2R3YA

Crystal structure of the degs protease in complex with the ywf activating peptide
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
311
structure length
280
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDGRVIRGYIGIGGIVVNEVSPDGPAANAGIQVNDLIISVDNKPATMDQVAEIRPGSVIPVVVLQVTIQEYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Regulation of the sigmaE stress response by DegS: how the PDZ domain keeps the protease inactive in the resting state and allows integration of different OMP-derived stress signals upon folding stress.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase activator
total genus 52
structure length 280
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2r3yA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3yA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3yA02
2ZTYA 1WBGB 1UK4A 4HZHA 1X7AC 3RU4D 1UTJA 5FB8C 1V5QA 1D3QB 3A85A 5C1XA 5ABWA 1QY6A 2XC4A 1FY1A 4D7GA 3RC4A 3Q00A 5E2OA 1V3XA 2ODQA 2A7JA 1GBIA 5BRRE 1C1WH 1ZOMA 1T4VH 2DAZA 3PS4A 1B7XB 2QKVA 4KKDA 1BTYA 1OS8A 5AFYH 1XVMA 3ZYEA 1DDJA 1WI2A 2QCYA 1CQQA 3LOXA 3T5FH 2ZFTA 1O2JA 4ZKNU 2UUJB 1AIXH 2PHBA 2Y5FA 1WTGH 2FOMB 1OYTH 2Y80A 1PJPA 2O8UA 5A2PA 1C1VH 4Q2PA 1ANCA 1O3JA 4DJZB 4Z33A 6GCHF 1SGFA 3B23B 3ZVDA 2QIQA 1HBTH 1ZPCA 4JZEH 2EJYA 4BAKB 1GBEA 2VWRA 2DM8A 1J16A 4FUGA 5GXPA 4DG4A 1P1EA 2X7ZA 5GCHF 2PKSC 5DKMA 4LZ1H 1J15A 2ZHWH 5HFDA 4TYDA 1N6XA 4WXVA 3MH5A 1OBZA 3RMLH 3UFAA 1ETRH 3I77A 1O3NA 2SGQE 3TJUA 2C8ZB 1LQDB 1QJ6B 1LHCH 1ETTH 3GCHB 2BM2A 4UDWH 1PYTC 1Q3XA 1G3DA 1BMNH 2OC8A 3RXJA 1UITA 5HF4A 1BHXF 2BDGA 2ZGJA 3C27B 1PPBH 3LGWA 2CJIA 2GKVE 2FOAA 1MAXA 1N7TA 3ZZDA 1TE0A 2M3MA 1UJ1A 3A7YA 4FUHA 4GUXA 3ZVBA 1GJ5H 1OWDA 3PDVA 5FBEA 1DWBH 1O37A 2ZDVH 3SNBA 1C1TA 3P95A 3RXGA 4ABBA 3D49H 4CHAC 2GZ7A 7GCHF 1C5VA 4DIHH 2I4SA 3ZZCA 4Q2QA 5PTPA 2K1ZA 8GCHF 5A0AE 3HGPA 3S0NA 3ZZ7A 1QL7A 4AORA 2BLOA 3GICB 3RU4T 2IWPA 1GL0E 2GGVB 2H2ZA 1UCYH 1IQIA 1TMBH 3MYWA 1A0JA 1YPJH 1IQLA 1GI8B 4DVAU 1CT0E 1O3CA 5DTHA 8LPRA 5K0HA 2I6SA 3IG6B 4BTTB 3A86A 1XUIA 4MPWA 1ACBE 4NZLA 2GCTB 2Q6DA 1P2QA 1W7XH 2EXGA 1A1RA 1NRQH 1G3EA 1GGDC 2VJ1A 4WY3A 3O46A 4UU6A 3WKLA 5DK1A 4KP0A 1IQMA 5D13A 1UCYK 1EJNA 4A5TS 2B8OH 1D6WA 1ZMJA 4YZUA 3CC0A 6ESTA 1P2JA 3CS7A 3DFLA 4TWWA 4ABHA 1BOQA 1P2NA 2J95A 2OUAA 2FOHA 1ID5H 1C2MA 1O2XA 1QBNA 3GGEA 4XSKU 3RXAA 3L33A 2ZCKP 4LXBH 4JOKA 1GMDF 1H9IE 1XUHA 1DXPA 3HPMA 5H4IB 3VFEA 3C1KA 4ISLA 1GVLA 1UEPA 2I04A 3LJOA 2BD8A 3O8DA 3ZZBA 1BE9A 1UTLM 1QQ4A 3BV9B 2C8WB 3TK5A 1B0FA 3RM0H 1O2UA 5HXFA 4K75A 1THSH 3STJA 1O30A 3NXPA 2TPIZ 2QKTA 2LNCA 2BY7X 2EGKA 4K1EA 2ZU1A 2L4SA 4B71A 3V13A 1DWEH 1BBRH 1Y3YA 3RXKA 1EZSC 2NWNA 5L2YH 4IMQA 2VNTA 1JIRA 2ODYB 1NF3C 3S7KB 3F6UH 2ZPQA 1K2I1 1MU6B 1QB1A 1ZGVA 1PQ7A 1RRKA 5FAHA 1EOLA 1AZ8A 2WV5A 4VGCB 2YTWA 2WUCA 1YF4A 2ZPSA 3UR9A 4NFEA 1OPHB 4Y10E 1K1MA 3LT3A 5F03A 3MWIU 1BBRK 1C9PA 3AW1A 1UTMA 3GDVA 1GCTC 2AIPA 2TIOA 3GYLB 1GHWH 1H8DH 3L4FD 1ELVA 2ILNA 1YCPH 1FY5A 3KF2A 4WH6A 5F8TA 2QN5T 4AGJA 1Z6JH 3ID4A 3SU1A 1C5OH 3K1RA 1FN8A 3SJ8A 2EV8A 4YOIA 1MH0A 3RXFA 2PNTA 2JIKA 4QT8C 2I6VA 4CRDA 2BLQA 2WV4A 2JH6D 5JB8S 1FY3A 1XM1A 3SW2B 1Z86A 4GCHF 2BOHB 1SC8U 2OP9A 2SGDE 1WF8A 1BRAA 1ELDE 3UIRA 1Y5AT 1YCPK 4KFVA 3BTDE 2ODPA 3K2UA 5DJ7A 5E0GA 2FOFA 4WMDA 4U30A 2TRMA 1MCVA 1GHYH 2DB5A 4K1TA 2PR3A 2DE8A 3A8AA 2FWWA 1TQ3A 1P03A 3S69A 2C90B 5F6MA 4Q7XA 1BUIA 1C1OA 1O2SA 1SPJA 1SQAA 4IS5A 2BDYA 2WPMS 1GHAG 5E0HA 1AI8H 2OQSA 1BCUH 3D62A 3EYDA 3MI4A 3T62A 1THPB 1SGFG 4I33A 1XKAC 5EXMA 1T2MA 4NNMA 1IQFA 3TJOA 2FDAA 4FUJA 2BZAA 5FX6A 1AUTC 1D6RA 1T31A 2QXHA 1QAVA 2PKSB 1YM0A 1DANH 2TGDA 5EU8A 1KTTB 3Q77A 1S83A 1VITH 2ZGHA 2WPHS 4N6XA 3NFKA 3MTYA 4BAQB 2HALA 4FU8A 1GJCB 3VB4A 1QJ7B 1TQ0B 4AFZA 1C4V2 1Z7KA 5TJXA 3SZNA 3LC5A 3NWUA 4GHQA 1FNIA 2H3MA 3SGAE 5K7RA 1F7ZA 1TWXB 1TONA 2ALPA 4X1RU 4NXRA 1O2LA 3M7TA 1HXEH 1E0FD 2HOBA 1HAOH 1IQJA 3JZ2B 4Y79A 3GCNA 4O3TA 1F0RA 5BPEA 1QRXA 5A2MH 2J9NA 1AU8A 1DFPA 1HCGA 1VB7A 1GBAA 4Q80A 2SNVA 1G2MA 3BG4B 1HAIH 3VB6A 1GMHG 1NESE 3RXEA 1P0SH 3R0HA 4YLQH 1DITH 3RL7A 5F3XA 1WU1A 2QY0B 1ZTLA 4OAJA 1GI4A 1GJ4H 1MUEB 4Y8XA 4CREA 2PW8H 4I32A 1UM7A 2DLUA 1F0TA 4JMYA 1OXGA 1GJAB 1LVYA 1W9OA 1WHDA 4MDSA 4BTUB 2ANWA 3A8BA 1G30B 1MBQA 4RI0A 1NY22 4XFQA 4Y7AA 5JBBS 3I18A 1FZZA 4GHTA 1BJVA 5EPYA 4KTUA 3SN8A 4Y8YA 1ZOKA 2R3UA 4ABEA 3TGJE 3UNSA 1CBWB 1P2KA 1C1SA 4ABGA 1NFYA 5FCKA 2VVVA 3OY5U 2OGPA 1QA7A 4ABDA 1BJUA 2ZQ2A 2B9LA 2BQ6B 3M5MA 4X6PA 6LPRA 1JOUB 1MTWA 3MNBA 3UQVA 1IQGA 1T8NA 1DICA 1SI5H 3KL6A 5HFBA 3MHWU 3RLEA 4X6OA 1U38A 1AB9C 1DM4B 1Z1JA 2XBVA 3VB7A 1O5AB 2HNTC 5EZ0A 1G32B 3F9EA 3DHKH 4BAMB 2G8TA 1T32A 3ZZ5A 3R3GB 3TJNA 2GVFA 2QA9E 2BDIA 1FCFA 1AGJA 1X5NA 4M7GA 3FP8E 4E35A 3ZV8A 1HAVA 1OWIA 1RS0A 1H9HE 2I6QA 3QTVH 2ASUB 1CT2E 1O3EA 3BEFB 4WYUA 4JL7A 1O3AA 1SLUB 3HVQC 1ELTA 3H7OA 1NFUA 3VPKA 2R0LA 2SNWA 3LH3A 2H9TH 1P2OA 2ZEBA 2QXJA 1J14A 4X2YA 5T6DA 4FUDA 5C1UA 3GSLA 1V2JT 1C2JA 3GYMA 1ZJKA 2D8WA 3K6ZA 3ZZAA 1D3DB 4Z8JA 1O2YA 3R68A 1LHEH 1SLWB 1V62A 4NA7A 1V2QT 5GJ4B 1H8IH 1SG8B 1O36A 2F83A 3LONA 3T25A 