2D92A

Solution structure of the fifth pdz domain of inad-like protein
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDNTSLAEAVEILKAVPPGLVHLGICSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein
publication title Solution structure of the fifth PDZ domain of InaD-like protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2005-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2d92A00
2PZDA 3L4FD 2OSGA 1KWAA 1Z86A 3KHFA 1L6OA 5HEBA 2KYLA 3K1RA 3MH6A 3SOEA 1QLCA 4N6XA 1Y7NA 4JOKA 3GCNA 2CSJA 2DJTA 3I18A 4E34A 1WI4A 2WL7A 4HOPA 1VA8A 4JOHA 1OBYA 2JWEA 3SFJA 3DORA 2JIKA 4LMMA 1U3BA 4WYTA 1FCFA 3QDOA 2EGKA 2HE2A 2DLSA 2OPGA 1V1TA 2JOAA 1UITA 1LCYA 1X6DA 2QKUA 4P2AB 1QAUA 2X7ZA 5HFFA 1UFXA 2PNTA 2I0LA 3CBYA 1UM1A 1N7FA 2RRMA 3QJNA 2QG1A 2LC7A 4AMHA 1Q3PA 3GDUA 2VWRA 3DJ3A 3AXAA 1SOTA 1I92A 1UJUA 2OS6A 4K6YA 2M10A 1Q3OA 2AWXA 2DM8A 2H3MA 4Q2PA 2Z9IA 3CBZA 1N6FA 3ID4A 1UM7A 3EGHC 1WHDA 2Q3GA 5HFBA 2QKVA 2I6VA 2VSPA 1X5NA 2KV8A 1W9EA 4UU5A 3ID1A 1NTEA 2JILA 1K32A 2KOJA 2KG2A 1Y8TA 4OAJA 2M0VA 4G69A 4NNMA 5HFCA 2KJDA 3DJ1A 5H3JA 2DKRA 2FNEA 2Q9VA 2P3WA 5HF1A 5GLJA 4Q2NA 5HETA 1P1DA 3I1EA 1FC9A 1BE9A 2M3MA 3PV2A 5FHTA 2EGOA 1MFLA 1QAVB 3TSVA 2EEGA 1V5QA 2KQFA 2MHOA 2FE5A 1N7EA 2YUYA 1XZ9A 2VZ5A 3QE1A 1IU0A 3DJAA 4NMTA 2KPKA 5HFEA 4K76A 2EV8A 2W4FA 2JINA 4GHNA 1RGRA 3K82A 1IU2A 2M0ZA 2V90A 5D13A 2VSVA 2W7RA 4YDPA 1UEQA 5HFDA 4P0CA 2KL1A 4NXPA 1SOZA 3CYYA 4NXRA 1WIFA 1B8QA 2DB5A 2YTWA 3NFKA 2KOMA 3TMHA 3CH8A 2I0IA 2KPLA 4F8KA 5JXBA 1QAVA 1N7TA 3RLEA 5EZ0A 5G1DA 3O5NA 3PDZA 1WHAA 2EJYA 2Z17A 1X8SA 3K50A 2OQSA 4NNLA 1I16A 3DIWA 5I7ZA 2G2LA 3GSLA 4Z33A 5E1YA 5E6PB 2O2TA 3HPMA 3LNYA 3JXTA 4E35A 3HVQC 1RZXA 1T2MA 1IHJA 3LNXA 5F3XA 2IWOA 4JOEA 4H11A 2KA9A 4O06A 3SHWA 2DAZA 4EDJA 1U39A 5E21A 1WH1A 3ID2A 1OBZA 2KOHA 4Q6SA 2KRGA 1W9OA 2LUIA 1Q7XA 1V5LA 1V62A 3TSZA 3QGLA 3R69A 2L4SA 1VCWA 2D90A 4NMRA 1D5GA 2E7KA 2FN5A 3E17A 1TP3A 2EEHA 2YT7A 3HPKA 2R3YA 2QT5A 3B76A 4PQWA 3PV4A 2DC2A 2AWUA 2I4SA 4REYA 4K72A 1NF3C 2KAWA 3GDVA 1VJ6A 1BFEA 1OZIA 1WG6A 5GNDA 4JOPA 2ZPLA 1WFVA 3MH4A 4JL7A 5F67A 2EHRA 3WKMA 1N6EA 2F5YA 3R68A 1KY9A 3I4WA 5HDYA 1UJVA 4R2ZA 1UJDA 5G1EA 2EAQA 2ENOA 5HEDA 3SUZA 1TE0A 4JOFA 4RI0A 1UF1A 2LOBA 1X45A 3RL8A 2H3LA 1Z87A 3TSWA 2KJKA 1GQ5A 1X5RA 1VB7A 2IWQA 4KFWA 2EXGA 2EDZA 1N6DA 2V1WA 4JOGA 2PDZA 1UEPA 4IC6A 2K1ZA 1G9OA 3ZRTA 1MC7A 2KJPA 4JORA 2OMJA 1W9QA 1PDRA 2R4HA 2M0TA 3CC0A 1U37A 1WI2A 3O46A 1X5QA 2YT8A 4JOJA 4K75A 2L4TA 2M0UA 2REYA 1TP5A 3STJA 3ID3A 2OZFA 2OCSA 4K78A 2QKTA 3CBXA 4NMPA 1RY4A 5HF4A 3FY5A 3KZEA 2L97A 2H2BA 2F0AA 3GGEA 2BYGA 4NMQA 2I04A 1RGWA 2LC6A 2DLUA 1UHPA 4Z8JA 3QJMA 2IWPA 2UZCA 1WF8A 2PKUA 3OU0A 5A2PA 5E22A 2FCFA 1FC6A 3MH7A 1P1EA 4NMSA 1WF7A 2EEJA 2CS5A 3SHUA 4UU6A 2ZPMA 2QBWA 3VQGA 2EDVA 2LA8A 2VPHA 2YUBA 2D92A 4MPAA 1GM1A 4L8NA 1GQ4A 4E3BA 3GJ9A 5HEYA 5E11A 2GZVA 3QO6A 2VRFA 1WJLA 4WYUA 1OBXA 3OTPA 3QIKA 2EGNA 