1RGRA

Cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Presynaptic density protein 95
publication title Targeting Specific PDZ Domains of PSD-95; Structural Basis for Enhanced Affinity and Enzymatic Stability of a Cyclic Peptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/de novo protein
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1rgrA00
1W9QA 2H2CA 2JWEA 1WHAA 2JOAA 2M0ZA 2OS6A 3CBXA 1Z87A 2R3YA 2QG1A 3EGHC 2HGAA 2F0AA 3WKMA 1B8QA 2G2LA 1UEWA 1UM1A 3DORA 5E22A 1Q3PA 3DJ3A 2KAWA 1GQ5A 4EDJA 3JXTA 4GHNA 4Q2PA 4HOPA 4K78A 2KJKA 1X5NA 5HFDA 2OZFA 1UEPA 2QKUA 5HFEA 1IU2A 2PA1A 4NMRA 3KZEA 1WFVA 3SHUA 3PDZA 1V62A 2FCFA 5H3JA 2WL7A 2QT5A 2OMJA 3B76A 4GVCA 5E6PB 2KYLA 1SOTA 1WI2A 3QE1A 2OQSA 2DMZA 2BYGA 1UJDA 3MH4A 5HEYA 2EEGA 1V1TA 4GVDA 1U3BA 1QAVA 2OPGA 5F67A 4NXPA 2JINA 3QGLA 2PKTA 4OAJA 1UEQA 3WKLA 2KJDA 1X6DA 2CSJA 2YUYA 3CYYA 3GDVA 4R2ZA 1FC9A 3GCOA 3GSLA 2EGOA 3O46A 4NNMA 5JXBA 2V90A 4K6YA 3TSZA 1V5QA 4N6XA 3PDVA 4PQWA 5HDYA 4XHVA 3EGGC 1N7TA 4NXQA 3K82A 2AWXA 2VSPA 3VQGA 4Z33A 2IWOA 1X5RA 2HE2A 2IWQA 2JIKA 2QKVA 1UJVA 4WYTA 4Q2NA 1TE0A 4UU5A 2YT8A 2M3MA 3HPMA 3SHWA 2VWRA 1VJ6A 3R68A 3PS4A 1NTEA 1MFLA 2KOHA 1IU0A 2VPHA 1X45A 3HPKA 5HJ1A 3I1EA 5G1EA 4E3BA 1P1DA 2LA8A 1QAVB 2I6VA 5HFCA 3QO6A 2Q3GA 1R6JA 2PNTA 2KA9A 2EDPA 2YUBA 1VB7A 1WG6A 4UU6A 2KL1A 1UFXA 1W9EA 4Q6HA 1SOZA 1TP3A 4IC6A 3RLEA 3RL8A 4JL7A 2AINA 2DB5A 4K76A 1RZXA 4AMHA 2QKTA 4REYA 4OEOA 2DM8A 3GJ9A 2L97A 4KFWA 1I92A 1WJLA 2H3MA 1U37A 1WH1A 2R4HA 1LCYA 4NMSA 1UHPA 4YYXA 2OCSA 1PDRA 2KQFA 3MH7A 3GDSA 1N7EA 1X5QA 2Q9VA 5HF1A 3BPUA 2MHOA 1WHDA 3TSVA 1KWAA 2CSSA 1GM1A 3O5NA 2K1ZA 4JORA 2PZDA 5FHTA 2DJTA 5HETA 2EXGA 3PV2A 3NGHA 2ZPMA 1VAEA 1M5ZA 3ZRTA 1VCWA 2FE5A 1BE9A 4K75A 2EV8A 3ID4A 2W4FA 1IHJA 3SUZA 2JREA 3PV4A 5EZ0A 5A2PA 3GCNA 3KZDA 1QLCA 2EAQA 2H3LA 4H11A 4OEPA 3ID2A 5E21A 2EJYA 1T2MA 