1GHBG 1O3FA 2QF0A 4DCDA 3TIUA 5F67A 3L6PA 3CBZA 2UUKB 3L3TA 4OEOA 1V2KT 1GDNA 1K1OA 3EGHC 2CF9H 3VGCC 4WMFA 2GMTC 1P04A 2V1WA 1GI7B 3E8LA 1C1QA 4JOJA 1HJ9A 1QBVH 1Z1IA 1TLDA 3RXRA 1C5MD 4Q3HA 5E1YA 5I7ZA 1OYQA 1O2OA 2XWAA 1W12U 4MNYA 2G52A 4XBCA 3SNCA 3S9CA 1HB0B 1O2PA 1UO6A 1VZQH 5GWZA 2VWOA 3BTEE 3KQCA 2R3YA 1QAUA 4HTCH 1O3HA 5HF1A 5HJ1A 4H42U 2P16A 4NA8A 3EA9A 1NC6A 3ATIA 3U1JB 3KN2A 3A82A 2ZFFH 3KGPA 1G9IE 3QGJA 2O2TA 1QAVB 2A45B 1W2KH 3LIWA 3PLKA 2RA0A 1WIFA 4P2AB 1WHAA 2XBYA 3Q3KA 3A8CA 3E6PH 2BDCA 2CSSA 4J1YA 5JPMH 1PDRA 3GDSA 1P10A 1ARCA 2EEJA 1EPTA 5HFCA 3T2NA 1EPTC 2DJTA 1W3CA 2YNBA 4IGDA 4G69A 2ZP0H 1FC6A 2P93A 2K1QA 1KXFA 3S9AA 2YT8A 2Q9VA 1LVMA 3RXUA 1AFQC 1M9UA 2HPPH 1B8QA 1JBUH 2FI5E 3SHWA 4R8TB 3SV2H 4YM9A 1FC7A 2BX3A 2J38A 2ZCLP 2FLRH 1WCZA 3BTFE 4X0WU 1TPSA 4YLUA 3V3MA 5JXBA 1IQNA 5E0JA 1L0ZA 1EZQA 3LU9B 1ZR0A 3M5LA 1TYNA 1DE7H 2CN0H 1SMFE 1AVWA 1AN1E 2RA3A 1C2HA 3A8DA 3GY8A 3TLOA 1D3TB 3CP7A 3SO3A 1C1MA 2YUBA 1O2IA 3MNXA 3CENA 4A1XA 2A32A 4LK4A 1L1JA 1SGCA 3GOVB 1O3PB 1U3BA 3PWBA 1WF7A 1SOTA 5C67A 2ZDNA 4IMZA 4Y6DA 4KFWA 1BMMH 1QFKH 2ZF0H 1KLJH 4AMHA 1O2WA 1TBZH 2OLGA 1F2SE 4X1PU 1BZXE 6CHAC 2ZFRH 1BTXA 4Y11E 3DJ3A 3VB3A 5EQRA 3QIKA 1C2KA 2FYQA 2I1NA 1EAUA 3OY6U 1UTKA 3HPKA 5EYZA 3CYYA 2OBOA 5LPFA 2JETC 4IN2A 3I78A 1EATA 4B73A 3U69H 1ZSKA 2QC2A 3RXMA 2Z17A 4UE7H 1N99A 5HEBA 1EJMA 2A2XH 4ZXXH 1TX7A 3M7UA 5DP8A 3STIA 3V7TA 1KSNA 4WF8A 2QV1A 2AMQA 2FNEA 1DT2A 1RGQA 3A87A 1ZZZA 4ZHAA 1NU7B 3SQEE 1N6EA 2ZU4A 1P05A 2KOMA 4MNVA 1TGTA 3DJ1A 1HAVB 1YPKH 2AGEX 1YC0A 4X2WA 2BY8X 2PWXA 1V6BA 4NIYA 3UPEA 1O3BA 1HAPH 1X5RA 1L6OA 1BT7A 1I92A 4NSVA 1H9LB 1O3KA 1LHDH 5LPEA 2TGPZ 4ZROA 1O5BB 1AE8H 3RXBA 4GVUA 3VQGA 3ENSB 1TA2A 2V3HH 2CSJA 3QWCH 5C3NA 3MH7A 1YPHE 2PA1A 2C4FH 1KXEA 1KLIH 3B8JA 2PDZA 1HNEE 5C20A 2Y7XA 3AAVA 4Y76A 3HK3B 1OOKB 4O03A 1K9OE 1HUTH 1GHZA 1GI3A 5GDSH 3PROA 1Z8GA 3NGHA 4MVNA 4SGBE 2VWMA 2FN5A 4INHA 2KG2A 3DFJA 1V2RT 2VIPA 5LH8A 2EEGA 3EE0B 4NIXA 4Y71A 3ZVEA 1AE5A 3VGCB 1R6JA 1GPZA 1GI0A 1MQ5A 3QJMA 1OP8A 3LKWA 1WQVH 1RJXB 1DWDH 1JMOH 4XBBA 4OGYA 1LPZB 4GSOA 5TCAA 1MU8B 2ESTE 3SORA 4D76A 1YP9A 3EGKH 1BMLA 4ABFA 1NRNH 3URDA 3P70B 3SU5A 4ZH8A 3ID1A 4X1NU 3ELAH 4NWKA 2ZNKH 3EDXB 3FP6E 1SBWA 3VEQB 1TX6A 3TSVA 3E0NB 5T3HA 2AERH 1AD8H 3ODFA 5JB9S 3VQFA 2XC0A 3FVFB 2OCSA 3MU0A 3LC3A 2E7KA 2XBWA 4K76A 1O3OA 3I4WA 1ELCA 1T4UH 1O5CB 1HV7A 4ABIA 2EGNA 2OMJA 2BLVA 3O5NA 2D2DA 5HDYA 1EZUC 1O2GH 1TNIA 4AB9A 3M7QA 3P6ZB 2P3UB 1GG6C 1GHVH 1EPTB 1GBCA 1ABJH 1QNJA 2G51A 1SGQE 1BFEA 1YLDA 1P57B 1PQAA 2CXVA 2LPRA 1AFQB 1Q31A 1GI6A 1E37B 4I8JA 3SV6A 1V2VT 1OP0A 1S0QA 2EHRA 5E11A 2H2CA 1GMHF 3PO1B 1ORFA 2V35A 1VGCC 2FE5A 1VCWA 1YLCA 2BLWA 2BOKA 2V0BA 2FTMA 3PV4A 2H5CA 5EXNA 1VJ6A 2AYWA 3RXQA 4X6NA 3F9GA 1C5WB 2EI8A 4XOJA 1WUNH 2M5TA 1K1LA 1ZHPA 3MU8A 1L1NA 3LGIA 4B1TA 5SGAE 3FY5A 1CVWH 2M0VA 1W9QA 1IQEA 3UWJH 4JYVH 3AXAA 1PPGE 2NU4E 3JZ1B 1MTUA 2AIQA 1WAYB 1ZMNA 3VB5A 5DP9A 2QYIA 2FOBA 3PLPA 2ZHFH 1N8OC 2GCHG 5DO4H 1O5EH 2OC1A 2DLSA 5LGOA 1GBKA 1V6DA 3TH4H 5HFEA 1UK2A 1C5YB 1UVOA 1V2OT 3QUMP 1NRPH 1GJDB 4NA9H 2F91A 1F5RA 1VJ9U 1O3DA 2ZHEH 4R0IA 4K5ZA 4FXGH 1SSXA 1SR5C 2W5EA 2QG1A 5AFZH 1OBXA 2A5KA 3U8RH 3QE1A 3BPUA 3PV5A 3SV7A 2VH6A 1ZRKA 2UZCA 1TGNA 2XCFA 1OWJA 2VVCA 3SHAH 1VR1H 1ETSH 3Q3YA 1B5GH 3ID3A 2AGGX 1C5LH 3A88A 4CH2B 2PUQH 1O2KA 2G55A 2O8MA 2NU3E 4NMOA 1CU1A 2ZHDA 1S82A 1YGCH 1AMHA 2CHAC 1OBYA 5EGMA 2KAWA 5A8YA 3PM3A 1EJAA 1TNHA 1FXYA 2WPJS 3S9BA 4YOJA 1NO9H 3JXTA 2PTCE 4NCYA 2ZDAH 3BG8A 2Y81A 3AW0A 3Q76A 2QBWA 1A5HA 1TNKA 2REYA 4NXPA 1X45A 4NXQA 1KLTA 1Y3WA 3BEUA 3ITIA 2Z3EA 2GZ8A 4XDEA 1IQKA 2DUCA 3RMNH 2G5MB 1CHOG 2SGPE 1YCPM 1A3BH 1XXDA 3U9AH 1QGFA 3QO6A 1KXDA 2FOGA 5FHTA 3IWMA 1GHBF 2F9UA 2Y5GA 1MD7A 4IN1A 1FLEE 2GZVA 2EC9H 3MNCA 3D65E 5EW1H 2JXOA 4K2YA 1W13U 3SU0A 1NRRH 1SL3A 2BD4A 3HPTB 3U8OH 1A46H 1WQSA 1ANDA 1O3GA 1P2IA 1ZPZA 4XHVA 4R2ZA 2BY5X 3P8NA 2TBSA 2VPHA 3CBYA 1DLKB 1DPOA 1DSUA 1W0ZU 1QRWA 1SGDE 3RUOA 5DG6A 3LGYA 3K82A 1MQ6A 2KJDA 1NFWA 3TU7H 5GPIB 1GI2A 1KY9A 4REYA 3BN9A 1LCYA 1DWCH 1E36B 3QX5H 1UK3A 1OSSA 1BDAA 1Z8IB 1ESAA 3DD2H 2EDPA 2AMDA 3M5OA 4YT7H 2ZHQH 1UTPA 3M37A 2XNIA 3GY6A 1AY6H 1N6FA 3AAUA 1GVZA 4ZUHA 4BAHB 3SBKA 3K9XB 1Z8JB 4K6YA 1O31A 1Y3UA 2C8YB 3AASA 2M10A 1HJ8A 2B5TB 3UTUH 3RXLA 4B76A 2ZPMA 3SOEA 2A4QA 3OSYA 2IWOA 3ZVAA 1HFDA 4B2AA 5DP6A 4Z6AH 1MKXH 1YBOA 3RXDA 3ZVCA 4IBLH 1K1PA 3SNAA 5A8XA 3ZZ6A 4AFQA 4CRGA 1W10U 1PYTD 2D92A 1GI5A 3T26A 4JZFH 1GG6B 2ZA5A 1O2MA 2OSGA 1MAYA 1VCQA 4AOQA 1QL8A 3TPIZ 2SGEE 5L2ZH 2FCFA 2OS6A 3IITA 3H5CB 2QF3A 5FPSA 1JRSA 1V2PT 2XRCA 5HM9A 1KIGH 1MKXK 1G3BA 3BTGE 4JOFA 1GBJA 1TB6H 1TP5A 2ANMH 1L4DA 3EA7A 3PTBA 4NZQA 1FJSA 4MQAA 2JH0D 4CHAB 3LGTA 2Q3GA 1V2ST 3UREA 1LPGB 1UJVA 4CBNA 4E34A 1CO7E 2XTTB 4INLA 3FP7E 1TP3A 2J94A 1E34B 1BTUA 1TNLA 1FPCH 3OTPA 2BQ7B 2BDBA 1EAWA 1G9OA 2F0AA 1C4Y2 3W95A 1Q3OA 1XVOA 3EGGC 1Q2WA 2ZG0H 2JILA 2YOLA 1SOZA 1AHTH 4NIWA 1D9IA 2J4IA 1CA8B 2B7DH 3B9FH 1FIZA 4YYXA 3SJOA 1CGIE 1SQTA 2FESH 1KYNA 2P8OC 2W7SA 5C5OA 1P11E 1C5NH 1GGDB 3O8CA 2VVUA 1P2MA 2I0LA 1T8LA 3FZZA 