2JXOA 2CSSA 3PS4A 2H2CA 2MX6A 4OEPA 1ZOKA 2DMZA 4OEOA 4Q6HA 5DTHA 1ZUBA 3GDSA 2PKTA 1R6JA 2HGAA 4XHVA 4NMOA 2K20A 2KBSA 4FGMA 3BPUA 5HJ1A 1FC7A 1N99A 1YBOA 2RCZA 3EGGC 4GVCA 5FB8C 1V6BA 4Q3HA 1WFGA 5B6LA 2D8IA 2PA1A 1MFGA 2AINA 3PV5A 3CS0A 4YYXA 4Q2QA 3RL7A 2G5MB 2EEIA 3NGHA 3VQFA 4Q2OA 2IWNA 4HOPB 1UEZA 3WKLA 2HE4A 1VAEA 2AWWA 1TQ3A 4GVDA 3R0HA 3NFLA 2JREA 3PDVA 4NXQA 4KFVA 1M5ZA 3GCOA 1U38A 4NMVA 2I1NA 3KZDA 5EYZA 2EDPA 1KEFA 2OGPA 1UEWA
chains in the Genus database with same CATH superfamily
2PZDA 3L4FD 2OSGA 1KWAA 1Z86A 3KHFA 1L6OA 5HEBA 2KYLA 3K1RA 3MH6A 3SOEA 1QLCA 4N6XA 1Y7NA 4JOKA 3GCNA 2CSJA 2DJTA 3I18A 4E34A 1WI4A 2WL7A 4HOPA 1VA8A 4JOHA 1OBYA 2JWEA 3SFJA 3DORA 2JIKA 4LMMA 1U3BA 4WYTA 1FCFA 4FLNA 3QDOA 2EGKA 2HE2A 2DLSA 2OPGA 1V1TA 2JOAA 1UITA 1LCYA 1X6DA 2QKUA 4P2AB 1QAUA 2X7ZA 5HFFA 1UFXA 2PNTA 2I0LA 3CBYA 1UM1A 1N7FA 2RRMA 3QJNA 2QG1A 2LC7A 4AMHA 1Q3PA 3GDUA 2VWRA 3DJ3A 3AXAA 1SOTA 1I92A 1UJUA 2OS6A 4K6YA 2M10A 1Q3OA 2AWXA 2DM8A 2H3MA 4Q2PA 2Z9IA 3CBZA 1N6FA 3ID4A 1UM7A 3EGHC 1WHDA 2Q3GA 5HFBA 2QKVA 2I6VA 2VSPA 5IL9A 1X5NA 2KV8A 1W9EA 4UU5A 3ID1A 1NTEA 2JILA 1K32A 2KOJA 2KG2A 1Y8TA 4OAJA 2M0VA 4G69A 4NNMA 5HFCA 2KJDA 3DJ1A 5H3JA 2DKRA 2FNEA 2Q9VA 2P3WA 5HF1A 5GLJA 4Q2NA 5HETA 1P1DA 3I1EA 1FC9A 1BE9A 2M3MA 3PV2A 5FHTA 2EGOA 1MFLA 1QAVB 3TSVA 2EEGA 1V5QA 2KQFA 2MHOA 2FE5A 1N7EA 2YUYA 1XZ9A 2VZ5A 3QE1A 1IU0A 3DJAA 4NMTA 2KPKA 5HFEA 4K76A 2EV8A 2W4FA 2JINA 4GHNA 1RGRA 3K82A 1IU2A 2M0ZA 2V90A 5D13A 2VSVA 2W7RA 4YDPA 1UEQA 5HFDA 4P0CA 2KL1A 4NXPA 1SOZA 3CYYA 4NXRA 1WIFA 1B8QA 2DB5A 2YTWA 3NFKA 2KOMA 3TMHA 3CH8A 2I0IA 2KPLA 4F8KA 5JXBA 1QAVA 1N7TA 3RLEA 5EZ0A 5G1DA 3O5NA 3PDZA 1WHAA 2EJYA 2Z17A 1X8SA 3K50A 2OQSA 4NNLA 1I16A 3DIWA 5I7ZA 2G2LA 3GSLA 4Z33A 5E1YA 5E6PB 2O2TA 3HPMA 3LNYA 3JXTA 4E35A 3HVQC 1RZXA 1T2MA 1IHJA 3LNXA 5F3XA 2IWOA 4JOEA 4H11A 2KA9A 4O06A 3SHWA 2DAZA 4EDJA 1U39A 5E21A 1WH1A 3ID2A 1OBZA 2KOHA 4Q6SA 2KRGA 1W9OA 2LUIA 1Q7XA 1V5LA 1V62A 3TSZA 3QGLA 3R69A 2L4SA 1VCWA 2D90A 4NMRA 1D5GA 2E7KA 2FN5A 3E17A 1TP3A 2EEHA 2YT7A 3HPKA 2R3YA 2QT5A 3B76A 4PQWA 3PV4A 2DC2A 2AWUA 2I4SA 4REYA 3KDKA 4K72A 1NF3C 2KAWA 3GDVA 1VJ6A 1BFEA 1OZIA 1WG6A 5GNDA 4JOPA 5ILBA 2ZPLA 1WFVA 3MH4A 4JL7A 5F67A 2EHRA 3WKMA 2GEFA 1N6EA 2F5YA 3R68A 1KY9A 2JSNA 3I4WA 5HDYA 1UJVA 4R2ZA 1UJDA 5G1EA 2EAQA 2ENOA 5HEDA 3SUZA 1TE0A 4JOFA 4RI0A 1UF1A 2LOBA 3NCVA 1X45A 3RL8A 2H3LA 1Z87A 3TSWA 2KJKA 1GQ5A 1X5RA 1VB7A 2IWQA 4KFWA 2EXGA 2EDZA 1N6DA 2V1WA 4JOGA 2PDZA 1UEPA 4IC6A 2K1ZA 1G9OA 3ZRTA 1MC7A 2KJPA 4JORA 2OMJA 1W9QA 1PDRA 2R4HA 2M0TA 3CC0A 1U37A 1WI2A 3O46A 1X5QA 2YT8A 4JOJA 4K75A 2L4TA 2M0UA 2REYA 1TP5A 3STJA 3ID3A 2OZFA 2OCSA 4K78A 2QKTA 3CBXA 4NMPA 1RY4A 5HF4A 3FY5A 3KZEA 2L97A 2H2BA 2F0AA 3GGEA 2BYGA 4NMQA 2I04A 1RGWA 2LC6A 2DLUA 1UHPA 4Z8JA 3QJMA 2IWPA 2UZCA 1WF8A 2PKUA 3OU0A 5A2PA 5E22A 3KDGA 3GABA 2FCFA 1FC6A 3MH7A 1P1EA 4NMSA 1WF7A 2EEJA 2CS5A 3SHUA 4UU6A 