD8A 2GCTC 3ZZBA 3U9AH 3NCVA 3T62A 2PA1A 4YTAA 3MU0A 4YT6H 3LKWA 5B6LA 1VJ9U 4B2AA 3M5NA 1C5ZB 1UEZA 2EDZA 1P9SA 4YOGA 4CR5A 1THRH 3QUMP 5F67A 2GV7A 1LVMA 3MNBA 3SUFA 2TGAA 1GQ4A 2M0TA 5FB8C 2A5AA 1MD7A 1UITA 4XDEA 2W3KA 4K8YA 2BD3A 2QXHA 3QJNA 3FP7E 5IDKA 4FUCA 2ULLA 2EQNA 3EE7A 1YF4A 1T4VH 2LC6A 2D1JA 1UHBB 8ESTE 2QKTA 1ZRBA 2FNEA 2Q1JA 1TOMH 5C3NA 3PLPA 4H42U 1O2KA 3F68H 1EX3A 2Q6FA 5JBAS 4KTCA 2ZU1A 5KEDA 1KWAA 1ZGVA 4E05H 1C5LH 1P04A 1QJ6B 4NFEA 3GABA 4AOQA 9LPRA 1C1VH 3NKKA 4B73A 3UWJH 2ODYB 1MABB 2WPJS 2YT7A 1U39A 1KXEA 1L4ZA 2GZ9A 3PV4A 5C20A 2QT5A 2BVRH 3BG4B 1UTLM 1FONA 3SBKA 1B7XB 2MX6A 3A82A 1O2HA 3AW1A 1G3BA 2AS9A 2ODPA 3ZZ3A 4NGAH 1O5GH 2JJ2D 3D49H 1G30B 2O8MA 5CDFE 1TBQH 4KP0A 4FU7A 2BY9X 2ZU4A 1CA0C 4ESTE 1KTSB 1UTNA 2I0LA 1O3GA 2FOFA 2FS9A 3BSQA 3ZZ8A 3A85A 1L1JA 1RIWC 1IQJA 4IN1A 1Z86A 1C1OA 1KXFA 3GDSA 1K9OE 1RTLA 2F9VA 1D3PB 1F7ZA 1Y5AT 4XRNA 2R4HA 1DWCH 4AFQA 1O38A 4K1TA 1IQLA 1N1LA 3O8DA 4DT7B 1O2WA 3I18A 1X8SA 2R9PA 2REYA 3T26A 1BMFD 1LTOA 2P95A 4DIIH 5EJ1A 5JBBS 2OZFA 1CHGA 1K1MA 2UUYA 1C1MA 4AG1A 1SC8U 1QJ7B 2J4IA 1O3AA 3LNYA 1TP3A 3O8BA 1BMLA 3SOEA 3I29A 1DWDH 2GJGA 3SYJA 3KZEA 4AFSA 5GXPA 1GBMA 5ABWA 4F8KA 1GI8B 1JOUB 3FFGA 1W0ZU 3EGGC 2WPLS 2H2BA 2V90A 3K50A 5L6NH 2AYWA 5EPYA 1UHBA 3RXVA 4KTSA 5HYOA 3BTFE 1OP2A 2A31A 3OY6U 2AINA 1QHRB 2M2AA 3TH2H 4ZROA 3O5NA 2VIWA 4AFUA 1O2RA 4FUIA 2MHOA 3F6UH 3ZV8A 1UK4A 3BTKE 1GBHA 1E0FD 2VBCA 4ZCNA 3M5MA 4CBNA 1PPHE 2P16A 1P1EA 1PQ7A 1G37A 2DE9A 3OEHD 3UWIA 1O3IA 1EFRD 4IMQA 2EV8A 4TT3D 4DJZB 1GVKB 5SGAE 2F9PA 1GDQA 2HLCA 3HGNA 1P9UA 3DFLA 2W6JD 2FCFA 2SFAA 2VGCB 1QGFA 3BTGE 4K72A 3UTUH 2B0FA 4JJ3A 1NC6A 2HVYB 5A0CA 1IQNA 4P0CA 2P94A 2VZ5A 1XXFA 1ETTH 2ZTXA 1H4WA 1QBNA 3ZV9A 2AMDA 2ZZUH 1ZHMA 2BD9A 5JYIA 3QIKA 