2Z9GA 3ZZ3A 1QJ1B 1EB1H 2CF8H 1GL1A 3KHFA 4E7NA 5E6PB 2A4OA 3A81A 2WYGA 3SV8A 2P94A 1Y3XA 1A3EH 1UHBA 4XBDA 2KBSA 3UWIA 2O8TA 1PQ8A 8GCHG 2HE2A 3ZV9A 1V2LT 1OP2A 1HJAC 4AX9H 2J34A 1UM1A 1CSOE 1GDUA 1YPLH 1SGRE 2AGIX 2AWUA 3K6YA 2BB4A 2ZI2H 2D8IA 2OINA 4AFSA 4JK5A 2OCVB 3TNTA 3BIUH 4BTIB 2YT7A 4ZKRU 1RGRA 3ATWA 2PLXA 5L6NH 4X8VH 1HLTH 4TPIZ 1FQ3A 2ZCHP 1SFIA 7ESTE 1KWAA 1O2TA 2M0ZA 3MOCA 4O3UA 1O3MA 1LVOA 1QCPA 4FUFA 2GDEH 1O39A 1ZRBA 3SQHE 1MBMA 2KV8A 1KXAA 2KOJA 5DPAA 2OXSA 3SJIA 3TGKE 4X2XA 4OS5A 1TAWA 1FC9A 2VRFA 1DS2E 3QTOH 1XXFA 3RC6A 4PQWA 5HEDA 3I1EA 1CGHA 4JZIA 4ISNA 4X1QU 1MTNC 1S6HA 1PPEE 1QTFA 3DA9B 4Y0YE 5GNDA 1C1UH 3TSWA 3OX7U 4BOHA 3SU2A 2A1DB 1UF1A 8KME2 4HI3A 2ZWLH 3GY3A 3PMBB 3SHUA 1GCTB 1WYKA 2NU1E 4NMQA 1A4WH 2AEIH 4Y7BA 2VIVA 1TALA 2WPIS 1Z71A 1C2LA 4X8TH 1M5ZA 4ZHLU 2KQFA 2ZU5A 1KXBA 1BITA 2BYAX 3PTNA 1O35A 1CE5A 2G4UA 3SI3H 1ZYOA 2V90A 2IOTA 3WY8A 2OTVA 1UEWA 2Y5HA 3PMJA 1N7EA 2EEKA 2FPZA 4WH8A 1DOJA 1HYLA 2P95A 2PKUA 4NIVA 1NN6A 5A0BA 1ZPBA 3HKJB 1NPMA 4THNH 1XKBC 2C93B 2FIRH 3A7VA 4DOQA 4K3JA 4Q6HA 2IN2A 3SU4A 2FLBH 1LHFH 2AWWA 3LH1A 3NK8A 3OYPA 1EZXC 3KQEA 2PKTA 3DUXH 1UVTH 1IHTH 4NMPA 2W7RA 1TQ7B 2BD3A 3SJ9A 4DURA 1FMGA 1HAXB 1VJAU 3FANA 2M0TA 3LPRA 3URCA 4ZXYH 1FN6A 4D7FA 3I29A 3RM2H 1GJ7B 1GBDA 1C5RA 4U01A 2VU8E 3PMAB 1CHGA 2BD2A 1GBHA 1AQ7A 1AKSA 1LMWB 1MFLA 1Y3VA 2BD9A 1K28D 1FIWA 2ULLA 4D9QA 4O9VA 1HIAA 1GHXH 1VA8A 4AFUA 1F5LA 1OWKA 4CR5A 3R69A 4YESB 2HPQH 2OZFA 3PV2A 2HGTH 4DGJA 5HGGA 1S0RA 1AVXA 1SGIB 2P59A 1O2HA 1SGTA 5J4QA 5A09A 5B6LA 4F49A 3MNSA 2PKAA 4ISOA 4PROA 4LZ4B 4I8LA 3CH8A 3KNXA 3SOSA 1D3PB 5F8ZA 4K8YA 3TK6A 3MH4A 2GP9B 3TITA 1N6DA 3MO6A 4K60A 2EEIA 4NMRA 1EOJA 3GCHC 1Y8TA 2GTBA 2TGAA 5HYOA 1SGPE 1TFXA 3BTHE 2W3IA 2EDVA 5TCCA 1MCTA 3LNXA 1BQYA 4P0CA 4Q2KA 3UQOA 4TWYA 4I7YH 2H1UA 2A0QB 4GHNA 1K21H 1O2QA 1QURH 1TGCA 4AG2A 9LPRA 1RFNA 4NG9H 4TY6A 4I31A 4MNWA 1EKBB 1ELGA 1BIOA 5ESBA 3ATMA 5EODA 1YPGH 1V2UT 1TPAE 2GCHF 2UUYA 2Z9LA 3UNRA 1J17T 4INKA 1RY4A 1GCDA 1P3CA 4ABAA 1ELBA 4K78A 1I16A 1RIWC 1XUKA 3A89A 3H7TA 2BHGA 4EDJA 1P1DA 3TSZA 2BTCE 4WVPE 4GVCA 2V3OH 1PQ5A 3GCOA 2FMJA 4XE4A 1GI1A 2H6MA 2A5AA 4NNLA 1BTPA 2ZGCA 4Q2NA 2ZGBH 3A7WA 1AWHB 1UHBB 1X6DA 2GCTC 1EXFA 4FUIA 2FS8A 2UWLA 2V6NA 1MC7A 1H1BA 4JK6A 3TJVA 1GBTA 1P06A 4JOPA 3RXSA 4FVDA 4H11A 5JYIA 1EP5A 4CR9A 2A7CA 3P92A 5GLJA 3SU3A 5CE1A 2A7HA 3SUGA 1A5GH 1AB9B 3E16B 2XYAA 1YPHC 2P3TB 1HPGA 4CRFA 1GBLA 4X1SU 3BTQE 1E35B 1UTQA 5IYTA 5DP4A 5E2PA 1DXWA 5FX5A 2BZ6H 2GD4B 2IJOB 5FXLA 1TNGA 4F4OC 1GBFA 1CHOF 1VAEA 3QGNB 3UY9A 2ZDKA 2ZGXH 2KRGA 3SUEA 2WYJA 4ASHA 2NU0E 4I8GA 3RL8A 1XZ9A 2LUIA 2PGBB 1ESTA 2B0FA 1U37A 1ZMLA 3ZZ8A 4AYYB 2ALVA 3MU5A 1K1JA 3ID2A 1LDTT 4AG1A 4E3BA 4FU9A 1C5XB 2JWEA 2QXGA 1XMNB 1FY4A 4D8NA 3Q3XA 4JOEA 2DMZA 4A92A 4HGCA 1DUEA 4JYUH 3F9FA 1O2RA 1RZXA 2F5YA 1EAXA 1KTSB 2A5IA 1O0DH 2JREA 2VZ5A 3BTKE 5JBCS 5HMAA 4WXIA 3SV9A 1TMUH 1ABIH 4B2BA 2HVXA 7LPRA 3TK9A 2A4RA 3M3TA 4DW2U 4GAWA 1BRUP 1SLVB 2SGAA 2AWXA 1PPHE 2UWPA 2ZPLA 1YBWA 1QQUA 1MKWH 3MFJA 2GMTB 1PFXC 4E05H 4BAOB 1C5ZB 1O2ZA 1F0UA 1GHAF 3BF6H 3M3SA 2A31A 3DJAA 5EXLA 1SGEE 1UVSH 3LJJA 1QIXB 2OBQA 3NPSA 1UFXA 1Y59T 5DP5A 3LGUA 2W4FA 2DE9A 1U6QA 1WFVA 1MKWK 1QR3E 1NT1A 1P01A 1ZLRA 2FO9A 4HFPB 5CHAC 1HGTH 3RLYH 1MZDA 4UD9H 1X8SA 1AKSB 1J9CH 1ZSJA 4ZKOU 3NZIA 1NRSH 1X5QA 2XC5A 3LNYA 5H3JA 2GV6A 3RLWH 1HIAB 1JXPA 1NU9A 2KAIB 1WFGA 1ZGIA 2H9HA 1BTZA 3N7OA 2F9NA 2GDDA 2ZU2A 1O2NA 3ZVGA 3M35A 5I46H 2G5NA 1LPKB 3A7TA 3RXOA 2VIWA 1IU0A 2MX6A 3M5NA 5G1DA 5FBIA 1ZHRA 2JKHA 2ZKSA 2ZTZA 4FU7A 2KL1A 5T6GA 2PKAB 1HAHH 5FPYA 2P3WA 3RXVA 1EB2A 1UEZA 3RXPA 3TH2H 2QT5A 2FZZA 5G4BA 2HLCA 2ZFSA 2EA3A 1GI9B 4MPUA 5FPTA 1F0SA 4UONA 2FEQH 1JWTA 2AMPA 1T7CA 2FTLE 2H9EH 1ZTKA 4LOYH 3K65B 1BA8B 1W14U 2EI6A 3KHVA 2WUBA 3HGNA 1QB9A 3PB1E 2WL7A 1E38B 3BSQA 1UJDA 1SLXB 1AFEH 2BDAA 1SHYA 1TBQH 3UUZA 1GBBA 1IAUA 2BQWB 1AUJA 3TH3H 1O32A 5HM2A 1FI8A 1EAIA 2QKUA 1GMCG 2BDHA 1RIWB 2PSYA 2FI4E 4OEPA 3QK1A 5E8EH 4B2CA 5JBTA 3BG4C 3EAJA 3LGVA 3SJKA 3MMGA 3BTME 1YKTA 1YYY1 2Z9KA 3NUMA 4WMEA 3ESTA 4JORA 2PTNA 5F8XA 6CHAB 1C2FA 5EQSA 2VINA 1C2EA 2EEHA 5E22A 3PDZA 1ELFA 1K22H 1AZZA 4MG3A 2VWNA 2PGQB 2BD7A 3LDXH 2JETB 1DY8A 2VIDA 1AO5A 1GBMA 1O34A 1CBWC 3OU0A 1ANEA 3QLPH 4YOGA 1GWAA 1Q7XA 2WINI 4JZ1A 1FY8E 3K50A 5LPRA 1NM6A 3SU6A 1Y5BT 2BXTH 3RXCA 1MFGA 1JIMA 3E91A 1XX9A 3FAOA 1TRYA 4AGKA 1INCA 3B76A 2PUXB 4Y8ZA 1AVGH 1UTNA 1UTOA 4F8KA 2GX4A 1GJ8B 1N1LA 4UFGH 5E21A 1A2CH 1TGBA 3EA8A 1RTKA 3ZRTA 1H4WA 1THRH 1CGJE 2LC7A 3GY2A 2ZPRA 4E7RG 4GVDA 2O9QA 4HOPA 4UEHH 3ZZ4A 1UMAH 2ZDMA 2QAAA 1U39A 1W0YH 2F9PA 5CMXH 4GLYA 4RKJB 1RD3B 1L1GA 1P9UA 2VGCC 1C9TA 8ESTE 2BD5A 1O5GH 1VITG 4X2VA 3GCTG 1WI4A 4GPGA 4JZDH 5C1YA 4K1SA 4FUBA 5I25A 1HRTH 4JOHA 3SNDA 5HFFA 3ATKA 1Z8RA 3P8FA 2ZO3H 4A6LA 2HWLB 5B6OA 1FONA 4BNRA 4MTBA 3DORA 2FP7B 1GJ9B 2OPGA 4AB8A 2R4HA 3KIDU 1MMJN 3HKIB 2KOHA 5L30H 2QXIA 1MTVA 1Y5UT 3QZRA 3SFJA 3RXIA 1NROH 4LMMA 1KDQA 1S5SA 2THFB 2WPKS 1L4ZA 3T27A 1AWFH 3GY7A 4TPYA 3UOPA 2LOBA 4IC6A 3R0FA 2UUFB 1K1IA 4AYVB 2VSPA 2AFQB 4SGAE 3KZEA 