2X7ZA 1V6BA 4Q3HA 3FY5A 4F8KA 2I0LA 5HF4A 5B6LA 3E17A 2YTWA 1N6DA 1G9OA 3QIKA 1TP5A 2GZVA 1BFEA 3CBYA 2IWPA 3GGEA 2KOJA 2MX6A 1N6EA 2EEIA 2EHRA 1KY9A 2UZCA 1U39A 2M0TA 2DC2A 3CH8A 3K50A 1I16A 1OBXA 1Y8TA 5GLJA 1Q7XA 2W7RA 4KFVA 3SFJA 2EEHA 2KBSA 2LC6A 2Z9IA 4YDPA 4JOEA 4Z8JA 2QBWA 1FC7A 5HFBA 3STJA 1WFGA 5G1DA 2EEJA 1FC6A 2KOMA 1Y7NA 1X8SA 3ID1A 3MH6A 2IWNA 2PDZA 3KHFA 2K20A 2EDZA 4JOFA 1YBOA 2AWUA 2I4SA 1OZIA 5E11A 3CS0A 2D92A 3DIWA 3R0HA 5FB8C 4JOJA 1ZOKA 1OBZA 3QJNA 3LNXA 5HFFA 3SOEA 1UF1A 3VQFA 1W9OA 2YT7A 2O2TA 2LC7A 2DLSA 2KG2A 2Z17A 2VSVA 4NNLA 1N99A 2H2BA 2KV8A 4NMQA 1MC7A 1L6OA 3QJMA 1ZUBA 2FNEA 1WF7A 3GDUA 3NFKA 3ID3A 3K1RA 4JOKA 1WF8A 2HE4A 1MFGA 2EGKA 2E7KA 1QAUA 4NMPA 2M0VA 3L4FD 4NXRA 3DJAA 2G5MB 1UJUA 1RY4A 2KRGA 1UITA 2JXOA 4WYUA 4L8NA 2I0IA 2I1NA 1TQ3A 4P0CA 2KPLA 3HVQC 2EGNA 5GNDA 3TMHA 3R69A 4NMOA 4JOHA 2VRFA 2VZ5A 2PKUA 3I4WA 2KJPA 4NMTA 1RGRA 4NMVA 1OBYA 1UM7A 2L4TA 3LNYA 5DTHA 1Z86A 1KEFA 4Q2OA 2DLUA 2AWWA 5HEBA 1FCFA 4P2AB 5D13A 5E1YA 2RRMA 2L4SA 4LMMA 1V5LA 3RL7A 2FN5A 2REYA 3NFLA 1N6FA 4K72A 1XZ9A 2D8IA 4RI0A 1U38A 2OSGA 5HEDA 1K32A 3CBZA 2LUIA 2KPKA 2ZPLA 4FGMA 2DAZA 2M0UA 4HOPB 2F5YA 5F3XA 1P1EA 2LOBA 1VA8A 3TSWA 1RGWA 3PV5A 2ENOA 2OGPA 4JOPA 4MPAA 1WI4A 3OTPA 2V1WA 5I7ZA 1Q3OA 2D90A 4Q2QA 1NF3C 4E34A 3AXAA 1WIFA 1UEZA 4JOGA 2CS5A 3QDOA 3CC0A 4G69A 2EDVA 2I04A 2P3WA 4O06A 4E35A 2RCZA 2DKRA 2JILA 1D5GA 3OU0A 1GQ4A 2M10A 3DJ1A 3I18A 5EYZA 1N7FA 4Q6SA
chains in the Genus database with same CATH superfamily
1W9QA 2H2CA 2JWEA 1WHAA 2JOAA 2M0ZA 2OS6A 3CBXA 1Z87A 2R3YA 2QG1A 3EGHC 2HGAA 2F0AA 3WKMA 1B8QA 2G2LA 1UEWA 1UM1A 3DORA 5E22A 1Q3PA 3DJ3A 2KAWA 1GQ5A 4EDJA 3JXTA 4GHNA 4Q2PA 4HOPA 4K78A 2KJKA 1X5NA 5HFDA 2OZFA 1UEPA 2QKUA 5HFEA 1IU2A 2PA1A 4NMRA 3KZEA 1WFVA 3SHUA 3PDZA 1V62A 2FCFA 5H3JA 5ILBA 2WL7A 2QT5A 2OMJA 3B76A 4GVCA 5E6PB 2KYLA 1SOTA 