1SGEE 1HB0B 2DMZA 1O5FH 3I1EA 2ZFSA 4ABJA 1XUHA 1RGWA 2ZQ2A 1AFQC 1AMHA 2FE5A 4WXVA 4Y79A 4ZKSU 2QN5T 1KLIH 2P59A 3HK6B 1K0HA 1QJ1B 3BTHE 1N7TA 3F2HA 1A3BH 3BTDE 2VU8E 2EGKA 1AKSB 3FP6E 4K2YA 3RC4A 1JRSA 1ZOKA 1INCA 1UMAH 2F5YA 1IHJA 1WDIA 1NFUA 2C93B 1O2QA 3ZZ5A 1MAYA 1BRBE 1SGPE 3HKIB 2UUFB 5DP5A 3K2UA 3A7WA 3E0PB 1N6YA 1O2OA 5A8ZA 2PFEA 1YPEH 3PMHB 2D90A 5EW1H 1HXEH 4ZHMU 2FOAA 2P3UB 5HEBA 5HXFA 1UEWA 4R8TB 2I0IA 1HJAB 4MPVA 3SU1A 3M36A 1K1LA 4YLUA 1HAYB 3VXEH 1UVUH 2FOMB 1KIGH 2UWPA 2LOBA 2AIPA 1GDNA 3KZDA 2V3HH 1VITF 4NXQA 1VCQA 3G01A 1ZSKA 1GL1A 4Y8YA 2VIPA 5LPEA 2AWUA 4B74A 1Y3WA 1UF1A 3DORA 2ZU3A 2RRMA 2G81E 4ZKNU 3D23A 1D6WA 2B8OH 2OBOA 4FVDA 5HM2A 4ASHA 1WF8A 1BJVA 3A87A 1NPMA 1QZ8A 3OY5U 1W3CA 1TPSA 2KOMA 4TYDA 3GSLA 1LPKB 5FPYA 1P0SH 3ZIAD 2XWAA 3UUZA 1MQ5A 4IGDA 3SV9A 4BXWA 2QIQA 3K1RA 1NBMD 2CGAA 2YOLA 4ZH8A 4NMTA 4A7IB 1R6JA 1TPOA 1ZSJA 2BD5A 2BD8A 2JJ1D 2XOKD 1DWEH 1IHSH 1BZXE 2BXUH 1GGDC 2STBE 3UQVA 3PTNA 1FPHH 5FBEA 3OTPA 2G51A 5EPNA 4D76A 4DOQA 2O2TA 2A4QA 4JK6A 5E8EH 2BDIA 3AVZA 1AZZA 1T7CA 3PM3A 4GVDA 4WMFA 5DP6A 3MFJA 4CR9A 3F9GA 3A88A 1N6XA 1AKSA 3GYMA 1HYLA 3SU5A 1AFEH 1NF3C 1SSXA 2Z7FE 1PDRA 4ABDA 5L2YH 1PQ8A 2KR7A 4NXRA 1A1RA 3HPMA 3F1SB 2RDLA 2XWBI 1W12U 2OP9A 1XX9A 1V2UT 1TQ7B 2BD7A 5AVDA 3CS7A 1V62A 4ABBA 1AGJA 1V2OT 2P3FH 1BHXB 1THSH 2WYGA 5DP4A 1AB9B 1Y59T 1GMCF 1EAIA 3UR6A 1ZPCA 2LELA 3GICB 2WPDD 1AIXH 4RT1A 1C2KA 1VKYA 1BUIA 1C4Y2 3CYYA 2W6ID 1XKAC 4X6NA 1ZMJA 2H9HA 2ZP0H 1Y5BT 2TGTA 4HI3A 2LPRA 2W7UA 3TH4H 4BTTB 2ILNA 2OC8A 4Y10E 5PTPA 3ID2A 3RM0H 2JH5D 2WUCA 2AGGX 2IWQA 1EPTC 2WV9A 2Z94A 2FP7B 4N6XA 2Q3GA 2QCYA 4B76A 3DUXH 3V0XA 1N8OC 3EQ0H 3LGYA 1GBCA 3N7OA 1UJUA 3DJAA 2FYQA 3TH3H 1C5QA 2NU3E 5GCHG 4B2CA 1W7XH 1SLWB 1WQVH 2WV5A 4JL7A 