2ZPMA 2QBWA 3VQGA 2EDVA 2LA8A 2VPHA 2YUBA 2D92A 4MPAA 1GM1A 4L8NA 1GQ4A 4E3BA 3GJ9A 5HEYA 5E11A 2GZVA 3QO6A 2VRFA 1WJLA 4WYUA 1OBXA 3OTPA 3QIKA 2EGNA 2JXOA 2CSSA 3PS4A 2H2CA 2MX6A 4OEPA 1ZOKA 2DMZA 4OEOA 4Q6HA 5DTHA 1ZUBA 3GDSA 2PKTA 1R6JA 2HGAA 4XHVA 5B42A 4NMOA 2K20A 2KBSA 4FGMA 3BPUA 5HJ1A 1FC7A 1N99A 1YBOA 2RCZA 3EGGC 4GVCA 5FB8C 1V6BA 4Q3HA 1WFGA 5B6LA 2D8IA 2PA1A 1MFGA 2AINA 3PV5A 3CS0A 4YYXA 4Q2QA 3RL7A 2G5MB 2EEIA 3NGHA 3VQFA 4Q2OA 2IWNA 4HOPB 1UEZA 3WKLA 2HE4A 1VAEA 2AWWA 1TQ3A 4GVDA 3R0HA 3NFLA 2JREA 4JJ3A 3PDVA 4NXQA 4KFVA 1M5ZA 3GCOA 1U38A 4NMVA 1X9ZA 2I1NA 3KZDA 5EYZA 2EDPA 1KEFA 2OGPA 4JJ0A 1UEWA
chains in the Genus database with same CATH topology
2PZDA 3L4FD 2OSGA 1KWAA 1Z86A 3KHFA 1L6OA 5HEBA 2KYLA 3K1RA 3MH6A 3SOEA 1QLCA 4N6XA 1Y7NA 4JOKA 3GCNA 2CSJA 2DJTA 3I18A 4E34A 1WI4A 2WL7A 4HOPA 1VA8A 4JOHA 1OBYA 2JWEA 3SFJA 3DORA 2JIKA 4LMMA 1U3BA 4WYTA 1FCFA 4FLNA 3QDOA 2EGKA 2HE2A 2DLSA 2OPGA 1V1TA 2JOAA 1UITA 1LCYA 1X6DA 2QKUA 4P2AB 1QAUA 2X7ZA 5HFFA 1UFXA 2PNTA 2I0LA 3CBYA 1UM1A 1N7FA 2RRMA 3QJNA 2QG1A 2LC7A 4AMHA 1Q3PA 3GDUA 2VWRA 3DJ3A 3AXAA 1SOTA 1I92A 1UJUA 2OS6A 4K6YA 2M10A 1Q3OA 2AWXA 2DM8A 2H3MA 4Q2PA 2Z9IA 3CBZA 1N6FA 3ID4A 1UM7A 3EGHC 1WHDA 2Q3GA 5HFBA 2QKVA 2I6VA 2VSPA 5IL9A 1X5NA 2KV8A 1W9EA 4UU5A 3ID1A 1NTEA 2JILA 1K32A 2KOJA 2KG2A 1Y8TA 4OAJA 2M0VA 4G69A 4NNMA 5HFCA 2KJDA 3DJ1A 5H3JA 2DKRA 2FNEA 2Q9VA 2P3WA 5HF1A 5GLJA 4Q2NA 5HETA 1P1DA 3I1EA 1FC9A 1BE9A 2M3MA 3PV2A 5FHTA 2EGOA 1MFLA 1QAVB 3TSVA 2EEGA 1V5QA 2KQFA 2MHOA 2FE5A 1N7EA 2YUYA 1XZ9A 2VZ5A 3QE1A 1IU0A 3DJAA 4NMTA 2KPKA 5HFEA 4K76A 2EV8A 2W4FA 2JINA 4GHNA 1RGRA 3K82A 1IU2A 2M0ZA 2V90A 5D13A 2VSVA 2W7RA 4YDPA 1UEQA 5HFDA 4P0CA 2KL1A 4NXPA 1SOZA 3CYYA 4NXRA 1WIFA 1B8QA 2DB5A 2YTWA 3NFKA 2KOMA 3TMHA 3CH8A 2I0IA 2KPLA 4F8KA 5JXBA 1QAVA 1N7TA 3RLEA 5EZ0A 5G1DA 3O5NA 3PDZA 1WHAA 2EJYA 2Z17A 1X8SA 3K50A 2OQSA 4NNLA 1I16A 3DIWA 5I7ZA 2G2LA 3GSLA 4Z33A 5E1YA 5E6PB 2O2TA 3HPMA 3LNYA 3JXTA 4E35A 3HVQC 1RZXA 1T2MA 1IHJA 3LNXA 5F3XA 2IWOA 4JOEA 4H11A 2KA9A 4O06A 3SHWA 2DAZA 4EDJA 1U39A 5E21A 1WH1A 3ID2A 1OBZA 2KOHA 4Q6SA 2KRGA 1W9OA 2LUIA 1Q7XA 1V5LA 1V62A 3TSZA 3QGLA 3R69A 2L4SA 1VCWA 2D90A 4NMRA 1D5GA 2E7KA 2FN5A 3E17A 1TP3A 2EEHA 2YT7A 3HPKA 2R3YA 2QT5A 3B76A 4PQWA 3PV4A 2DC2A 2AWUA 2I4SA 4REYA 3KDKA 4K72A 1NF3C 2KAWA 3GDVA 1VJ6A 1BFEA 1OZIA 1WG6A 5GNDA 4JOPA 5ILBA 2ZPLA 1WFVA 3MH4A 4JL7A 5F67A 2EHRA 3WKMA 2GEFA 1N6EA 2F5YA 3R68A 1KY9A 2JSNA 3I4WA 5HDYA 1UJVA 4R2ZA 1UJDA 5G1EA 2EAQA 2ENOA 5HEDA 3SUZA 1TE0A 4JOFA 4RI0A 1UF1A 2LOBA 3NCVA 1X45A 3RL8A 2H3LA 1Z87A 3TSWA 2KJKA 1GQ5A 1X5RA 1VB7A 2IWQA 4KFWA 2EXGA 2EDZA 1N6DA 2V1WA 4JOGA 2PDZA 1UEPA 4IC6A 2K1ZA 1G9OA 3ZRTA 1MC7A 2KJPA 4JORA 2OMJA 1W9QA 1PDRA 2R4HA 2M0TA 3CC0A 1U37A 1WI2A 3O46A 1X5QA 2YT8A 4JOJA 4K75A 2L4TA 2M0UA 2REYA 1TP5A 3STJA 3ID3A 2OZFA 2OCSA 4K78A 2QKTA 3CBXA 4NMPA 1RY4A 5HF4A 3FY5A 3KZEA 2L97A 2H2BA 2F0AA 3GGEA 