3T29A 3TGIE 4DIIH 1RXPA 3P8OA 2I0IA 3SHCH 3PWCA 3DIWA 2VIOA 4FVBA 1O3IA 2KYLA 3KEEA 4I8HA 5CHAB 4B74A 2H3LA 4O97A 1C2IA 3A84A 2Q6FA 2HGAA 2KPKA 1IOEA 4FUCA 3O8BA 2FOCA 4Q7YA 3O8RA 2Z94A 1A61H 1FAXA 4UFEH 1WV7H 2LC6A 4MPXA 1SHHB 1QHRB 2AH4X 2J92A 4WYTA 4MPVA 2F9OA 3RXTA 3NCLA 2ENOA 4OGXA 1L2EA 1SFQB 3SNEA 1SGNE 1LVBA 1O3LA 2FYRA 2PFEA 2OQ5A 2BVRH 5T6FA 2O8WA 2OC7A 2G4TA 3HK6B 2R9PA 4ABJA 1SQOA 5HEYA 4UU5A 1TNJA 2EDZA 1XUJA 3KQDA 2LA8A 6GCHG 2STAE 2ZFQH 2ZIQH 5ETXA 3SUDA 1ZUBA 2FM2A 1T8MA 4U2WA 1V2TT 1A0HB 1KEFA 1DVAH 2BYGA 1N7FA 3U1IB 2DC2A 2RDLA 4YO9A 4H4FA 1VGCB 2CV3A 3F1SB 1CA0C 3E90B 5GCHG 3ZZ9A 2F3CE 2D26C 3E0PB 4NGAH 1WG6A 2KJPA 1O2VA 3SI4H 2H2BA 5A0CA 1D4PB 2Z3DA 2R2WU 1BHXB 1C5QA 2M0UA 3UR6A 2G81E 3PMHB 4KTCA 4CRBA 2XWBI 4OS1A 1MD8A 3MO9A 5EPNA 1LKAA 1O33A 3HATH 4I8KA 5AHGH 1WOFA 1NTPA 4MLFB 3U98H 1OZIA 2Z3CA 1LKBA 1JRTA 4U32A 4OS6A 3ODDA 1V2MT 2H5DA 1BMAA 5EQQA 1B0EA 5EOKA 2D1JA 1DLEA 7GCHG 3GJ9A 1S84A 2UWOA 2PZDA 2JINA 5C5NA 1WJLA 1QA0A 1N8OB 2Z9JA 5JBAS 4BXSA 4KGAA 2PV9B 2ZU3A 1NFXA 1YPMH 1EP6A 1PPFE 1WSSH 3D23A 3U8TH 3MU1A 4TY7A 2BVSH 1TPOA 3QGLA 3BTTE 4ISHH 5GIBA 4ZKSU 2DKRA 4KELA 1IQHA 2HNTF 2BY9X 1P09A 1S85A 1TBRH 4BXWA 1SB1H 1GDQA 1GJ6A 2RCZA 1RTFB 4B75A 3VXEH 2XCNA 1DUAA 3RXHA 4CBOA 2Z6BD 2GZ9A 2HRVA 1GM1A 1PPCE 2KJKA 2ANKH 1UJUA 2VSVA 2CHAB 2RCEA 2IWQA 1N6YA 2ZC9H 4ISIH 1ELAA 1OWEA 2XW9A 2ZFPH 3CS0A 1DX5M 4DT7B 2G5VA 2TGTA 2ZDLA 1QL9A 1C1RA 4JYTA 1F92A 2L97A 1GMDG 1EASA 4AN7A 2BMGB 5G1EA 2OQUA 1K1NA 1UEQA 1CT4E 2YUYA 2WPLS 1P8VC 4BANB 2R0KA 4HOPB 3BTWE 1QRZA 4FGMA 2Y7ZA 1GVKB 4Q7ZA 3GISB 1UHPA 1NZQH 2JH5D 1TPPA 4J2YB 1OX1A 2IWNA 1C5PA 1V2NT 4JCNA 3V12A 3NFLA 1P02A 4O06A 4K69A 3MO3A 2VGCB 3QZQA 1LTOA 5JDUB 2BY6X 1A5IA 2BVXH 2GT7A 3ZVFA 1BTWA 3P8GA 2F9BH 1MTSA 2ZTXA 3RMMH 1TABE 2MHOA 1SVPA 4NMTA 4ZAEA 2C8XB 4RSPA 1BB0B 1BRCE 3QJNA 1TOMH 2IPHA 2HNTE 1GQ4A 1FV9A 1A0LA 3E1XB 1ESBA 3M61U 3PLBA 5HETA 2G00A 1XUGA 3E17A 3ZYDA 4WWYA 1SGYE 4YTAA 1G36A 4K72A 1OWHA 5DGJA 3QDZB 3VXFH 2CS5A 1KDQB 3TMHA 4NSYA 4NMVA 4A1TA 4YDPA 2CGAA 1W8BH 2Y82A 2G2LA 3RMOH 2JOAA 7KMEH 1FUJA 1TRNA 2EI7A 1UVUH 1FDPA 1BRBE 1HXFH 2OD3B 2VH0A 1C1NA 3FFGA 2EAQA 5EW2H 1ELEE 3F68H 2Q6GA 4GCHG 5DP7A 1ARBA 3F9HA 1PPZA 3A7XA 1TGSZ 2KAIA 1O5DH 2VIQA 4Q2OA 1O5FH 3ATLA 4MNXA 2EGOA 1DSTA 2VB0A 1C1PA 2GT8A 4ESTE 4IW4E 1VCPA 1ANBA 3MU4A 3V0XA 2ANYA 4H6TA 2AS9A 4ZHMU 3QDOA 1QB6A 1Z87A 1KXCA 2QGRA 1LHGH 1TX8A 2F9VA 4X8UH 4WJG2 5C2ZA 1T8OA 4UFFH 3GY5A 4NWLA 4RN6A 2ZQ1A 2J2UA 2ZZUH 1XUFA 5AF9H 1TMTH 2SFAA 4D9RA 1IHJA 1C2GA 2RG3A 4YT6H 1ZJDA 4CRAA 2W3KA 2XXLA 1OKXA 1WTHD 3P17H 3M3VA 3MH6A 2FOEA 3RU4E 1V5LA 1CA0B 4KTSA 2L4TA 1GQ5A 1C5SA 1TOCB 4L8NA 2Z7FE 2FX6A 1UCYE 3PYHA 4X8SH 1Y7NA 3G01A 3RDZA 1C2DA 9ESTA 1GMCF 1P9SA 2NU2E 2OC0A 3EQ0H 1TRMA 1RGWA 4UFDH 2ZECA 3A7ZA 3PO1C 1WH1A 4CRCA 2P8OB 1TA6A 2HE4A 1ZHMA 2CMYA 2A2QH 1EUFA 2BXUH 4RKOB 3T28A 2SGFE 2A4GA 1HAZB 4H6SB 1EX3A 3KCGH 4OS7A 1HAYB 1MZAA 3A80A 1BTHH 4Y0ZE 1W7GH 1A7SA 1D5GA 3QN7A 1UVPA 1HJAB 3TVJB 2FI3E 4MPAA 2GV7A 1G37A 5AVDA 1QBOA 1NTEA 3GDUA 3BIVH 1P12E 3KZDA 1QLCA 2BX4A 5A8ZA 4CH8B 4A1VA 1G2LA 4IC5A 1S81A 4X6MA 3NKKA 4AZ2B 1F5KU 1DY9A 1TIOA 2VWLA 2Y6TA 3E3TA 5FCRA 1NS3A 5ESTE 2FX4A 2W7UA 4A7IB 1Q3PA 4FUEA 3KQBA 4K8BA 1S6FA 3UOUA 1HAGE 3OTJE 1BBRE 4ZMAH 2RRMA 4OS4A 3WKMA 3CBXA 2O8LA 1ZTJA 1FPHH 1J8AA 1LQEA 1P3EA 3TNSA 3BEIB 2D90A 4DY7B 1YPEH 3RP2A 3AVZA 5DP3A 2XBXA 1MTNB 2STBE 4NMSA 1V2WT 2W26A 2Z9IA 1VITF 4Q6SA 3FZDA 3SUFA 1V1TA 3GCTF 4NFFA 3M36A 3DT0H 4JOGA 5EG4A 3RC5A 2PSXA 2K20A 3SGQE 2KPLA 3A83A 1C4U2 1ZSLA 1GJBB 4Z0KA 2P3FH 1O38A 5J4SA 3UNQA 4VGCC 3SUZA 1RTLA 2C3SA 1C5UA 1HDTH 1FAKH 2R2MB 1EQ9A 2KA9A 1G3CA 4E06H 1W11U 1K32A 2FS9A 1IHSH 2Q1JA 1W9EA 2AINA 1IU2A 1LO6A 2FXRA 1Z6EA 3SGBE 5IDKA 3GY4A 3W94A 3S7HB 1C5TA 2YNAA 2FODA 4OS2A
chains in the Genus database with same CATH superfamily
2ZTYA 1WBGB 4M9FA 1UK4A 2IPQX 4HZHA 2KCPA 1X7AC 3RU4D 1UTJA 5FB8C 1V5QA 1D3QB 3A85A 5C1XA 5ABWA 1QY6A 2XC4A 1FY1A 4D7GA 3RC4A 2J98A 3Q00A 5E2OA 1V3XA 2ODQA 2A7JA 1GBIA 5BRRE 1C1WH 1ZOMA 1T4VH 2DAZA 3PS4A 1B7XB 2QKVA 4KKDA 1BTYA 1OS8A 5AFYH 1XVMA 3ZYEA 1DDJA 1WI2A 2QCYA 1CQQA 3LOXA 3T5FH 2ZFTA 1O2JA 4ZKNU 2UUJB 1AIXH 2PHBA 2Y5FA 1WTGH 2FOMB 1OYTH 2Y80A 1PJPA 2O8UA 5A2PA 1C1VH 4Q2PA 1ANCA 1O3JA 4DJZB 4Z33A 6GCHF 1SGFA 3B23B 3ZVDA 2QIQA 1HBTH 1ZPCA 4JZEH 2EJYA 4BAKB 1GBEA 2VWRA 2DM8A 1J16A 4FUGA 5GXPA 4DG4A 1P1EA 2X7ZA 5GCHF 2PKSC 5DKMA 4LZ1H 1J15A 2ZHWH 5HFDA 4TYDA 1N6XA 4WXVA 3MH5A 1OBZA 3RMLH 3UFAA 1ETRH 3I77A 1O3NA 2SGQE 3TJUA 2C8ZB 1LQDB 1QJ6B 1LHCH 1ETTH 3GCHB 2BM2A 4UDWH 1PYTC 1Q3XA 1G3DA 1BMNH 2OC8A 3RXJA 1UITA 2M2AA 5HF4A 1BHXF 2BDGA 2ZGJA 3C27B 1PPBH 3LGWA 2CJIA 2GKVE 2FOAA 1MAXA 1N7TA 3ZZDA 1TE0A 2M3MA 1UJ1A 3A7YA 1W0JD 4FUHA 4GUXA 3ZVBA 1GJ5H 1OWDA 3PDVA 5FBEA 1DWBH 1O37A 2ZDVH 3SNBA 2F4LA 1C1TA 3P95A 3RXGA 4ABBA 3D49H 4CHAC 2GZ7A 7GCHF 1C5VA 2JJ2D 4DIHH 2I4SA 3ZZCA 4Q2QA 5PTPA 2K1ZA 8GCHF 5A0AE 3HGPA 3S0NA 1BMFD 3ZZ7A 1QL7A 4AORA 2BLOA 3GICB 3RU4T 2IWPA 1GL0E 2GGVB 2H2ZA 1UCYH 1IQIA 1TMBH 3MYWA 1A0JA 1YPJH 1IQLA 4Q4LA 1GI8B 4DVAU 1CT0E 1O3CA 