1WI2A 3QE1A 2OQSA 2DMZA 2BYGA 1UJDA 3MH4A 5HEYA 2EEGA 1V1TA 4GVDA 1U3BA 1QAVA 2OPGA 5F67A 4NXPA 2JINA 3QGLA 2PKTA 4OAJA 1UEQA 3WKLA 2KJDA 1X6DA 2CSJA 2YUYA 3CYYA 3GDVA 4R2ZA 1FC9A 3GCOA 3GSLA 2EGOA 3O46A 4NNMA 5JXBA 2V90A 4K6YA 3TSZA 1V5QA 4N6XA 3PDVA 4PQWA 5HDYA 4XHVA 3EGGC 1N7TA 5B42A 4NXQA 3K82A 2AWXA 2VSPA 3VQGA 4Z33A 2IWOA 1X5RA 2HE2A 2IWQA 2JIKA 2QKVA 1UJVA 4WYTA 4Q2NA 1TE0A 4UU5A 2YT8A 2M3MA 3HPMA 3SHWA 2VWRA 4FLNA 1VJ6A 3R68A 3PS4A 1NTEA 1MFLA 2KOHA 1IU0A 2VPHA 1X45A 3HPKA 5HJ1A 3I1EA 5G1EA 4E3BA 1P1DA 2LA8A 1QAVB 2I6VA 5HFCA 3QO6A 2Q3GA 1R6JA 2PNTA 2KA9A 2EDPA 2YUBA 1VB7A 1WG6A 4UU6A 2KL1A 1UFXA 1W9EA 4Q6HA 1SOZA 1TP3A 4IC6A 3RLEA 3RL8A 4JL7A 2AINA 2DB5A 4K76A 1RZXA 4AMHA 2QKTA 4REYA 4OEOA 2DM8A 3GJ9A 2L97A 4KFWA 1I92A 1WJLA 2H3MA 1U37A 1WH1A 2R4HA 1LCYA 4NMSA 1UHPA 4YYXA 2OCSA 1PDRA 2KQFA 3MH7A 3GDSA 1N7EA 1X5QA 2Q9VA 5HF1A 3BPUA 2MHOA 1WHDA 3TSVA 1KWAA 2CSSA 1GM1A 3O5NA 2K1ZA 4JORA 2PZDA 5FHTA 2DJTA 5HETA 2EXGA 3PV2A 3NGHA 2ZPMA 1VAEA 1M5ZA 3ZRTA 1VCWA 2FE5A 1BE9A 4K75A 2EV8A 3ID4A 2W4FA 1IHJA 3SUZA 2JREA 3PV4A 5EZ0A 5A2PA 3GCNA 3KZDA 1QLCA 3KDGA 2EAQA 2H3LA 4H11A 4OEPA 3ID2A 5E21A 2EJYA 1T2MA 2X7ZA 1V6BA 4Q3HA 3FY5A 4F8KA 2I0LA 5HF4A 5B6LA 3E17A 2YTWA 1N6DA 1G9OA 3QIKA 1TP5A 2GZVA 1BFEA 3CBYA 2IWPA 3GGEA 4JJ0A 2KOJA 2MX6A 1N6EA 2EEIA 2EHRA 1KY9A 2UZCA 1U39A 2M0TA 2DC2A 3CH8A 3K50A 1I16A 1OBXA 1Y8TA 5GLJA 1Q7XA 2W7RA 4KFVA 3SFJA 2EEHA 2KBSA 2LC6A 2Z9IA 4YDPA 4JOEA 4Z8JA 2QBWA 1FC7A 5HFBA 3STJA 1WFGA 5G1DA 2EEJA 4JJ3A 1FC6A 2KOMA 1Y7NA 1X8SA 3ID1A 3MH6A 2IWNA 2PDZA 3KHFA 2K20A 2EDZA 4JOFA 1YBOA 2AWUA 2I4SA 1OZIA 5E11A 3CS0A 2D92A 3DIWA 3R0HA 5FB8C 4JOJA 1ZOKA 1OBZA 3QJNA 3LNXA 5HFFA 3SOEA 1UF1A 3VQFA 1W9OA 2YT7A 2O2TA 2LC7A 2DLSA 2KG2A 2Z17A 2VSVA 4NNLA 1N99A 2H2BA 2KV8A 4NMQA 1MC7A 1L6OA 3QJMA 1ZUBA 2JSNA 2FNEA 1WF7A 3GDUA 3NFKA 3ID3A 3K1RA 4JOKA 1WF8A 2HE4A 