2BYGA 4NMQA 2I04A 1RGWA 2LC6A 2DLUA 1UHPA 4Z8JA 3QJMA 2IWPA 2UZCA 1WF8A 2PKUA 3OU0A 5A2PA 5E22A 3KDGA 3GABA 2FCFA 1FC6A 3MH7A 1P1EA 4NMSA 1WF7A 2EEJA 2CS5A 3SHUA 4UU6A 2ZPMA 2QBWA 3VQGA 2EDVA 2LA8A 2VPHA 2YUBA 2D92A 4MPAA 1GM1A 4L8NA 1GQ4A 4E3BA 3GJ9A 5HEYA 5E11A 2GZVA 3QO6A 2VRFA 1WJLA 4WYUA 1OBXA 3OTPA 3QIKA 2EGNA 2JXOA 2CSSA 3PS4A 2H2CA 2MX6A 4OEPA 1ZOKA 2DMZA 4OEOA 4Q6HA 5DTHA 1ZUBA 3GDSA 2PKTA 1R6JA 2HGAA 4XHVA 5B42A 4NMOA 2K20A 2KBSA 4FGMA 3BPUA 5HJ1A 1FC7A 1N99A 1YBOA 2RCZA 3EGGC 4GVCA 5FB8C 1V6BA 4Q3HA 1WFGA 5B6LA 2D8IA 2PA1A 1MFGA 2AINA 3PV5A 3CS0A 4YYXA 4Q2QA 3RL7A 2G5MB 2EEIA 3NGHA 3VQFA 4Q2OA 2IWNA 4HOPB 1UEZA 3WKLA 2HE4A 1VAEA 2AWWA 1TQ3A 4GVDA 3R0HA 3NFLA 2JREA 4JJ3A 3PDVA 4NXQA 4KFVA 1M5ZA 3GCOA 1U38A 4NMVA 1X9ZA 2I1NA 3KZDA 5EYZA 2EDPA 1KEFA 2OGPA 4JJ0A 1UEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZD A;  3L4F D;  2OSG A;  1KWA A;  1Z86 A;  3KHF A;  1L6O A;  5HEB A;  2KYL A;  3K1R A;  3MH6 A;  3SOE A;  1QLC A;  4N6X A;  1Y7N A;  4JOK A;  3GCN A;  2CSJ A;  2DJT A;  3I18 A;  4E34 A;  1WI4 A;  2WL7 A;  4HOP A;  1VA8 A;  4JOH A;  1OBY A;  2JWE A;  3SFJ A;  3DOR A;  2JIK A;  4LMM A;  1U3B A;  4WYT A;  1FCF A;  3QDO A;  2EGK A;  2HE2 A;  2DLS A;  2OPG A;  1V1T A;  2JOA A;  1UIT A;  1LCY A;  1X6D A;  2QKU A;  4P2A B;  1QAU A;  2X7Z A;  5HFF A;  1UFX A;  2PNT A;  2I0L A;  3CBY A;  1UM1 A;  1N7F A;  2RRM A;  3QJN A;  2QG1 A;  2LC7 A;  4AMH A;  1Q3P A;  3GDU A;  2VWR A;  3DJ3 A;  3AXA A;  1SOT A;  1I92 A;  1UJU A;  2OS6 A;  4K6Y A;  2M10 A;  1Q3O A;  2AWX A;  2DM8 A;  2H3M A;  4Q2P A;  2Z9I A;  3CBZ A;  1N6F A;  3ID4 A;  1UM7 A;  3EGH C;  1WHD A;  2Q3G A;  5HFB A;  2QKV A;  2I6V A;  2VSP A;  1X5N A;  2KV8 A;  1W9E A;  4UU5 A;  3ID1 A;  1NTE A;  2JIL A;  1K32 A;  2KOJ A;  2KG2 A;  1Y8T A;  4OAJ A;  2M0V A;  4G69 A;  4NNM A;  5HFC A;  2KJD A;  3DJ1 A;  5H3J A;  2DKR A;  2FNE A;  2Q9V A;  2P3W A;  5HF1 A;  5GLJ A;  4Q2N A;  5HET A;  1P1D A;  3I1E A;  1FC9 A;  1BE9 A;  2M3M A;  3PV2 A;  5FHT A;  2EGO A;  1MFL A;  1QAV B;  3TSV A;  2EEG A;  1V5Q A;  2KQF A;  2MHO A;  2FE5 A;  1N7E A;  2YUY A;  1XZ9 A;  2VZ5 A;  3QE1 A;  1IU0 A;  3DJA A;  4NMT A;  2KPK A;  5HFE A;  4K76 A;  2EV8 A;  2W4F A;  2JIN A;  4GHN A;  1RGR A;  3K82 A;  1IU2 A;  2M0Z A;  2V90 A;  5D13 A;  2VSV A;  2W7R A;  4YDP A;  1UEQ A;  5HFD A;  4P0C A;  2KL1 A;  4NXP A;  1SOZ A;  3CYY A;  4NXR A;  1WIF A;  1B8Q A;  2DB5 A;  2YTW A;  3NFK A;  2KOM A;  3TMH A;  3CH8 A;  2I0I A;  2KPL A;  4F8K A;  5JXB A;  1QAV A;  1N7T A;  3RLE A;  5EZ0 A;  5G1D A;  3O5N A;  3PDZ A;  1WHA A;  2EJY A;  2Z17 A;  1X8S A;  3K50 A;  2OQS A;  4NNL A;  1I16 A;  3DIW A;  5I7Z A;  2G2L A;  3GSL A;  4Z33 A;  5E1Y A;  5E6P B;  2O2T A;  3HPM A;  3LNY A;  3JXT A;  4E35 A;  3HVQ C;  1RZX A;  1T2M A;  1IHJ A;  3LNX A;  5F3X A;  2IWO A;  4JOE A;  4H11 A;  2KA9 A;  4O06 A;  3SHW A;  2DAZ A;  4EDJ A;  1U39 A;  5E21 