5DTHA 8LPRA 5K0HA 2I6SA 3IG6B 5ILBA 4BTTB 3A86A 1XUIA 4MPWA 5CDFE 1ACBE 4NZLA 2GCTB 2Q6DA 1P2QA 1W7XH 3WWBA 2EXGA 1A1RA 1NRQH 1G3EA 1GGDC 2VJ1A 4WY3A 3O46A 4UU6A 3WKLA 5DK1A 4KP0A 1IQMA 5D13A 1UCYK 2WPDD 1EJNA 4A5TS 2B8OH 1D6WA 1ZMJA 4YZUA 3CC0A 6ESTA 1P2JA 3CS7A 3DFLA 2XNDD 4TWWA 1BOQA 1P2NA 2J95A 4ABHA 2OUAA 2FOHA 1ID5H 1C2MA 1O2XA 1QBNA 4B6FA 3GGEA 4XSKU 2CK3D 3L33A 3RXAA 2ZCKP 4LXBH 4JOKA 1GMDF 1H9IE 1XUHA 1DXPA 3HPMA 5H4IB 3VFEA 3C1KA 4ISLA 5KEDA 1GVLA 1UEPA 2I04A 3LJOA 2BD8A 3O8DA 3ZZBA 1BE9A 1UTLM 1QQ4A 3BV9B 2C8WB 3TK5A 1B0FA 3RM0H 1O2UA 5HXFA 4K75A 1THSH 3STJA 1O30A 3NXPA 2TPIZ 2QKTA 2LNCA 2BY7X 2EGKA 3OE7D 2ZU1A 4K1EA 2L4SA 4B71A 3V13A 1DWEH 1BBRH 1Y3YA 3RXKA 1EZSC 2NWNA 5L2YH 4IMQA 2VNTA 5DN6D 1JIRA 2ODYB 1NF3C 3S7KB 3F6UH 2ZPQA 1K2I1 1MU6B 1QB1A 1ZGVA 1PQ7A 1RRKA 5FAHA 1EOLA 1AZ8A 2WV5A 4VGCB 2YTWA 2WUCA 1YF4A 2ZPSA 3UR9A 4NFEA 1OPHB 4Y10E 1K1MA 3LT3A 5F03A 3MWIU 1BBRK 1C9PA 3AW1A 1UTMA 3GDVA 1GCTC 2AIPA 2TIOA 3GYLB 1GHWH 1H8DH 3L4FD 1ELVA 2ILNA 1YCPH 1FY5A 3KF2A 4WH6A 5F8TA 2QN5T 4AGJA 1Z6JH 3ID4A 3SU1A 1C5OH 3K1RA 1FN8A 3SJ8A 2EV8A 4YOIA 1MH0A 3RXFA 2PNTA 2JIKA 4QT8C 2I6VA 4CRDA 2BLQA 2WV4A 2JH6D 5JB8S 1FY3A 2J98B 1XM1A 3SW2B 1Z86A 4GCHF 2BOHB 1SC8U 2OP9A 2SGDE 1WF8A 1BRAA 1ELDE 3UIRA 1Y5AT 1YCPK 4KFVA 3BTDE 2ODPA 3K2UA 5DJ7A 5E0GA 2FOFA 4WMDA 4U30A 2TRMA 1MCVA 1GHYH 2DB5A 4K1TA 2PR3A 2DE8A 3A8AA 2FWWA 1TQ3A 1P03A 3S69A 4F48B 2C90B 2RFKC 5F6MA 4Q7XA 1BUIA 1C1OA 1S6LA 1O2SA 1SPJA 1SQAA 4IS5A 2BDYA 2WPMS 1GHAG 5E0HA 1AI8H 2OQSA 1BCUH 3D62A 3EYDA 3MI4A 3T62A 1THPB 1SGFG 4I33A 1XKAC 5EXMA 1T2MA 4NNMA 1IQFA 3TJOA 2FDAA 4P02A 4FUJA 2WHXA 2BZAA 5FX6A 1AUTC 1D6RA 1T31A 2QXHA 1QAVA 2PKSB 1YM0A 1DANH 2TGDA 5EU8A 1KTTB 3Q77A 1S83A 1VITH 2ZGHA 2WPHS 4N6XA 3NFKA 2HVYB 3MTYA 4BAQB 2HALA 4FU8A 1GJCB 3VB4A 1QJ7B 1TQ0B 3F0PA 1MABB 1NBMD 4AFZA 1C4V2 1Z7KA 5TJXA 3SZNA 3LC5A 3NWUA 4GHQA 1FNIA 2H3MA 3SGAE 5K7RA 1F7ZA 1TWXB 1TONA 2ALPA 4X1RU 4NXRA 1O2LA 3M7TA 1HXEH 1E0FD 2HOBA 1HAOH 1IQJA 3JZ2B 3KQ5A 4Y79A 3GCNA 4O3TA 1F0RA 5BPEA 1QRXA 5A2MH 2J9NA 1AU8A 1DFPA 1HCGA 1VB7A 1GBAA 4Q80A 2SNVA 1G2MA 3BG4B 1HAIH 3VB6A 1GMHG 1NESE 3RXEA 1P0SH 3R0HA 4YLQH 1DITH 3RL7A 5F3XA 1WU1A 2QY0B 1ZTLA 4OAJA 1GI4A 1GJ4H 1MUEB 4Y8XA 4CREA 2PW8H 4I32A 1UM7A 2DLUA 1F0TA 4JMYA 1OXGA 1GJAB 1LVYA 1W9OA 1WHDA 4MDSA 4BTUB 2ANWA 3A8BA 1G30B 1MBQA 4RI0A 1NY22 2J5UA 4XFQA 4Y7AA 5JBBS 3I18A 1FZZA 4GHTA 1BJVA 5EPYA 4KTUA 3SN8A 4Y8YA 3OAAD 1ZOKA 2R3UA 4ABEA 3TGJE 3UNSA 1CBWB 1P2KA 1C1SA 4ABGA 1NFYA 5FCKA 2KFWA 2VVVA 2EY4C 3OY5U 2OGPA 1QA7A 4ABDA 1BJUA 2ZQ2A 2B9LA 2BQ6B 3M5MA 4X6PA 6LPRA 1JOUB 1MTWA 3MNBA 3UQVA 1IQGA 1T8NA 1DICA 1SI5H 3KL6A 5HFBA 1E1QD 3MHWU 3RLEA 4X6OA 1U38A 1AB9C 1DM4B 1Z1JA 2XBVA 3VB7A 1O5AB 2HNTC 2F43B 5EZ0A 1G32B 3F9EA 2LP6A 3DHKH 4BAMB 2G8TA 1T32A 3ZZ5A 3R3GB 3TJNA 4OM9A 3KYGA 2GVFA 2QA9E 2BDIA 1FCFA 1AGJA 1X5NA 4M7GA 3FP8E 4E35A 3ZV8A 1HAVA 5IL9A 1OWIA 1RS0A 1H9HE 2I6QA 3QTVH 2ASUB 1CT2E 1O3EA 3BEFB 4WYUA 4JL7A 4DT4A 1O3AA 1SLUB 3HVQC 1ELTA 3H7OA 1NFUA 3VPKA 2R0LA 2SNWA 3LH3A 2H9TH 1P2OA 2ZEBA 2QXJA 1J14A 4X2YA 5T6DA 4FUDA 5C1UA 3GSLA 1V2JT 1C2JA 3GYMA 1ZJKA 2D8WA 3K6ZA 3N7EA 3ZZAA 1D3DB 4Z8JA 1O2YA 3R68A 1LHEH 1SLWB 1V62A 4NA7A 3N7DA 1V2QT 5GJ4B 1H8IH 1SG8B 1O36A 2F83A 3LONA 3T25A 1GHBG 1O3FA 2QF0A 4DCDA 3TIUA 5F67A 3L6PA 3CBZA 2UUKB 3L3TA 4OEOA 1V2KT 1GDNA 1K1OA 3EGHC 2CF9H 3VGCC 4WMFA 2GMTC 3PRDA 1P04A 2V1WA 1GI7B 3E8LA 1C1QA 4JOJA 3DSOA 1HJ9A 1QBVH 1Z1IA 1TLDA 3RXRA 1C5MD 4Q3HA 5E1YA 5I7ZA 1OYQA 1O2OA 2XWAA 1W12U 4MNYA 2G52A 4XBCA 3SNCA 3S9CA 1HB0B 1O2PA 1UO6A 1VZQH 5GWZA 2VWOA 3BTEE 3KQCA 2R3YA 1QAUA 4HTCH 1O3HA 5HF1A 5HJ1A 4H42U 2P16A 4NA8A 3EA9A 1NC6A 3ATIA 3U1JB 3KN2A 3A82A 4FOUC 2ZFFH 3KGPA 1G9IE 3QGJA 2O2TA 1YY3A 1QAVB 2A45B 1W2KH 3LIWA 3PLKA 2RA0A 1WIFA 4P2AB 1WHAA 2XBYA 3Q3KA 3A8CA 3E6PH 2BDCA 2CSSA 4J1YA 5JPMH 1PDRA 3GDSA 1P10A 1ARCA 2EEJA 1EPTA 5HFCA 3T2NA 1EPTC 2DJTA 1W3CA 2YNBA 4IGDA 4G69A 2ZP0H 1FC6A 2P93A 2K1QA 1KXFA 3S9AA 2YT8A 2Q9VA 1LVMA 3RXUA 1AFQC 1WDIA 1M9UA 2HPPH 1B8QA 1JBUH 2FI5E 3SHWA 4R8TB 3SV2H 4YM9A 1FC7A 2BX3A 2J38A 2ZCLP 2FLRH 1WCZA 3BTFE 4X0WU 1TPSA 4YLUA 1OHHD 3F3BA 3V3MA 5JXBA 1IQNA 5E0JA 1L0ZA 3AK5A 1EZQA 3LU9B 1ZR0A 3M5LA 1TYNA 1DE7H 2CN0H 1SMFE 1AVWA 1AN1E 2RA3A 1C2HA 3A8DA 3GY8A 3TLOA 1D3TB 3CP7A 3SO3A 1C1MA 2YUBA 1O2IA 3MNXA 3CENA 4A1XA 2A32A 4LK4A 2YMSC 1L1JA 1SGCA 3GOVB 1O3PB 1U3BA 3PWBA 1WF7A 1SOTA 5C67A 2ZDNA 4IMZA 4Y6DA 4KFWA 1BMMH 1QFKH 2ZF0H 1KLJH 4AMHA 1O2WA 1TBZH 2OLGA 1F2SE 4X1PU 1BZXE 6CHAC 2ZFRH 1BTXA 4Y11E 3DJ3A 3VB3A 5EQRA 3QIKA 1C2KA 2FYQA 2I1NA 1EAUA 3OY6U 1UTKA 3HPKA 5EYZA 5KECA 3CYYA 2OBOA 5LPFA 2JETC 4IN2A 3I78A 1EATA 5HKKD 4B73A 3U69H 1ZSKA 2QC2A 3RXMA 2Z17A 4UE7H 1N99A 5HEBA 1EJMA 2A2XH 4ZXXH 1TX7A 3M7UA 5DP8A 3STIA 3V7TA 1KSNA 4WF8A 2QV1A 2AMQA 2FNEA 1DT2A 1RGQA 3A87A 2V3MA 1ZZZA 4ZHAA 1NU7B 3SQEE 1N6EA 2ZU4A 1P05A 2KOMA 1SKYE 4MNVA 1TGTA 3DJ1A 1HAVB 1YPKH 2AGEX 1YC0A 4X2WA 2BY8X 2PWXA 1V6BA 4NIYA 3UPEA 1O3BA 2AHME 2KCYA 1HAPH 1X5RA 1L6OA 1BT7A 1I92A 4NSVA 1H9LB 1O3KA 4ASUD 1LHDH 5LPEA 2TGPZ 4ZROA 1O5BB 1AE8H 3FO8D 