1MFGA 2EGKA 2E7KA 1QAUA 4NMPA 2M0VA 3L4FD 4NXRA 3DJAA 2G5MB 1UJUA 1RY4A 3NCVA 2KRGA 1UITA 2JXOA 4WYUA 4L8NA 2I0IA 2I1NA 1TQ3A 4P0CA 2KPLA 3HVQC 2EGNA 5GNDA 3TMHA 3R69A 4NMOA 4JOHA 2VRFA 2VZ5A 2PKUA 3I4WA 2KJPA 4NMTA 1RGRA 4NMVA 1OBYA 1UM7A 2L4TA 3LNYA 5DTHA 2GEFA 1Z86A 1KEFA 4Q2OA 2DLUA 2AWWA 5HEBA 1FCFA 4P2AB 5D13A 5E1YA 2RRMA 2L4SA 4LMMA 1V5LA 3RL7A 2FN5A 2REYA 3NFLA 1N6FA 4K72A 1XZ9A 2D8IA 4RI0A 1U38A 2OSGA 5HEDA 1K32A 3CBZA 2LUIA 2KPKA 2ZPLA 4FGMA 5IL9A 2DAZA 2M0UA 4HOPB 2F5YA 3GABA 5F3XA 1P1EA 2LOBA 1VA8A 1X9ZA 3TSWA 1RGWA 3PV5A 2ENOA 2OGPA 4JOPA 4MPAA 1WI4A 3OTPA 2V1WA 5I7ZA 1Q3OA 2D90A 4Q2QA 1NF3C 4E34A 3AXAA 1WIFA 1UEZA 4JOGA 2CS5A 3QDOA 3CC0A 4G69A 2EDVA 2I04A 2P3WA 4O06A 4E35A 2RCZA 2DKRA 2JILA 1D5GA 3OU0A 1GQ4A 3KDKA 2M10A 3DJ1A 3I18A 5EYZA 1N7FA 4Q6SA
chains in the Genus database with same CATH topology
1W9QA 2H2CA 2JWEA 1WHAA 2JOAA 2M0ZA 2OS6A 3CBXA 1Z87A 2R3YA 2QG1A 3EGHC 2HGAA 2F0AA 3WKMA 1B8QA 2G2LA 1UEWA 1UM1A 3DORA 5E22A 1Q3PA 3DJ3A 2KAWA 1GQ5A 4EDJA 3JXTA 4GHNA 4Q2PA 4HOPA 4K78A 2KJKA 1X5NA 5HFDA 2OZFA 1UEPA 2QKUA 5HFEA 1IU2A 2PA1A 4NMRA 3KZEA 1WFVA 3SHUA 3PDZA 1V62A 2FCFA 5H3JA 5ILBA 2WL7A 2QT5A 2OMJA 3B76A 4GVCA 5E6PB 2KYLA 1SOTA 1WI2A 3QE1A 2OQSA 2DMZA 2BYGA 1UJDA 3MH4A 5HEYA 2EEGA 1V1TA 4GVDA 1U3BA 1QAVA 2OPGA 5F67A 4NXPA 2JINA 3QGLA 2PKTA 4OAJA 1UEQA 3WKLA 2KJDA 1X6DA 2CSJA 2YUYA 3CYYA 3GDVA 4R2ZA 1FC9A 3GCOA 3GSLA 2EGOA 3O46A 4NNMA 5JXBA 2V90A 4K6YA 3TSZA 1V5QA 4N6XA 3PDVA 4PQWA 5HDYA 4XHVA 3EGGC 1N7TA 5B42A 4NXQA 3K82A 2AWXA 2VSPA 3VQGA 4Z33A 2IWOA 1X5RA 2HE2A 2IWQA 2JIKA 2QKVA 1UJVA 4WYTA 4Q2NA 1TE0A 4UU5A 2YT8A 2M3MA 3HPMA 3SHWA 2VWRA 4FLNA 1VJ6A 3R68A 3PS4A 1NTEA 1MFLA 2KOHA 1IU0A 2VPHA 1X45A 3HPKA 5HJ1A 3I1EA 5G1EA 4E3BA 1P1DA 2LA8A 1QAVB 2I6VA 5HFCA 3QO6A 2Q3GA 1R6JA 2PNTA 2KA9A 2EDPA 2YUBA 1VB7A 1WG6A 4UU6A 2KL1A 1UFXA 1W9EA 4Q6HA 1SOZA 1TP3A 