A;  1WH1 A;  3ID2 A;  1OBZ A;  2KOH A;  4Q6S A;  2KRG A;  1W9O A;  2LUI A;  1Q7X A;  1V5L A;  1V62 A;  3TSZ A;  3QGL A;  3R69 A;  2L4S A;  1VCW A;  2D90 A;  4NMR A;  1D5G A;  2E7K A;  2FN5 A;  3E17 A;  1TP3 A;  2EEH A;  2YT7 A;  3HPK A;  2R3Y A;  2QT5 A;  3B76 A;  4PQW A;  3PV4 A;  2DC2 A;  2AWU A;  2I4S A;  4REY A;  4K72 A;  1NF3 C;  2KAW A;  3GDV A;  1VJ6 A;  1BFE A;  1OZI A;  1WG6 A;  5GND A;  4JOP A;  2ZPL A;  1WFV A;  3MH4 A;  4JL7 A;  5F67 A;  2EHR A;  3WKM A;  1N6E A;  2F5Y A;  3R68 A;  1KY9 A;  3I4W A;  5HDY A;  1UJV A;  4R2Z A;  1UJD A;  5G1E A;  2EAQ A;  2ENO A;  5HED A;  3SUZ A;  1TE0 A;  4JOF A;  4RI0 A;  1UF1 A;  2LOB A;  1X45 A;  3RL8 A;  2H3L A;  1Z87 A;  3TSW A;  2KJK A;  1GQ5 A;  1X5R A;  1VB7 A;  2IWQ A;  4KFW A;  2EXG A;  2EDZ A;  1N6D A;  2V1W A;  4JOG A;  2PDZ A;  1UEP A;  4IC6 A;  2K1Z A;  1G9O A;  3ZRT A;  1MC7 A;  2KJP A;  4JOR A;  2OMJ A;  1W9Q A;  1PDR A;  2R4H A;  2M0T A;  3CC0 A;  1U37 A;  1WI2 A;  3O46 A;  1X5Q A;  2YT8 A;  4JOJ A;  4K75 A;  2L4T A;  2M0U A;  2REY A;  1TP5 A;  3STJ A;  3ID3 A;  2OZF A;  2OCS A;  4K78 A;  2QKT A;  3CBX A;  4NMP A;  1RY4 A;  5HF4 A;  3FY5 A;  3KZE A;  2L97 A;  2H2B A;  2F0A A;  3GGE A;  2BYG A;  4NMQ A;  2I04 A;  1RGW A;  2LC6 A;  2DLU A;  1UHP A;  4Z8J A;  3QJM A;  2IWP A;  2UZC A;  1WF8 A;  2PKU A;  3OU0 A;  5A2P A;  5E22 A;  2FCF A;  1FC6 A;  3MH7 A;  1P1E A;  4NMS A;  1WF7 A;  2EEJ A;  2CS5 A;  3SHU A;  4UU6 A;  2ZPM A;  2QBW A;  3VQG A;  2EDV A;  2LA8 A;  2VPH A;  2YUB A;  2D92 A;  4MPA A;  1GM1 A;  4L8N A;  1GQ4 A;  4E3B A;  3GJ9 A;  5HEY A;  5E11 A;  2GZV A;  3QO6 A;  2VRF A;  1WJL A;  4WYU A;  1OBX A;  3OTP A;  3QIK A;  2EGN A;  2JXO A;  2CSS A;  3PS4 A;  2H2C A;  2MX6 A;  4OEP A;  1ZOK A;  2DMZ A;  4OEO A;  4Q6H A;  5DTH A;  1ZUB A;  3GDS A;  2PKT A;  1R6J A;  2HGA A;  4XHV A;  4NMO A;  2K20 A;  2KBS A;  4FGM A;  3BPU A;  5HJ1 A;  1FC7 A;  1N99 A;  1YBO A;  2RCZ A;  3EGG C;  4GVC A;  5FB8 C;  1V6B A;  4Q3H A;  1WFG A;  5B6L A;  2D8I A;  2PA1 A;  1MFG A;  2AIN A;  3PV5 A;  3CS0 A;  4YYX A;  4Q2Q A;  3RL7 A;  2G5M B;  2EEI A;  3NGH A;  3VQF A;  4Q2O A;  2IWN A;  4HOP B;  1UEZ A;  3WKL A;  2HE4 A;  1VAE A;  2AWW A;  1TQ3 A;  4GVD A;  3R0H A;  3NFL A;  2JRE A;  3PDV A;  4NXQ A;  4KFV A;  1M5Z A;  3GCO A;  1U38 A;  4NMV A;  2I1N A;  3KZD A;  5EYZ A;  2EDP A;  1KEF A;  2OGP A;  1UEW A; 
#chains in the Genus database with same CATH topology
 2PZD A;  3L4F D;  2OSG A;  1KWA A;  1Z86 A;  3KHF A;  1L6O A;  5HEB A;  2KYL A;  3K1R A;  3MH6 A;  3SOE A;  1QLC A;  4N6X A;  1Y7N A;  4JOK A;  3GCN A;  2CSJ A;  2DJT A;  3I18 A;  4E34 A;  1WI4 A;  2WL7 A;  4HOP A;  1VA8 A;  4JOH A;  1OBY A;  2JWE A;  3SFJ A;  3DOR A;  2JIK A;  4LMM A;  1U3B A;  4WYT A;  1FCF A;  4FLN A;  3QDO A;  2EGK A;  2HE2 A;  2DLS A;  2OPG A;  1V1T A;  2JOA A;  1UIT A;  1LCY A;  1X6D A;  2QKU A;  4P2A B;  1QAU A;  2X7Z A;  5HFF