3RXBA 4GVUA 3VQGA 3ENSB 1TA2A 2V3HH 2CSJA 3QWCH 5C3NA 3MH7A 1YPHE 2PA1A 2C4FH 1KXEA 1KLIH 3B8JA 2PDZA 1HNEE 5C20A 5HIYA 2Y7XA 3AAVA 4Y76A 3HK3B 1OOKB 4O03A 1K9OE 1HUTH 1GHZA 1GI3A 5GDSH 3PROA 1Z8GA 3NGHA 4MVNA 4SGBE 2VWMA 2FN5A 2GJGA 4INHA 2KG2A 3DFJA 1V2RT 2VIPA 5LH8A 2EEGA 3EE0B 4NIXA 4Y71A 5T1VA 3U28C 3ZVEA 1AE5A 3VGCB 1R6JA 1GPZA 1GI0A 1MQ5A 3QJMA 1OP8A 3LKWA 1WQVH 1RJXB 1DWDH 1JMOH 4XBBA 4OGYA 1LPZB 4GSOA 5TCAA 1MU8B 2ESTE 3SORA 4D76A 1YP9A 3EGKH 1BMLA 4ABFA 1NRNH 3URDA 3P70B 3GS9A 3SU5A 4ZH8A 3ID1A 4X1NU 3ELAH 4NWKA 2ZNKH 3EDXB 3FP6E 1SBWA 3VEQB 1TX6A 3TSVA 3E0NB 5T3HA 2AERH 3FOAA 1AD8H 3ODFA 5JB9S 3VQFA 2XC0A 2QE7D 3FVFB 2OCSA 3MU0A 3LC3A 2E7KA 2XBWA 4K76A 1O3OA 3I4WA 1ELCA 1T4UH 1O5CB 1HV7A 4ABIA 2EGNA 2OMJA 2BLVA 3O5NA 2D2DA 5HDYA 1EZUC 1O2GH 1TNIA 4AB9A 3M7QA 3P6ZB 2P3UB 1GG6C 1GHVH 1EPTB 1GBCA 2RDEA 1ABJH 1QNJA 2KCAA 4XRNA 2G51A 1SGQE 1BFEA 1YLDA 1P57B 1PQAA 2CXVA 2LPRA 1AFQB 1Q31A 5HIZA 1GI6A 1E37B 4I8JA 3SV6A 1V2VT 1OP0A 1S0QA 2EHRA 5E11A 2H2CA 2HLDD 3DSGA 1GMHF 3PO1B 1ORFA 2V35A 1VGCC 2FE5A 1VCWA 1YLCA 2BLWA 2BOKA 2V0BA 2FTMA 3ZIAD 3PV4A 2H5CA 5EXNA 1VJ6A 2AYWA 3RXQA 4X6NA 1YWUA 3F9GA 1C5WB 2EI8A 4XOJA 1WUNH 2M5TA 1K1LA 1ZHPA 3MU8A 1L1NA 3LGIA 4B1TA 5SGAE 3FY5A 1CVWH 2M0VA 1W9QA 1IQEA 3UWJH 4JYVH 3EE7A 3AXAA 2VBCA 1PPGE 2K8IA 2NU4E 3JZ1B 2YMSB 1MTUA 1E79D 2AIQA 1WAYB 1ZMNA 3VB5A 5DP9A 2QYIA 2FOBA 3PLPA 2ZHFH 1N8OC 2GCHG 2W6ID 5DO4H 1O5EH 2OC1A 2DLSA 5LGOA 1GBKA 1V6DA 3TH4H 5HFEA 1UK2A 1C5YB 1UVOA 1V2OT 3QUMP 1NRPH 1GJDB 3FKSD 4NA9H 1NBME 2WSSD 2F91A 1F5RA 1VJ9U 1O3DA 2ZHEH 4R0IA 4K5ZA 4FXGH 1SSXA 1SR5C 2W5EA 2QG1A 5AFZH 1OBXA 2A5KA 3U8RH 3QE1A 3BPUA 3PV5A 3SV7A 2VH6A 1ZRKA 2UZCA 1TGNA 2XCFA 1OWJA 2VVCA 3SHAH 1VR1H 1ETSH 3Q3YA 1B5GH 3ID3A 2AGGX 1C5LH 3A88A 4CH2B 2PUQH 2V7QD 1O2KA 2G55A 2O8MA 2NU3E 4NMOA 1CU1A 2ZHDA 1S82A 1YGCH 1AMHA 2CHAC 1OBYA 5EGMA 2KAWA 5A8YA 3PM3A 1EJAA 1TNHA 3NRLA 1FXYA 2WPJS 3S9BA 4YOJA 1NO9H 3JXTA 2PTCE 4NCYA 2ZDAH 3BG8A 2Y81A 3AW0A 3Q76A 2QBWA 1A5HA 1TNKA 2REYA 4NXPA 1X45A 4NXQA 1KLTA 1Y3WA 3BEUA 3ITIA 2Z3EA 2GZ8A 4XDEA 1IQKA 2DUCA 3RMNH 2G5MB 1CHOG 2SGPE 1YCPM 1A3BH 5KGOA 1XXDA 3U9AH 1QGFA 3QO6A 1KXDA 2FOGA 5FHTA 3IWMA 1GHBF 2F9UA 2Y5GA 1MD7A 4IN1A 1FLEE 2GZVA 2EC9H 3MNCA 3D65E 5EW1H 2JXOA 4K2YA 1W13U 5F53A 3SU0A 1NRRH 1SL3A 2BD4A 2WZQA 3HPTB 3U8OH 1A46H 1WQSA 1ANDA 1O3GA 1P2IA 1ZPZA 4XHVA 4R2ZA 2BY5X 3P8NA 2TBSA 2VPHA 3CBYA 1DLKB 5EIYA 1DPOA 1DSUA 1W0ZU 1QRWA 2GEFA 1SGDE 3RUOA 5DG6A 3LGYA 3K82A 1MQ6A 2KJDA 1NFWA 3TU7H 5GPIB 1GI2A 1KY9A 4REYA 3BN9A 1LCYA 1DWCH 1E36B 2LELA 3QX5H 1UK3A 1OSSA 1BDAA 1QZ8A 1Z8IB 1ESAA 3DD2H 2EDPA 2AMDA 3M5OA 4P00A 4YT7H 2ZHQH 1UTPA 3M37A 2XNIA 3GY6A 1AY6H 1N6FA 3AAUA 1GVZA 4ZUHA 4BAHB 3SBKA 4TSFD 3K9XB 1Z8JB 4K6YA 1O31A 1Y3UA 2C8YB 3AASA 2M10A 1HJ8A 2B5TB 3UTUH 3RXLA 4B76A 2ZPMA 3SOEA 2A4QA 3OSYA 2IWOA 3ZVAA 5C94A 1HFDA 4B2AA 5DP6A 4Z6AH 1MKXH 1YBOA 3RXDA 3ZVCA 4IBLH 4B6EA 1K1PA 3SNAA 3N99A 3ZZ6A 5A8XA 4AFQA 4CRGA 1W10U 1PYTD 5CHBA 2D92A 1GI5A 3T26A 4JZFH 1GG6B 2ZA5A 1O2MA 2OSGA 1MAYA 1VCQA 4AOQA 1QL8A 3TPIZ 2SGEE 5L2ZH 2FCFA 2OS6A 3IITA 3H5CB 2QF3A 5FPSA 1JRSA 1V2PT 2XRCA 5HM9A 1KIGH 1MKXK 1G3BA 3BTGE 4JOFA 1GBJA 1TB6H 1TP5A 2ANMH 1L4DA 3EA7A 3PTBA 4NZQA 1FJSA 4MQAA 2JH0D 4CHAB 3LGTA 2Q3GA 1V2ST 3UREA 4F55A 1LPGB 1UJVA 3SZEA 4CBNA 4E34A 1CO7E 2XTTB 4INLA 3FP7E 1TP3A 2J94A 1E34B 1BTUA 1TNLA 1FPCH 3OTPA 2BQ7B 2BDBA 1EAWA 1G9OA 2F0AA 1C4Y2 3W95A 1Q3OA 1XVOA 3EGGC 1Q2WA 2ZG0H 2JILA 2YOLA 1SOZA 1AHTH 4NIWA 1D9IA 2J4IA 1CA8B 2B7DH 3B9FH 1FIZA 4YYXA 3SJOA 1CGIE 1SQTA 2FESH 1KYNA 2P8OC 2W7SA 5C5OA 4HG6A 1P11E 1C5NH 1GGDB 3O8CA 2VVUA 1P2MA 2I0LA 1T8LA 3FZZA 2Z9GA 3ZZ3A 1QJ1B 1EB1H 1UW7A 2CF8H 1GL1A 3KHFA 4E7NA 5E6PB 2A4OA 3A81A 2WYGA 3SV8A 2P94A 1Y3XA 1A3EH 1UHBA 4XBDA 2KBSA 3UWIA 2O8TA 1PQ8A 8GCHG 2HE2A 3ZV9A 1V2LT 1OP2A 1HJAC 4AX9H 2J34A 1UM1A 1CSOE 1GDUA 1YPLH 1SGRE 2AGIX 2AWUA 3K6YA 2BB4A 2ZI2H 2D8IA 2OINA 4AFSA 4JK5A 2OCVB 3TNTA 3BIUH 4BTIB 2YT7A 4ZKRU 1RGRA 3ATWA 2PLXA 5L6NH 4X8VH 1HLTH 4TPIZ 1FQ3A 2ZCHP 1SFIA 7ESTE 1KWAA 1O2TA 2M0ZA 3MOCA 4O3UA 1O3MA 1LVOA 1QCPA 4FUFA 2GDEH 1O39A 1ZRBA 3SQHE 1MBMA 2KV8A 1KXAA 2KOJA 5DPAA 2OXSA 3SJIA 3TGKE 4X2XA 4OS5A 1TAWA 1FC9A 2VRFA 1DS2E 3QTOH 1XXFA 3RC6A 4PQWA 5HEDA 3I1EA 4JJ0A 1CGHA 4JZIA 4ISNA 4X1QU 1MTNC 1S6HA 1PPEE 1QTFA 3DA9B 4Y0YE 4Q63A 5GNDA 1C1UH 3TSWA 3OX7U 4BOHA 3SU2A 2A1DB 1UF1A 8KME2 4HI3A 2ZWLH 3GY3A 3PMBB 3SHUA 1GCTB 1WYKA 2NU1E 4NMQA 1A4WH 2AEIH 4Y7BA 2VIVA 1TALA 2WPIS 1Z71A 1C2LA 4X8TH 1M5ZA 4ZHLU 2KQFA 3UB0A 2ZU5A 1KXBA 1BITA 2BYAX 3PTNA 1O35A 1CE5A 2G4UA 3SI3H 1ZYOA 2V90A 2IOTA 3WY8A 2OTVA 1UEWA 2Y5HA 3PMJA 2JSNA 1N7EA 2EEKA 2FPZA 4WH8A 1DOJA 1HYLA 2P95A 2PKUA 4NIVA 1NN6A 5A0BA 1ZPBA 3HKJB 1NPMA 4THNH 1XKBC 2C93B 2FIRH 3A7VA 4DOQA 4K3JA 4Q6HA 2IN2A 5C0TA 3SU4A 2FLBH 1LHFH 2AWWA 3LH1A 3NK8A 3OYPA 1EZXC 3KQEA 2PKTA 3DUXH 1UVTH 1IHTH 4NMPA 2W7RA 1TQ7B 2BD3A 3SJ9A 4DURA 1FMGA 1HAXB 1VJAU 2WV9A 3FANA 2M0TA 3LPRA 3URCA 4ZXYH 1FN6A 4D7FA 3I29A 3RM2H 1GJ7B 1GBDA 1C5RA 4U01A 2VU8E 3PMAB 1CHGA 2BD2A 1GBHA 1AQ7A 1AKSA 1LMWB 1MFLA 1Y3VA 2BD9A 1K28D 