1GJ8B 1C2IA 4FXGH 1P3CA 8GCHG 3URCA 3RXFA 4MQAA 3QDZB 2V6NA 3AAUA 1HJ9A 3PLKA 4OM9A 3FY5A 3VGCC 1UJ1A 3BTQE 2BD2A 2OXSA 3SNEA 1FCFA 2GCTB 1MC7A 1PPCE 2SGAA 2KYLA 4A5TS 2JIKA 2RCEA 2YT8A 3HVQC 1FJSA 3S9CA 1ESTA 1SGFG 1KMHB 1S84A 1GMDF 1TAWA 1EASA 2ZF0H 3ID4A 2FLBH 1TPPA 1C2LA 2M10A 4AG2A 4NMOA 2CS5A 1MAXA 1UEQA 2GT7A 1QAUA 3NWUA 5EQSA 3OFND 1W14U 1P09A 4BOHA 2XW9A 1OS8A 3T25A 4X1NU 1NT1A 2C8XB 1ANBA 2R3UA 3H09A 4GVUA 4SGBE 1MU6B 2BY7X 1FIWA 4B6FA 4NIVA 2QF4A 2ZNKH 4Y8XA 3TPIZ 5H4IB 3RMNH 1TA2A 4AORA 1O3JA 3F9FA 2ZI2H 4MG3A 2HE4A 3UNRA 2ZTZA 3T27A 4OS4A 3V12A 1H1BA 3SJOA 1Z8JB 2JSNA 1LDTT 1SGRE 4X2YA 4F55A 1WV7H 4XBCA 3VB7A 1MCTA 5EODA 2G5NA 4UFEH 3K6ZA 2SNVA 2O8LA 4H4FA 2GEFA 4NXPA 2JH6D 5DP3A 1GHAF 4Q63A 5F3XA 1O3MA 1Y3YA 3SJKA 1YPHE 3C1KA 1W9OA 1CA0B 3B23B 3UOPA 5DP7A 4MPAA 2VH6A 4FUFA 1TRMA 1HDTH 4FVBA 2A45B 1C1RA 2WINI 5FBIA 2CK3D 4U2WA 4WJG2 1UVOA 2FLRH 3DIWA 6GCHG 4X6OA 4FLNA 2EI7A 1K32A 1BRAA 1SGTA 2EHRA 4OAJA 3TIUA 3L6PA 1SGNE 2OUAA 2I6QA 1CO7E 3PRBA 1XKBC 2C3SA 2PSYA 2AGEX 2KOJA 2PR3A 3V7TA 4B6EA 3SV7A 1YLNA 3D62A 5G4BA 1C2FA 5EW2H 1UTJA 1NM6A 1W9QA 1O3OA 2D92A 1NBME 1O2YA 1WF7A 1FMGA 4Q2PA 4YESB 2V7QD 5TJXA 2Q6DA 5LPRA 2PKSC 1W9EA 3NK8A 3SGQE 1H8ED 1ANEA 1EJMA 2ZCKP 1GJDB 1ZYOA 3NUMA 1MTNC 6ESTA 1LCYA 1S81A 4K5ZA 2EEKA 1DWBH 1JRTA 4O03A 3VB4A 4Y0YE 1BMAA 1S6FA 2OK5A 1C2GA 3GY2A 1S0QA 4ISOA 5A2MH 1SL3A 1SOTA 2JINA 3RXUA 1PPGE 2IJOB 2PTNA 3KF2A 1P02A 4ZXYH 2LA8A 2KCAA 2P3TB 3GJ9A 2KA9A 1TX8A 1P2KA 4WF8A 1J16A 4X1SU 1FY1A 3NXPA 3QWCH 1V6BA 4CRBA 4I8GA 5EQRA 3PWBA 2PTCE 2XC4A 2PGBB 3TITA 3V13A 1QRZA 4ASUD 1NZQH 1BITA 4OEPA 3A7YA 3NRLA 1SBWA 4ZHLU 2M3MA 4FETA 3T29A 2QBWA 2YTWA 1QBVH 3MNSA 4WXIA 3QZRA 4FUDA 3A83A 5C5NA 4GCHF 1V2KT 2V3OH 4JOFA 1JIMA 4F4OC 8LPRA 1S82A 2JH0D 