A;  1UFX A;  2PNT A;  2I0L A;  3CBY A;  1UM1 A;  1N7F A;  2RRM A;  3QJN A;  2QG1 A;  2LC7 A;  4AMH A;  1Q3P A;  3GDU A;  2VWR A;  3DJ3 A;  3AXA A;  1SOT A;  1I92 A;  1UJU A;  2OS6 A;  4K6Y A;  2M10 A;  1Q3O A;  2AWX A;  2DM8 A;  2H3M A;  4Q2P A;  2Z9I A;  3CBZ A;  1N6F A;  3ID4 A;  1UM7 A;  3EGH C;  1WHD A;  2Q3G A;  5HFB A;  2QKV A;  2I6V A;  2VSP A;  5IL9 A;  1X5N A;  2KV8 A;  1W9E A;  4UU5 A;  3ID1 A;  1NTE A;  2JIL A;  1K32 A;  2KOJ A;  2KG2 A;  1Y8T A;  4OAJ A;  2M0V A;  4G69 A;  4NNM A;  5HFC A;  2KJD A;  3DJ1 A;  5H3J A;  2DKR A;  2FNE A;  2Q9V A;  2P3W A;  5HF1 A;  5GLJ A;  4Q2N A;  5HET A;  1P1D A;  3I1E A;  1FC9 A;  1BE9 A;  2M3M A;  3PV2 A;  5FHT A;  2EGO A;  1MFL A;  1QAV B;  3TSV A;  2EEG A;  1V5Q A;  2KQF A;  2MHO A;  2FE5 A;  1N7E A;  2YUY A;  1XZ9 A;  2VZ5 A;  3QE1 A;  1IU0 A;  3DJA A;  4NMT A;  2KPK A;  5HFE A;  4K76 A;  2EV8 A;  2W4F A;  2JIN A;  4GHN A;  1RGR A;  3K82 A;  1IU2 A;  2M0Z A;  2V90 A;  5D13 A;  2VSV A;  2W7R A;  4YDP A;  1UEQ A;  5HFD A;  4P0C A;  2KL1 A;  4NXP A;  1SOZ A;  3CYY A;  4NXR A;  1WIF A;  1B8Q A;  2DB5 A;  2YTW A;  3NFK A;  2KOM A;  3TMH A;  3CH8 A;  2I0I A;  2KPL A;  4F8K A;  5JXB A;  1QAV A;  1N7T A;  3RLE A;  5EZ0 A;  5G1D A;  3O5N A;  3PDZ A;  1WHA A;  2EJY A;  2Z17 A;  1X8S A;  3K50 A;  2OQS A;  4NNL A;  1I16 A;  3DIW A;  5I7Z A;  2G2L A;  3GSL A;  4Z33 A;  5E1Y A;  5E6P B;  2O2T A;  3HPM A;  3LNY A;  3JXT A;  4E35 A;  3HVQ C;  1RZX A;  1T2M A;  1IHJ A;  3LNX A;  5F3X A;  2IWO A;  4JOE A;  4H11 A;  2KA9 A;  4O06 A;  3SHW A;  2DAZ A;  4EDJ A;  1U39 A;  5E21 A;  1WH1 A;  3ID2 A;  1OBZ A;  2KOH A;  4Q6S A;  2KRG A;  1W9O A;  2LUI A;  1Q7X A;  1V5L A;  1V62 A;  3TSZ A;  3QGL A;  3R69 A;  2L4S A;  1VCW A;  2D90 A;  4NMR A;  1D5G A;  2E7K A;  2FN5 A;  3E17 A;  1TP3 A;  2EEH A;  2YT7 A;  3HPK A;  2R3Y A;  2QT5 A;  3B76 A;  4PQW A;  3PV4 A;  2DC2 A;  2AWU A;  2I4S A;  4REY A;  3KDK A;  4K72 A;  1NF3 C;  2KAW A;  3GDV A;  1VJ6 A;  1BFE A;  1OZI A;  1WG6 A;  5GND A;  4JOP A;  5ILB A;  2ZPL A;  1WFV A;  3MH4 A;  4JL7 A;  5F67 A;  2EHR A;  3WKM A;  2GEF A;  1N6E A;  2F5Y A;  3R68 A;  1KY9 A;  2JSN A;  3I4W A;  5HDY A;  1UJV A;  4R2Z A;  1UJD A;  5G1E A;  2EAQ A;  2ENO A;  5HED A;  3SUZ A;  1TE0 A;  4JOF A;  4RI0 A;  1UF1 A;  2LOB A;  3NCV A;  1X45 A;  3RL8 A;  2H3L A;  1Z87 A;  3TSW A;  2KJK A;  1GQ5 A;  1X5R A;  1VB7 A;  2IWQ A;  4KFW A;  2EXG A;  2EDZ A;  1N6D A;  2V1W A;  4JOG A;  2PDZ A;  1UEP A;  4IC6 A;  2K1Z A;  1G9O A;  3ZRT A;  1MC7 A;  2KJP A;  4JOR A;  2OMJ A;  1W9Q A;  1PDR A;  2R4H A;  2M0T A;  3CC0 A;  1U37 A;  1WI2 A;  3O46 A;  1X5Q A;  2YT8 A;  4JOJ A;  4K75 A;  2L4T A;  2M0U A;  2REY A;  1TP5 A;  3STJ A;  3ID3 A;  2OZF A;  2OCS A;  4K78 A;  2QKT A;  3CBX A;  4NMP A;  1RY4 A;  5HF4 A;  3FY5 A;  3KZE A;  2L97 A;  2H2B A;  2F0A A;  3GGE A;  2BYG A;  4NMQ A;  2I04 A;  1RGW A;  2LC6 A;  2DLU A;  1UHP