1FIWA 2ULLA 4D9QA 4O9VA 1HIAA 1GHXH 1VA8A 4AFUA 1F5LA 1OWKA 4CR5A 3R69A 4YESB 2HPQH 2OZFA 3PV2A 2HGTH 4DGJA 5HGGA 1S0RA 1AVXA 1SGIB 2P59A 1O2HA 3F2GA 1SGTA 5J4QA 5A09A 5B6LA 4F49A 3MNSA 2PKAA 4ISOA 4PROA 4LZ4B 4I8LA 3CH8A 3KNXA 3SOSA 1D3PB 5F8ZA 4K8YA 3TK6A 3MH4A 5C17A 2GP9B 3TITA 1N6DA 3MO6A 3WW7A 4K60A 2EEIA 4NMRA 1EOJA 3GCHC 1Y8TA 2GTBA 2TGAA 5HYOA 1SGPE 1TFXA 3BTHE 2W3IA 2EDVA 5TCCA 1MCTA 3LNXA 1BQYA 3W1EA 4P0CA 4Q2KA 3UQOA 4TWYA 5B42A 4I7YH 2H1UA 2A0QB 4GHNA 1K21H 1O2QA 1QURH 1TGCA 4AG2A 9LPRA 1RFNA 4NG9H 4TY6A 4I31A 4MNWA 1EKBB 1ELGA 1BIOA 5ESBA 3ATMA 5EODA 1YPGH 1YLNA 4RT0A 1V2UT 1TPAE 2GCHF 2UUYA 2Z9LA 3UNRA 1J17T 4INKA 1RY4A 1GCDA 1P3CA 4ABAA 1ELBA 4K78A 1I16A 1RIWC 1XUKA 3A89A 3H7TA 2BHGA 4EDJA 1P1DA 3TSZA 2BTCE 4WVPE 4GVCA 2V3OH 1PQ5A 3GCOA 2FMJA 4XE4A 1GI1A 2H6MA 2A5AA 4NNLA 1BTPA 2ZGCA 4Q2NA 2ZGBH 3A7WA 1AWHB 1UHBB 1X6DA 2GCTC 4ACBA 1EXFA 4FUIA 2FS8A 4Z1MD 2UWLA 2V6NA 1MC7A 3OEED 1H1BA 4JK6A 3TJVA 1GBTA 1P06A 4JOPA 3RXSA 4FVDA 4H11A 5JYIA 1EP5A 4CR9A 2A7CA 3P92A 5GLJA 3SU3A 5CE1A 2A7HA 3SUGA 1A5GH 1AB9B 3E16B 2XYAA 1YPHC 2P3TB 1HPGA 4CRFA 1GBLA 4X1SU 3BTQE 1E35B 1UTQA 5IYTA 5DP4A 3F2HA 5E2PA 1DXWA 5FX5A 2BZ6H 4FLNA 2GD4B 2IJOB 5FXLA 1TNGA 4F4OC 1GBFA 1CHOF 1VAEA 3QGNB 3UY9A 2ZDKA 2ZGXH 2KRGA 2OK5A 2WYJA 3SUEA 4ASHA 2NU0E 4I8GA 3RL8A 1XZ9A 2LUIA 2PGBB 1ESTA 2B0FA 1U37A 1ZMLA 3ZZ8A 4AYYB 4ZCNA 2ALVA 3MU5A 1K1JA 3ID2A 1LDTT 4AG1A 4E3BA 4FU9A 1C5XB 2JWEA 2QXGA 1XMNB 1FY4A 4D8NA 3Q3XA 4JOEA 2DMZA 4A92A 4HGCA 1DUEA 4JYUH 3F9FA 1O2RA 5DSFA 1RZXA 2F5YA 1EAXA 1KTSB 2A5IA 1O0DH 4YXWD 2JREA 2VZ5A 3BTKE 5JBCS 5HMAA 3F0OA 4WXIA 3SV9A 1TMUH 1ABIH 4B2BA 2HVXA 7LPRA 3TK9A 2A4RA 3M3TA 4DW2U 4GAWA 2QF4A 1BRUP 1SLVB 2SGAA 2AWXA 1PPHE 2UWPA 2ZPLA 1YBWA 1QQUA 1MKWH 2XOKD 2JJ1D 3MFJA 2GMTB 1PFXC 4E05H 4BAOB 1C5ZB 1O2ZA 1F0UA 1GHAF 3BF6H 3M3SA 1X9ZA 2A31A 1H8ED 3DJAA 5EXLA 1SGEE 1UVSH 3LJJA 1QIXB 2OBQA 3NPSA 1UFXA 1Y59T 5DP5A 3LGUA 2W4FA 2DE9A 1U6QA 1WFVA 1MKWK 1QR3E 3PRBA 1NT1A 3MQKC 1P01A 1ZLRA 2FO9A 4HFPB 5CHAC 1HGTH 3RLYH 1MZDA 4UD9H 1X8SA 1AKSB 1J9CH 1ZSJA 4ZKOU 3NZIA 1NRSH 1X5QA 2K0QA 2XC5A 3LNYA 5H3JA 2GV6A 3RLWH 1HIAB 1JXPA 1NU9A 2KAIB 1WFGA 1ZGIA 2H9HA 2KCOA 1BTZA 3N7OA 2JIZD 3GABA 2F9NA 2GDDA 2ZU2A 1O2NA 3ZVGA 3M35A 5I46H 2G5NA 1LPKB 3A7TA 3RXOA 2VIWA 1IU0A 2MX6A 3M5NA 5G1DA 4I86A 5FBIA 1ZHRA 2JKHA 2KM0A 2ZKSA 2ZTZA 4FU7A 2KL1A 5T6GA 2PKAB 1HAHH 5FPYA 3NCVA 3FN8A 2P3WA 3RXVA 1EB2A 1UEZA 3RXPA 3TH2H 2QT5A 2FZZA 4FETA 5G4BA 2EQNA 2HLCA 2ZFSA 2EA3A 1GI9B 4MPUA 5FPTA 1F0SA 4UONA 2FEQH 1JWTA 2AMPA 1T7CA 2FTLE 2H9EH 1ZTKA 4LOYH 3K65B 1BA8B 1W14U 2EI6A 3KHVA 2WUBA 3HGNA 1QB9A 3PB1E 2WL7A 1E38B 3BSQA 1UJDA 3OFND 1SLXB 1AFEH 2BDAA 1SHYA 1TBQH 3UUZA 1GBBA 1IAUA 2BQWB 1AUJA 1H8HD 3TH3H 1O32A 5HM2A 1FI8A 1W0KD 1EAIA 2YMSD 2QKUA 1GMCG 2BDHA 1RIWB 2PSYA 2FI4E 4OEPA 3QK1A 5E8EH 4B2CA 5JBTA 3BG4C 3EAJA 3LGVA 3SJKA 3MMGA 3BTME 1YKTA 1YYY1 2Z9KA 3NUMA 4WMEA 2PP6A 3ESTA 4JORA 2PTNA 5F8XA 6CHAB 1C2FA 5EQSA 2VINA 1C2EA 2IJD1 2EEHA 5E22A 3PDZA 1ELFA 3KDGA 1AZZA 1K22H 4MG3A 2VWNA 2PGQB 2BD7A 3LDXH 2JETB 1DY8A 2VIDA 1AO5A 1GBMA 1O34A 1CBWC 3OU0A 1ANEA 3QLPH 4YOGA 1GWAA 1Q7XA 2WINI 4JZ1A 1FY8E 3K50A 5LPRA 1NM6A 3SU6A 1Y5BT 2BXTH 3RXCA 1MFGA 1JIMA 3E91A 1XX9A 3FAOA 1TRYA 4AGKA 1INCA 3VG8A 3B76A 2PUXB 4Y8ZA 1AVGH 1UTNA 1UTOA 4F8KA 4JJ3A 2GX4A 1GJ8B 1N1LA 4UFGH 5E21A 4ACAA 1A2CH 1TGBA 3EA8A 1RTKA 3ZRTA 1H4WA 1THRH 1CGJE 2LC7A 3GY2A 2ZPRA 4E7RG 4GVDA 2O9QA 4HOPA 1COWD 4UEHH 3ZZ4A 1UMAH 2ZDMA 2QAAA 1U39A 1W0YH 2F9PA 5CMXH 4GLYA 4RKJB 1RD3B 1L1GA 1P9UA 2VGCC 1C9TA 8ESTE 2BD5A 1O5GH 1VITG 4X2VA 3GCTG 1WI4A 4GPGA 4JZDH 3F2FA 5C1YA 4K1SA 4FUBA 5I25A 3H09A 1HRTH 4JOHA 3SNDA 5HFFA 3ATKA 1Z8RA 3P8FA 2ZO3H 4A6LA 2L6OA 2HWLB 2JDID 5B6OA 1FONA 3SYJA 4BNRA 4MTBA 3DORA 2FP7B 1GJ9B 2OPGA 4AB8A 2R4HA 3KIDU 1MMJN 3HKIB 2KOHA 5L30H 2QXIA 5IK2D 1MTVA 1Y5UT 3QZRA 3SFJA 3RXIA 1NROH 4LMMA 1KDQA 1S5SA 2THFB 2WPKS 1L4ZA 3T27A 1AWFH 3GY7A 4TPYA 3UOPA 2LOBA 4IC6A 3R0FA 2UUFB 1K1IA 4AYVB 2VSPA 2AFQB 4SGAE 3KZEA 3T29A 3TGIE 4DIIH 1RXPA 3P8OA 2I0IA 3SHCH 3PWCA 3DIWA 3WWFA 2VIOA 4FVBA 1O3IA 2KYLA 3KEEA 3OEHD 4I8HA 5CHAB 4B74A 2H3LA 4O97A 1C2IA 3A84A 2Q6FA 2HGAA 2KPKA 1IOEA 4FUCA 3O8BA 1EFRD 2FOCA 4Q7YA 3O8RA 2Z94A 1A61H 1FAXA 4UFEH 1WV7H 2LC6A 4MPXA 1SHHB 1QHRB 2AH4X 2J92A 4WYTA 4MPVA 2F9OA 3RXTA 3NCLA 2ENOA 4OGXA 1L2EA 1SFQB 3SNEA 5EJLA 1SGNE 1LVBA 1O3LA 2FYRA 2PFEA 2OQ5A 2BVRH 5T6FA 2O8WA 2OC7A 2G4TA 3HK6B 2R9PA 4ABJA 1SQOA 5HEYA 4UU5A 1TNJA 2EDZA 1XUJA 3KQDA 2LA8A 6GCHG 2STAE 2ZFQH 2ZIQH 5ETXA 3SUDA 1ZUBA 2FM2A 1T8MA 4U2WA 1V2TT 1E1RD 1A0HB 1KEFA 1DVAH 2BYGA 1N7FA 3U1IB 2DC2A 2RDLA 4YO9A 4H4FA 1VGCB 2CV3A 3F1SB 1CA0C 3E90B 5GCHG 1VKYA 3ZZ9A 2F3CE 2D26C 3E0PB 4NGAH 1WG6A 2KJPA 1O2VA 3SI4H 3UAIC 2H2BA 5A0CA 1D4PB 2Z3DA 4XD7D 2R2WU 1BHXB 1C5QA 2M0UA 3UR6A 2G81E 3PMHB 4KTCA 4CRBA 2XWBI 4OS1A 1MD8A 3MO9A 2KZ4A 1LKAA 5EPNA 1O33A 3HATH 4I8KA 5AHGH 1WOFA 1NTPA 4MLFB 3U98H 1OZIA 2Z3CA 1LKBA 1JRTA 4U32A 4OS6A 3ODDA 1V2MT 2H5DA 1BMAA 5EQQA 1B0EA 5EOKA 2D1JA 1DLEA 7GCHG 3GJ9A 1S84A 2UWOA 2PZDA 2JINA 5C5NA 1WJLA 1QA0A 1N8OB 