2IPQX 2XBXA 1O3EA 5IK2D 2NU1E 3QTOH 2ANYA 3STIA 3QN7A 1AFQB 1SQOA 3MOCA 1C9TA 1LHCH 4MPUA 3O8RA 1BJUA 1MTVA 1IQGA 1TPAE 4Q6SA 3CBZA 4OGYA 5FPTA 4CRGA 4CBOA 5JB9S 2G52A 1XZ9A 1TX6A 1GBAA 3ZYDA 2OSGA 1XM1A 4K78A 4I8HA 1PPEE 1BIOA 5JDUB 4J2YB 3VB3A 1TNIA 2FWWA 2GD4B 4UE7H 3UR9A 1D3TB 2AH4X 4LMMA 2GP9B 4BTUB 1JMOH 1C1SA 2GCHF 1VB7A 4VGCC 2J5UA 1FI8A 3R3GB 5FXLA 3PYHA 1IHTH 1GM1A 1VITG 3QDOA 2V3MA 2EGOA 1HXFH 5FX6A 1MZAA 2L74A 4I8LA 1XXDA 1C1UH 2Z3DA 1QL9A 2PSXA 1EXFA 4IW4E 5CHBA 1TGBA 2A2XH 2F9BH 1AWHB 1HAOH 5EOKA 2CSSA 3ZZCA 4Y6DA 3LGWA 2ZU5A 5HF1A 1P2JA 1CT0E 1FDPA 1P57B 2HWLB 1C5TA 5HFBA 1CT4E 1RY4A 1O3NA 1WSSH 1YPKH 2ZCLP 3N7EA 3QTVH 1FAKH 3UPEA 1HRTH 3Q3KA 7GCHG 1A0JA 4Q6HA 4I86A 1UCYK 1UM7A 1XUFA 2B5TB 4DG4A 1TQ3A 2BM2A 4P2AB 1Q7XA 5E22A 1O31A 4O06A 1O2SA 5E1YA 1O2VA 1F0UA 1O3CA 1BTWA 5F8TA 2QF0A 1BTYA 4H6SB 1GGDB 5GNDA 1E34B 4A1XA 1SMFE 1QB6A 5T1VA 1KEFA 3A8AA 3MU8A 3ZYEA 1GI4A 2K0QA 2O8UA 2OS6A 4XSKU 2A0QB 3TK6A 3LT3A 3RXIA 1D4PB 3Q3XA 1ZUBA 1A2CH 3OEED 4AGKA 1NRSH 4NMPA 4CH8B 1U38A 1BHXF 2BTCE 2BY5X 1H8IH 1T8LA 1ABJH 1BE9A 1KLTA 1GI1A 3M7TA 2KQFA 3GCTG 1PQAA 3KIDU 4DVAU 1GHVH 2ZO3H 1WYKA 1UW7A 3SORA 1WFVA 3PV2A 5C2ZA 3LC5A 3RXHA 3LDXH 2THFB 2JILA 3GY5A 1C9PA 5E6PB 3RL7A 2PGQB 2K1ZA 1RGQA 5E0GA 1X7AC 2WYJA 3H7OA 1S85A 1Z6JH 3RU4D 1RXPA 3RP2A 3E91A 4B1TA 2OMJA 3EA9A 2CN0H 2XNIA 4Q80A 1UTKA 4BTIB 5C0TA 1EZUC 4MLFB 1SR5C 1GBJA 2HOBA 4DGJA 4P02A 2W7SA 3ESTA 1W2KH 5HKKD 1GBLA 1D5GA 2ZFRH 3RM2H 3P70B 1EPTB 4FU8A 1B5GH 2V1WA 1BQYA 1XUKA 3LNXA 3FZZA 1SQTA 1N8OB 5CMXH 1RTKA 1SHHB 2A2QH 2KBSA 3TJUA 2FM2A 2VVUA 2UZCA 1D6RA 4MVNA 4BANB 3S9BA 4NWLA 3ODFA 2KL1A 1BRUP 1JXPA 3MH7A 1BB0B 2VINA 2VIVA 5HIZA 1IAUA 3C27B 1GVZA 3KCGH 2SGFE 2ZPMA 2BOKA 4GLYA 1RRKA 2GT8A 1P03A 1KY9A 3VGCB 