4IC6A 3RLEA 3RL8A 4JL7A 2AINA 2DB5A 4K76A 1RZXA 4AMHA 2QKTA 4REYA 4OEOA 2DM8A 3GJ9A 2L97A 4KFWA 1I92A 1WJLA 2H3MA 1U37A 1WH1A 2R4HA 1LCYA 4NMSA 1UHPA 4YYXA 2OCSA 1PDRA 2KQFA 3MH7A 3GDSA 1N7EA 1X5QA 2Q9VA 5HF1A 3BPUA 2MHOA 1WHDA 3TSVA 1KWAA 2CSSA 1GM1A 3O5NA 2K1ZA 4JORA 2PZDA 5FHTA 2DJTA 5HETA 2EXGA 3PV2A 3NGHA 2ZPMA 1VAEA 1M5ZA 3ZRTA 1VCWA 2FE5A 1BE9A 4K75A 2EV8A 3ID4A 2W4FA 1IHJA 3SUZA 2JREA 3PV4A 5EZ0A 5A2PA 3GCNA 3KZDA 1QLCA 3KDGA 2EAQA 2H3LA 4H11A 4OEPA 3ID2A 5E21A 2EJYA 1T2MA 2X7ZA 1V6BA 4Q3HA 3FY5A 4F8KA 2I0LA 5HF4A 5B6LA 3E17A 2YTWA 1N6DA 1G9OA 3QIKA 1TP5A 2GZVA 1BFEA 3CBYA 2IWPA 3GGEA 4JJ0A 2KOJA 2MX6A 1N6EA 2EEIA 2EHRA 1KY9A 2UZCA 1U39A 2M0TA 2DC2A 3CH8A 3K50A 1I16A 1OBXA 1Y8TA 5GLJA 1Q7XA 2W7RA 4KFVA 3SFJA 2EEHA 2KBSA 2LC6A 2Z9IA 4YDPA 4JOEA 4Z8JA 2QBWA 1FC7A 5HFBA 3STJA 1WFGA 5G1DA 2EEJA 4JJ3A 1FC6A 2KOMA 1Y7NA 1X8SA 3ID1A 3MH6A 2IWNA 2PDZA 3KHFA 2K20A 2EDZA 4JOFA 1YBOA 2AWUA 2I4SA 1OZIA 5E11A 3CS0A 2D92A 3DIWA 3R0HA 5FB8C 4JOJA 1ZOKA 1OBZA 3QJNA 3LNXA 5HFFA 3SOEA 1UF1A 3VQFA 1W9OA 2YT7A 2O2TA 2LC7A 2DLSA 2KG2A 2Z17A 2VSVA 4NNLA 1N99A 2H2BA 2KV8A 4NMQA 1MC7A 1L6OA 3QJMA 1ZUBA 2JSNA 2FNEA 1WF7A 3GDUA 3NFKA 3ID3A 3K1RA 4JOKA 1WF8A 2HE4A 1MFGA 2EGKA 2E7KA 1QAUA 4NMPA 2M0VA 3L4FD 4NXRA 3DJAA 2G5MB 1UJUA 1RY4A 3NCVA 2KRGA 1UITA 2JXOA 4WYUA 4L8NA 2I0IA 2I1NA 1TQ3A 4P0CA 2KPLA 3HVQC 2EGNA 5GNDA 3TMHA 3R69A 4NMOA 4JOHA 2VRFA 2VZ5A 2PKUA 3I4WA 2KJPA 4NMTA 1RGRA 4NMVA 1OBYA 1UM7A 2L4TA 3LNYA 5DTHA 2GEFA 1Z86A 1KEFA 4Q2OA 2DLUA 2AWWA 5HEBA 1FCFA 4P2AB 5D13A 5E1YA 2RRMA 2L4SA 4LMMA 1V5LA 3RL7A 2FN5A 2REYA 3NFLA 1N6FA 4K72A 1XZ9A 2D8IA 4RI0A 1U38A 2OSGA 5HEDA 1K32A 3CBZA 2LUIA 2KPKA 2ZPLA 4FGMA 5IL9A 2DAZA 2M0UA 4HOPB 2F5YA 3GABA 5F3XA 1P1EA 2LOBA 1VA8A 1X9ZA 3TSWA 1RGWA 3PV5A 2ENOA 2OGPA 4JOPA 4MPAA 1WI4A 3OTPA 2V1WA 5I7ZA 1Q3OA 2D90A 4Q2QA 1NF3C 4E34A 3AXAA 1WIFA 1UEZA 