2Z9JA 5JBAS 4BXSA 4KGAA 2PV9B 2ZU3A 1NFXA 1K0HA 1YPMH 1EP6A 1PPFE 1WSSH 3D23A 3U8TH 3MU1A 4TY7A 2BVSH 1TPOA 3QGLA 3BTTE 4ISHH 5GIBA 4ZKSU 2DKRA 4KELA 1IQHA 2HNTF 2BY9X 1P09A 3KYFA 1S85A 1TBRH 4BXWA 1SB1H 1GDQA 1GJ6A 2RCZA 1RTFB 4B75A 3VXEH 2XCNA 1DUAA 3RXHA 4CBOA 2Z6BD 2GZ9A 2HRVA 1GM1A 1PPCE 2KJKA 2ANKH 1UJUA 2VSVA 2CHAB 2RCEA 4TT3D 2IWQA 1N6YA 2ZC9H 4ISIH 1ELAA 1OWEA 2XW9A 2ZFPH 4RT1A 3CS0A 1DX5M 4DT7B 2G5VA 2J97A 2TGTA 2ZDLA 1FX0B 1QL9A 1C1RA 4JYTA 1F92A 2L97A 1GMDG 1EASA 4AN7A 2BMGB 5G1EA 2OQUA 1K1NA 3CNRA 1UEQA 1CT4E 2YUYA 2WPLS 1P8VC 4BANB 2R0KA 4HOPB 3BTWE 1QRZA 4FGMA 2Y7ZA 1GVKB 4Q7ZA 3GISB 1UHPA 1NZQH 2JH5D 1TPPA 4J2YB 1OX1A 2IWNA 1C5PA 1V2NT 4JCNA 2KX4A 3NFLA 1P02A 4O06A 4K69A 3MO3A 3V12A 2VGCB 5EJ1A 3QZQA 1LTOA 5JDUB 2BY6X 1A5IA 2BVXH 2GT7A 3ZVFA 1BTWA 3P8GA 2F9BH 1MTSA 2ZTXA 3RMMH 1TABE 2MHOA 1SVPA 4NMTA 4ZAEA 2C8XB 4RSPA 1BB0B 1BRCE 3QJNA 1TOMH 2IPHA 2HNTE 1GQ4A 1FV9A 1A0LA 3E1XB 1ESBA 3M61U 3PLBA 5HETA 2G00A 1XUGA 3E17A 3ZYDA 4WWYA 1SGYE 4YTAA 3DSPA 1G36A 4K72A 1OWHA 5DGJA 3QDZB 3VXFH 2CS5A 1KDQB 2KR7A 3TMHA 4NSYA 4NMVA 4A1TA 4YDPA 2CGAA 1W8BH 2Y82A 2G2LA 3RMOH 2JOAA 7KMEH 1FUJA 1TRNA 2EI7A 1UVUH 1FDPA 1BRBE 1HXFH 2OD3B 2VH0A 1C1NA 3FFGA 2EAQA 5EW2H 1ELEE 3F68H 2Q6GA 4GCHG 5DP7A 2W6JD 1ARBA 3F9HA 1PPZA 3A7XA 1TGSZ 2KAIA 1O5DH 2VIQA 4Q2OA 1O5FH 3ATLA 4MNXA 2EGOA 1DSTA 2VB0A 1C1PA 2GT8A 4ESTE 4IW4E 1VCPA 1ANBA 3MU4A 3V0XA 2ANYA 4H6TA 2AS9A 4ZHMU 3QDOA 1QB6A 1Z87A 1KXCA 2QGRA 1LHGH 1TX8A 2F9VA 4X8UH 4WJG2 5C2ZA 1T8OA 4UFFH 3GY5A 4NWLA 3KDKA 2ZQ1A 4RN6A 2J2UA 2ZZUH 1XUFA 5AF9H 1TMTH 2SFAA 4D9RA 1IHJA 1C2GA 2RG3A 4YT6H 1ZJDA 4CRAA 2W3KA 2XXLA 2L74A 1OKXA 1WTHD 3P17H 3M3VA 3MH6A 2FOEA 3RU4E 1V5LA 5C0UA 1CA0B 4KTSA 4AC9A 2L4TA 1GQ5A 1C5SA 1TOCB 4L8NA 2Z7FE 2FX6A 1UCYE 3PYHA 4X8SH 1Y7NA 3G01A 5FL7D 3RDZA 1C2DA 9ESTA 1GMCF 1P9SA 2QF5A 2NU2E 2OC0A 3EQ0H 1TRMA 1RGWA 4UFDH 2ZECA 3A7ZA 3PO1C 3DCLA 1WH1A 4CRCA 2P8OB 1TA6A 2HE4A 1ZHMA 2CMYA 2A2QH 1EUFA 2BXUH 4RKOB 3T28A 2SGFE 2A4GA 1HAZB 4H6SB 1EX3A 3KCGH 4OS7A 1HAYB 1MZAA 3A80A 1BTHH 4Y0ZE 1SQRA 1KMHB 1W7GH 1A7SA 1D5GA 3QN7A 1UVPA 1HJAB 3TVJB 2FI3E 4MPAA 2GV7A 1G37A 5AVDA 1QBOA 1NTEA 3GDUA 3BIVH 1P12E 3KZDA 1QLCA 2BX4A 5A8ZA 4CH8B 4A1VA 1G2LA 4IC5A 1S81A 4X6MA 3NKKA 4AZ2B 1F5KU 1DY9A 1TIOA 2VWLA 2Y6TA 3E3TA 5FCRA 1NS3A 5ESTE 2FX4A 2W7UA 4A7IB 1Q3PA 4FUEA 3KQBA 4K8BA 1S6FA 3UOUA 1HAGE 3OTJE 1BBRE 4ZMAH 2RRMA 1WXRA 4OS4A 3WKMA 3CBXA 2O8LA 1ZTJA 1FPHH 1J8AA 1LQEA 1P3EA 3TNSA 3BEIB 2D90A 4DY7B 1YPEH 3RP2A 3AVZA 5DP3A 2XBXA 1MTNB 2STBE 4NMSA 1V2WT 2W26A 5EJZA 2Z9IA 1VITF 4Q6SA 3FZDA 3SUFA 1V1TA 3GCTF 4NFFA 3M36A 3DT0H 4JOGA 5EG4A 3RC5A 2PSXA 2K20A 3SGQE 2KPLA 3A83A 1C4U2 1ZSLA 1GJBB 4Z0KA 2P3FH 1O38A 5J4SA 3UNQA 4VGCC 3SUZA 1RTLA 2C3SA 1C5UA 1HDTH 1FAKH 2R2MB 1EQ9A 2KA9A 1G3CA 4E06H 1W11U 1K32A 2FS9A 1IHSH 2Q1JA 1W9EA 2AINA 1IU2A 1LO6A 2FXRA 1Z6EA 3SGBE 5IDKA 3GY4A 3W94A 3S7HB 1C5TA 2YNAA 2FODA 4OS2A
chains in the Genus database with same CATH topology
2ZTYA 1WBGB 1UK4A 4HZHA 1X7AC 3RU4D 1UTJA 5FB8C 1V5QA 1D3QB 3A85A 5C1XA 5ABWA 1QY6A 2XC4A 1FY1A 4D7GA 3RC4A 3Q00A 5E2OA 1V3XA 2ODQA 2A7JA 1GBIA 5BRRE 1C1WH 1ZOMA 1T4VH 2DAZA 3PS4A 1B7XB 2QKVA 4KKDA 1BTYA 1OS8A 5AFYH 1XVMA 3ZYEA 1DDJA 1WI2A 2QCYA 1CQQA 3LOXA 3T5FH 2ZFTA 1O2JA 4ZKNU 2UUJB 1AIXH 2PHBA 2Y5FA 1WTGH 2FOMB 1OYTH 2Y80A 1PJPA 2O8UA 5A2PA 1C1VH 4Q2PA 1ANCA 1O3JA 4DJZB 4Z33A 6GCHF 1SGFA 3B23B 3ZVDA 2QIQA 1HBTH 1ZPCA 4JZEH 2EJYA 4BAKB 1GBEA 2VWRA 2DM8A 1J16A 4FUGA 5GXPA 4DG4A 1P1EA 2X7ZA 5GCHF 2PKSC 5DKMA 4LZ1H 1J15A 2ZHWH 5HFDA 4TYDA 1N6XA 4WXVA 3MH5A 1OBZA 3RMLH 3UFAA 1ETRH 3I77A 1O3NA 2SGQE 3TJUA 2C8ZB 1LQDB 1QJ6B 1LHCH 1ETTH 3GCHB 2BM2A 4UDWH 1PYTC 1Q3XA 1G3DA 1BMNH 2OC8A 3RXJA 1UITA 5HF4A 1BHXF 2BDGA 2ZGJA 3C27B 1PPBH 3LGWA 2CJIA 2GKVE 2FOAA 1MAXA 1N7TA 3ZZDA 1TE0A 2M3MA 1UJ1A 3A7YA 4FUHA 4GUXA 3ZVBA 1GJ5H 1OWDA 3PDVA 5FBEA 1DWBH 1O37A 2ZDVH 3SNBA 1C1TA 3P95A 3RXGA 4ABBA 3D49H 4CHAC 2GZ7A 7GCHF 1C5VA 4DIHH 2I4SA 3ZZCA 4Q2QA 5PTPA 2K1ZA 8GCHF 5A0AE 3HGPA 3S0NA 3ZZ7A 1QL7A 4AORA 2BLOA 3GICB 3RU4T 2IWPA 1GL0E 2GGVB 2H2ZA 1UCYH 1IQIA 1TMBH 3MYWA 1A0JA 1YPJH 1IQLA 1GI8B 4DVAU 1CT0E 1O3CA 5DTHA 8LPRA 5K0HA 2I6SA 3IG6B 5ILBA 4BTTB 3A86A 1XUIA 4MPWA 1ACBE 4NZLA 2GCTB 2Q6DA 1P2QA 1W7XH 2EXGA 1A1RA 1NRQH 1G3EA 1GGDC 2VJ1A 4WY3A 3O46A 4UU6A 3WKLA 5DK1A 4KP0A 1IQMA 5D13A 1UCYK 1EJNA 4A5TS 2B8OH 1D6WA 1ZMJA 4YZUA 3CC0A 6ESTA 1P2JA 3CS7A 3DFLA 4TWWA 4ABHA 1BOQA 1P2NA 2J95A 2OUAA 2FOHA 1ID5H 1C2MA 1O2XA 1QBNA 3GGEA 4XSKU 3RXAA 3L33A 2ZCKP 4LXBH 4JOKA 1GMDF 1H9IE 1XUHA 1DXPA 3HPMA 5H4IB 3VFEA 3C1KA 4ISLA 1GVLA 1UEPA 2I04A 3LJOA 2BD8A 3O8DA 3ZZBA 1BE9A 1UTLM 1QQ4A 3BV9B 2C8WB 3TK5A 1B0FA 3RM0H 1O2UA 5HXFA 4K75A 1THSH 3STJA 1O30A 3NXPA 2TPIZ 2QKTA 2LNCA 2BY7X 2EGKA 4K1EA 2ZU1A 2L4SA 4B71A 3V13A 1DWEH 1BBRH 1Y3YA 3RXKA 1EZSC 2NWNA 5L2YH 4IMQA 2VNTA 1JIRA 2ODYB 1NF3C 3S7KB 3F6UH 2ZPQA 1K2I1 1MU6B 1QB1A 1ZGVA 1PQ7A 1RRKA 5FAHA 1EOLA 1AZ8A 2WV5A 4VGCB 2YTWA 2WUCA 1YF4A 2ZPSA 3UR9A 4NFEA 1OPHB 4Y10E 1K1MA 3LT3A 5F03A 3MWIU 1BBRK 1C9PA 3AW1A 1UTMA 3GDVA 1GCTC 2AIPA 2TIOA 3GYLB 1GHWH