4AB8A 2FXRA 2A7JA 4XFQA 2TRMA 2ZDAH 2YUYA 1XVMA 3P6ZB 3SNAA 1QB1A 4U32A 1K22H 1IU0A 3UREA 4YM9A 5FX5A 2QAAA 2ZFTA 5TCAA 2ZFFH 1HUTH 1MFGA 1IQIA 1TMTH 1TNGA 4AN7A 1A61H 3SHCH 2FESH 3LJJA 4BAHB 1FIZA 5AFYH 2UUJB 2W7RA 2ZECA 4U30A 3ATWA 4B71A 2VSVA 3I4WA 4I32A 1C5RA 2ZHWH 1SGQE 2XCNA 2R2WU 2X7ZA 4ACAA 1ESAA 3LH1A 2VWNA 1QA0A 3WY8A 3DT0H 4ABIA 1OWDA 2Y6TA 3AAVA 4FU9A 2VWRA 2NU4E 1KXDA 4GAWA 5KECA 4THNH 4MNYA 5BPEA 2XYAA 1P2OA 5LGOA 2HPPH 4HZHA 1UVPA 4JZ1A 1WQSA 1GHWH 1O32A 3CH8A 1F92A 1P2MA 2FN5A 1EZQA 1ZTLA 2A1DB 1GJ5H 4F49A 2FZZA 2OTVA 1NRRH 5EJLA 3PRDA 1B0EA 4GHQA 4A1TA 1V2LT 5EYZA 1GHAG 2SGDE 1HFDA 2Y80A 1VITH 4ACBA 4CRCA 3PMBB 1A46H 2PP6A 2FOEA 1PPZA 4O9VA 1VCWA 2BLQA 3SI4H 1ZTJA 5TCCA 5EG4A 3RXRA 2JKHA 1F0SA 1GBFA 1C4U2 1GHYH 3DCLA 4NSYA 1O5EH 2KM0A 2WL7A 1KSNA 2ZFPH 5DGJA 4X2WA 1P8VC 1GWAA 2O8WA 1L1NA 1O3LA 3BTTE 1DY8A 4GSOA 5CE1A 2L4SA 4TWWA 2ZU2A 4ABHA 1HAZB 5E21A 3DFJA 5HFFA 1A0HB 1HBTH 1PPFE 1ZLRA 3AXAA 2GZVA 1WAYB 1E1QD 4OEOA 4E34A 3F9HA 4TWYA 1H9LB 3QGLA 1YGCH 1MQ6A 2G8TA 3PO1C 2IWOA 4WVPE 2Z6BD 2VVVA 1QRWA 1GJ4H 2VWMA 1BBRE 1Y5UT 4TPIZ 1H9IE 3ATMA 2VIQA 2ZDNA 3A81A 1GI6A 1Z7KA 2XCFA 2O9QA 2KOHA 5K0HA 1P2QA 2QKUA 4K1SA 2OQ5A 4ISHH 5B42A 4NNMA 3TJVA 4D9RA 1NROH 2IJD1 1LKBA 1IQKA 1O2XA 4BAKB 3F2GA 2WPKS 3JXTA 2BOHB 4JCNA 2FDAA 1W10U 2PKSB 2NU2E 2RCZA 2HNTE 1X9ZA 3SU6A 1EAUA 1N6EA 4GHNA 1YBWA 2YNAA 5C17A 2KJKA 3LIWA 4CRDA 4ZHAA 1UK2A 1Z8IB 1GG6C 4P00A 1DOJA 3DSPA 1MTNB 3TSVA 3DHKH 3WWFA 2XBWA 1YPJH 3FANA 3EDXB 2CF9H 2YMSC 4Y76A 1AUJA 3RXSA 2ZPSA 4XD7D 1O34A 1MBMA 4A92A 3OAAD 4REYA 1EB1H 1J15A 4HOPB 2BY8X 2CF8H 3F0OA 1P01A 1AUTC 4RN6A 1GJCB 2CJIA 3URDA 4ABEA 3RLWH 1P11E 4ZXXH 1G3EA 3SZEA 4Q7YA 4ABFA 3MU4A 3A7VA 2Y7XA 2Q9VA 3LGTA 1O2IA 1SVPA 1C1WH 4Q2OA 4NMVA 4HG6A 2EEIA 