A;  4Z8J A;  3QJM A;  2IWP A;  2UZC A;  1WF8 A;  2PKU A;  3OU0 A;  5A2P A;  5E22 A;  3KDG A;  3GAB A;  2FCF A;  1FC6 A;  3MH7 A;  1P1E A;  4NMS A;  1WF7 A;  2EEJ A;  2CS5 A;  3SHU A;  4UU6 A;  2ZPM A;  2QBW A;  3VQG A;  2EDV A;  2LA8 A;  2VPH A;  2YUB A;  2D92 A;  4MPA A;  1GM1 A;  4L8N A;  1GQ4 A;  4E3B A;  3GJ9 A;  5HEY A;  5E11 A;  2GZV A;  3QO6 A;  2VRF A;  1WJL A;  4WYU A;  1OBX A;  3OTP A;  3QIK A;  2EGN A;  2JXO A;  2CSS A;  3PS4 A;  2H2C A;  2MX6 A;  4OEP A;  1ZOK A;  2DMZ A;  4OEO A;  4Q6H A;  5DTH A;  1ZUB A;  3GDS A;  2PKT A;  1R6J A;  2HGA A;  4XHV A;  5B42 A;  4NMO A;  2K20 A;  2KBS A;  4FGM A;  3BPU A;  5HJ1 A;  1FC7 A;  1N99 A;  1YBO A;  2RCZ A;  3EGG C;  4GVC A;  5FB8 C;  1V6B A;  4Q3H A;  1WFG A;  5B6L A;  2D8I A;  2PA1 A;  1MFG A;  2AIN A;  3PV5 A;  3CS0 A;  4YYX A;  4Q2Q A;  3RL7 A;  2G5M B;  2EEI A;  3NGH A;  3VQF A;  4Q2O A;  2IWN A;  4HOP B;  1UEZ A;  3WKL A;  2HE4 A;  1VAE A;  2AWW A;  1TQ3 A;  4GVD A;  3R0H A;  3NFL A;  2JRE A;  4JJ3 A;  3PDV A;  4NXQ A;  4KFV A;  1M5Z A;  3GCO A;  1U38 A;  4NMV A;  1X9Z A;  2I1N A;  3KZD A;  5EYZ A;  2EDP A;  1KEF A;  2OGP A;  4JJ0 A;  1UEW A; 
#chains in the Genus database with same CATH homology
 2PZD A;  3L4F D;  2OSG A;  1KWA A;  1Z86 A;  3KHF A;  1L6O A;  5HEB A;  2KYL A;  3K1R A;  3MH6 A;  3SOE A;  1QLC A;  4N6X A;  1Y7N A;  4JOK A;  3GCN A;  2CSJ A;  2DJT A;  3I18 A;  4E34 A;  1WI4 A;  2WL7 A;  4HOP A;  1VA8 A;  4JOH A;  1OBY A;  2JWE A;  3SFJ A;  3DOR A;  2JIK A;  4LMM A;  1U3B A;  4WYT A;  1FCF A;  4FLN A;  3QDO A;  2EGK A;  2HE2 A;  2DLS A;  2OPG A;  1V1T A;  2JOA A;  1UIT A;  1LCY A;  1X6D A;  2QKU A;  4P2A B;  1QAU A;  2X7Z A;  5HFF A;  1UFX A;  2PNT A;  2I0L A;  3CBY A;  1UM1 A;  1N7F A;  2RRM A;  3QJN A;  2QG1 A;  2LC7 A;  4AMH A;  1Q3P A;  3GDU A;  2VWR A;  3DJ3 A;  3AXA A;  1SOT A;  1I92 A;  1UJU A;  2OS6 A;  4K6Y A;  2M10 A;  1Q3O A;  2AWX A;  2DM8 A;  2H3M A;  4Q2P A;  2Z9I A;  3CBZ A;  1N6F A;  3ID4 A;  1UM7 A;  3EGH C;  1WHD A;  2Q3G A;  5HFB A;  2QKV A;  2I6V A;  2VSP A;  5IL9 A;  1X5N A;  2KV8 A;  1W9E A;  4UU5 A;  3ID1 A;  1NTE A;  2JIL A;  1K32 A;  2KOJ A;  2KG2 A;  1Y8T A;  4OAJ A;  2M0V A;  4G69 A;  4NNM A;  5HFC A;  2KJD A;  3DJ1 A;  5H3J A;  2DKR A;  2FNE A;  2Q9V A;  2P3W A;  5HF1 A;  5GLJ A;  4Q2N A;  5HET A;  1P1D A;  3I1E A;  1FC9 A;  1BE9 A;  2M3M A;  3PV2 A;  5FHT A;  2EGO A;  1MFL A;  1QAV B;  3TSV A;  2EEG A;  1V5Q A;  2KQF A;  2MHO A;  2FE5 A;  1N7E A;  2YUY A;  1XZ9 A;  2VZ5 A;  3QE1 A;  1IU0 A;  3DJA A;  4NMT A;  2KPK A;  5HFE A;  4K76 A;  2EV8 A;  2W4F A;  2JIN A;  4GHN A;  1RGR A;  3K82 A;  1IU2 A;  2M0Z A;  2V90 A;  5D13 A;  2VSV A;  2W7R A;  4YDP A;  1UEQ A;  5HFD A;  4P0C A;  2KL1 A;  4NXP A;  1SOZ A;  3CYY A;  4NXR A;  1WIF A;  1B8Q A;  2DB5 A;  2YTW A;  3NFK A;  2KOM A;  3TMH A;  3CH8 A;  2I0I A;  2KPL A;  4F8K A;  5JXB A;  1QAV A;  1N7T A;  3RLE