1SLVB 1V3XA 1HLTH 3S69A 1C1NA 3M3VA 3OE7D 2D2DA 1LKAA 1UVSH 2UUKB 3LGUA 1O3DA 1X5RA 3TK5A 1N7FA 4JZIA 2OQSA 2GX4A 1SLUB 3RU4E 3GS9A 2EC9H 5DSFA 1TE0A 2QXJA 1X45A 2R2MB 4Z6AH 4L8NA 1IQFA 3PMJA 3KQ5A 1K1NA 2DLUA 3BTEE 3A8CA 2HNTF 3HATH 1MKWH 4E35A 2VWOA 1TGTA 2EEJA 2EY4C 2R0LA 1BMNH 4MDSA 2KZ4A 3ZZAA 3ENSB 2PWXA 3UOUA 3RLEA 1IQHA 2BZ6H 3FAOA 2BDYA 3SV8A 1DDJA 1Z8RA 2GCHG 1ZJDA 3S9AA 2A4RA 3W94A 3RXJA 4O3UA 2ZPRA 1LQEA 1Y3UA 2DE8A 1TRYA 1MTUA 3D65E 1FLEE 1OBXA 1EJNA 3VQGA 3DA9B 4ZUHA 2L6OA 1PJPA 3ATIA 4VGCB 1GHBG 5T6GA 1BTUA 3A8DA 3CENA 4Z1MD 2VWLA 5E2OA 3L4FD 1YY3A 3MO6A 1DUEA 1O37A 3E3TA 4FUHA 4K1EA 3EE0B 3VB6A 2FOGA 1V5QA 1AVGH 3RDZA 3GY4A 4HOPA 1MKWK 4Q2KA 1PYTC 3TGJE 1BCUH 1CE5A 3GCNA 1MCVA 2ZC9H 2E7KA 3FVFB 1TBRH 2B7DH 5JBTA 3UIRA 4WH6A 1ETSH 1F5KU 1WG6A 2J38A 2KAWA 2BDGA 2BLWA 1FY3A 4X2XA 3P17H 3WWBA 3RXBA 3GYLB 2HVXA 3UFAA 5I7ZA 2C8YB 3E6PH 3P8GA 2AERH 1XMNB 2Y7ZA 1A5IA 1HAIH 1GCTC 2FI4E 1P12E 2KG2A 1DS2E 1GDUA 3L3TA 4JYUH 2Z3CA 1OBZA 1LO6A 1O35A 1OWKA 1P05A 1UK3A 4X1RU 3SO3A 3QO6A 4NA9H 3SNCA 1ANCA 1ZPBA 3F2FA 3GOVB 1J8AA 1T8OA 2AFQB 3SU4A 5IL9A 2FODA 4YYXA 3B76A 1O5DH 1RFNA 2BDHA 4FUGA 2Y82A 1Y8TA 1X5NA 2LNCA 1DVAH 2FTMA 5AF9H 1ZZZA 2WPHS 3F9EA 4LZ4B 1TNHA 1K1JA 3K82A 5JB8S 4E7RG 4DY7B 4YZUA 2Z17A 2PV9B 3E90B 4INLA 3GDUA 1VJAU 2F83A 2TIOA 3CBYA 3Q00A 1M9UA 3RXOA 3SJIA 2D26C 1E37B 5C5OA 4YOIA 2DKRA 4K60A 1AU8A 1C5XB
chains in the Genus database with same CATH topology
1GI5A 3JZ2B 1N6DA 4QT8C 3GCOA 1GJAB 2OLGA 5E0HA 3LJOA 2KV8A 3KNXA 4O97A 2IOTA 1EJAA 2EEGA 1C1PA 4TPYA 3SFJA 3MO3A 1HAXB 5FAHA 1CA8B 2IN2A 5C1YA 1MFLA 1L0ZA 4FUJA 2LUIA 1AO5A 1B0FA 2XBYA 4IC5A 2YUBA 4AMHA 1OP8A 4Y7AA 4NG9H 4Y71A 1OWEA 2KJPA 3A89A 2H9TH 5LH8A 2BB4A 2ZGJA 4BXSA 5HDYA 3ID1A 1DXPA 1ZRKA 1G2LA 1AE8H 2G2LA 3A80A 1NN6A 2EI8A 2VJ1A 2NWNA 4K69A 1YCPH 5A09A 3GY7A 4ZKOU 3MHWU 3SU2A 1AE5A 1ID5H 1DXWA 1D3QB 1V6DA 1YPHC 3UY9A 2CHAC 1FNIA 2A5IA 1EP6A 3RXPA 1E36B 2DAZA 2H2CA 1HJ8A 2HGAA 2ZHFH 4ZKRU 1YLCA 1HPGA 4XE4A 2HALA 3KQEA 4IMZA 1HIAB 3TLOA 1ZPZA 1C5WB 5HGGA 3CBXA 1OX1A 1LVBA 5T6DA 2LC7A 1BRCE 3EYDA 1S83A 1OYTH 2PKAB 2W26A 3GCHC 3R69A 1ELDE 4YT7H 2XTTB 4XOJA 2PZDA 3KEEA 1T8NA 1ZHRA 1UM1A 1O3HA 1OBYA 1UFXA 3BEIB 1O2GH 1Y3VA 2V0BA 4B2BA 3PDZA 1V2PT 4WMEA 2BQWB 5HF4A 3NCLA 2XBVA 2BDAA 2QF3A 3FZDA 1GVLA 1FC7A 1ELEE 1AI8H 3A7TA 2RA0A 3RXQA 1YPGH 3P95A 3HKJB 3QGJA 3IWMA 5A0BA 4KGAA 3ZVDA 2PLXA 2Q6GA 4J1YA 4LK4A 1Z8GA 1CT2E 2JOAA 1O3KA 4D9QA 1GHXH 3E1XB 3QGNB 2BQ7B 4CHAC 1F5RA 1KLJH 4RI0A 1A4WH 1SI5H 1PPBH 2G4UA 4D7FA 1NU9A 5DTHA 1WFGA 2J92A 1Q3OA 1Q31A 5JPMH 3SUGA 1LHEH 8KME2 1TB6H 1CQQA 2QXGA 5FCRA 3GDVA 5HMAA 3P8OA 9ESTA 2C8ZB 1I16A 1H8DH 3KQDA 1K1OA 1GJ9B 4WH8A 2ZTYA 3ZVGA 3TU7H 2ZG0H 1CSOE 1L1GA 3K9XB 2H9EH 2ZPLA 1BOQA 1YBOA 2QY0B 2VIDA 4NZQA 2HE2A 1DLEA 2OC1A 5DKMA 2BX4A 3CP7A 3GY8A 1ESBA 4WMDA 4JYTA 2I1NA 4Y0ZE 1Z1JA 3Q77A 3SGBE 1HIAA 1J17T 4H6TA 5E11A 3PO1B 4NSVA 4OGXA 5EQQA 4DCDA 1MKXH 4TY7A 4JOHA 2G4TA 1ARBA 1C5PA 5FPSA 1V2JT 3SGAE 2AMQA 3U98H 2K20A 1LPZB 1O5AB 3BTWE 6LPRA 2BY6X 3E17A 1SQAA 1TNJA 3L33A 2SNWA 4JOJA 2QG1A 2OC7A 1HAVB 1EOJA 2ANMH 1C5YB 4KFVA 5HEDA 5DP9A 1RTFB 1V2TT 2ZDMA 1SHYA 2AWWA 4R0IA 2GZ8A 1WBGB 3AW0A 3M3TA 1KDQB 2VH0A 2ZGCA 5IYTA 4RKOB 2Z9IA 4HTCH 1ZJKA 1VAEA 1FY4A 2P93A 2GV6A 2PDZA 1GG6B 1LMWB 2CV3A 1ANDA 4U01A 4A1VA 4NMQA 2ASUB 3NFKA 4Q2NA 1UVTH 2EDVA 2XC5A 4OS5A 3ZZ6A 4LOYH 3ZZDA 1GMHF 5DG6A 4Q2QA 3TGIE 1GI9B 2G00A 5EZ0A 1F5LA 2OCVB 2Y81A 1O36A 2PUQH 3RMOH 4CREA 3NFLA 2ANWA 4X1QU 1MTWA 1P3EA 2CMYA 1AHTH 3QX5H 1UJDA 2A4OA 4NIYA 5F8XA 1CGJE