A;  5EZ0 A;  5G1D A;  3O5N A;  3PDZ A;  1WHA A;  2EJY A;  2Z17 A;  1X8S A;  3K50 A;  2OQS A;  4NNL A;  1I16 A;  3DIW A;  5I7Z A;  2G2L A;  3GSL A;  4Z33 A;  5E1Y A;  5E6P B;  2O2T A;  3HPM A;  3LNY A;  3JXT A;  4E35 A;  3HVQ C;  1RZX A;  1T2M A;  1IHJ A;  3LNX A;  5F3X A;  2IWO A;  4JOE A;  4H11 A;  2KA9 A;  4O06 A;  3SHW A;  2DAZ A;  4EDJ A;  1U39 A;  5E21 A;  1WH1 A;  3ID2 A;  1OBZ A;  2KOH A;  4Q6S A;  2KRG A;  1W9O A;  2LUI A;  1Q7X A;  1V5L A;  1V62 A;  3TSZ A;  3QGL A;  3R69 A;  2L4S A;  1VCW A;  2D90 A;  4NMR A;  1D5G A;  2E7K A;  2FN5 A;  3E17 A;  1TP3 A;  2EEH A;  2YT7 A;  3HPK A;  2R3Y A;  2QT5 A;  3B76 A;  4PQW A;  3PV4 A;  2DC2 A;  2AWU A;  2I4S A;  4REY A;  3KDK A;  4K72 A;  1NF3 C;  2KAW A;  3GDV A;  1VJ6 A;  1BFE A;  1OZI A;  1WG6 A;  5GND A;  4JOP A;  5ILB A;  2ZPL A;  1WFV A;  3MH4 A;  4JL7 A;  5F67 A;  2EHR A;  3WKM A;  2GEF A;  1N6E A;  2F5Y A;  3R68 A;  1KY9 A;  2JSN A;  3I4W A;  5HDY A;  1UJV A;  4R2Z A;  1UJD A;  5G1E A;  2EAQ A;  2ENO A;  5HED A;  3SUZ A;  1TE0 A;  4JOF A;  4RI0 A;  1UF1 A;  2LOB A;  3NCV A;  1X45 A;  3RL8 A;  2H3L A;  1Z87 A;  3TSW A;  2KJK A;  1GQ5 A;  1X5R A;  1VB7 A;  2IWQ A;  4KFW A;  2EXG A;  2EDZ A;  1N6D A;  2V1W A;  4JOG A;  2PDZ A;  1UEP A;  4IC6 A;  2K1Z A;  1G9O A;  3ZRT A;  1MC7 A;  2KJP A;  4JOR A;  2OMJ A;  1W9Q A;  1PDR A;  2R4H A;  2M0T A;  3CC0 A;  1U37 A;  1WI2 A;  3O46 A;  1X5Q A;  2YT8 A;  4JOJ A;  4K75 A;  2L4T A;  2M0U A;  2REY A;  1TP5 A;  3STJ A;  3ID3 A;  2OZF A;  2OCS A;  4K78 A;  2QKT A;  3CBX A;  4NMP A;  1RY4 A;  5HF4 A;  3FY5 A;  3KZE A;  2L97 A;  2H2B A;  2F0A A;  3GGE A;  2BYG A;  4NMQ A;  2I04 A;  1RGW A;  2LC6 A;  2DLU A;  1UHP A;  4Z8J A;  3QJM A;  2IWP A;  2UZC A;  1WF8 A;  2PKU A;  3OU0 A;  5A2P A;  5E22 A;  3KDG A;  3GAB A;  2FCF A;  1FC6 A;  3MH7 A;  1P1E A;  4NMS A;  1WF7 A;  2EEJ A;  2CS5 A;  3SHU A;  4UU6 A;  2ZPM A;  2QBW A;  3VQG A;  2EDV A;  2LA8 A;  2VPH A;  2YUB A;  2D92 A;  4MPA A;  1GM1 A;  4L8N A;  1GQ4 A;  4E3B A;  3GJ9 A;  5HEY A;  5E11 A;  2GZV A;  3QO6 A;  2VRF A;  1WJL A;  4WYU A;  1OBX A;  3OTP A;  3QIK A;  2EGN A;  2JXO A;  2CSS A;  3PS4 A;  2H2C A;  2MX6 A;  4OEP A;  1ZOK A;  2DMZ A;  4OEO A;  4Q6H A;  5DTH A;  1ZUB A;  3GDS A;  2PKT A;  1R6J A;  2HGA A;  4XHV A;  5B42 A;  4NMO A;  2K20 A;  2KBS A;  4FGM A;  3BPU A;  5HJ1 A;  1FC7 A;  1N99 A;  1YBO A;  2RCZ A;  3EGG C;  4GVC A;  5FB8 C;  1V6B A;  4Q3H A;  1WFG A;  5B6L A;  2D8I A;  2PA1 A;  1MFG A;  2AIN A;  3PV5 A;  3CS0 A;  4YYX A;  4Q2Q A;  3RL7 A;  2G5M B;  2EEI A;  3NGH A;  3VQF A;  4Q2O A;  2IWN A;  4HOP B;  1UEZ A;  3WKL A;  2HE4 A;  1VAE A;  2AWW A;  1TQ3 A;  4GVD A;  3R0H A;  3NFL A;  2JRE A;  4JJ3 A;  3PDV A;  4NXQ A;  4KFV A;  1M5Z A;  3GCO A;  1U38 A;  4NMV A;  1X9Z A;  2I1N A;  3KZD A;  5EYZ A;  2EDP A;  1KEF A;  2OGP A;  4JJ0 A;  1UEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...