4JOGA 2CS5A 3QDOA 3CC0A 4G69A 2EDVA 2I04A 2P3WA 4O06A 4E35A 2RCZA 2DKRA 2JILA 1D5GA 3OU0A 1GQ4A 3KDKA 2M10A 3DJ1A 3I18A 5EYZA 1N7FA 4Q6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W9Q A;  2H2C A;  2JWE A;  1WHA A;  2JOA A;  2M0Z A;  2OS6 A;  3CBX A;  1Z87 A;  2R3Y A;  2QG1 A;  3EGH C;  2HGA A;  2F0A A;  3WKM A;  1B8Q A;  2G2L A;  1UEW A;  1UM1 A;  3DOR A;  5E22 A;  1Q3P A;  3DJ3 A;  2KAW A;  1GQ5 A;  4EDJ A;  3JXT A;  4GHN A;  4Q2P A;  4HOP A;  4K78 A;  2KJK A;  1X5N A;  5HFD A;  2OZF A;  1UEP A;  2QKU A;  5HFE A;  1IU2 A;  2PA1 A;  4NMR A;  3KZE A;  1WFV A;  3SHU A;  3PDZ A;  1V62 A;  2FCF A;  5H3J A;  2WL7 A;  2QT5 A;  2OMJ A;  3B76 A;  4GVC A;  5E6P B;  2KYL A;  1SOT A;  1WI2 A;  3QE1 A;  2OQS A;  2DMZ A;  2BYG A;  1UJD A;  3MH4 A;  5HEY A;  2EEG A;  1V1T A;  4GVD A;  1U3B A;  1QAV A;  2OPG A;  5F67 A;  4NXP A;  2JIN A;  3QGL A;  2PKT A;  4OAJ A;  1UEQ A;  3WKL A;  2KJD A;  1X6D A;  2CSJ A;  2YUY A;  3CYY A;  3GDV A;  4R2Z A;  1FC9 A;  3GCO A;  3GSL A;  2EGO A;  3O46 A;  4NNM A;  5JXB A;  2V90 A;  4K6Y A;  3TSZ A;  1V5Q A;  4N6X A;  3PDV A;  4PQW A;  5HDY A;  4XHV A;  3EGG C;  1N7T A;  4NXQ A;  3K82 A;  2AWX A;  2VSP A;  3VQG A;  4Z33 A;  2IWO A;  1X5R A;  2HE2 A;  2IWQ A;  2JIK A;  2QKV A;  1UJV A;  4WYT A;  4Q2N A;  1TE0 A;  4UU5 A;  2YT8 A;  2M3M A;  3HPM A;  3SHW A;  2VWR A;  1VJ6 A;  3R68 A;  3PS4 A;  1NTE A;  1MFL A;  2KOH A;  1IU0 A;  2VPH A;  1X45 A;  3HPK A;  5HJ1 A;  3I1E A;  5G1E A;  4E3B A;  1P1D A;  2LA8 A;  1QAV B;  2I6V A;  5HFC A;  3QO6 A;  2Q3G A;  1R6J A;  2PNT A;  2KA9 A;  2EDP A;  2YUB A;  1VB7 A;  1WG6 A;  4UU6 A;  2KL1 A;  1UFX A;  1W9E A;  4Q6H A;  1SOZ A;  1TP3 A;  4IC6 A;  3RLE A;  3RL8 A;  4JL7 A;  2AIN A;  2DB5 A;  4K76 A;  1RZX A;  4AMH A;  2QKT A;  4REY A;  4OEO A;  2DM8 A;  3GJ9 A;  2L97 A;  4KFW A;  1I92 A;  1WJL A;  2H3M A;  1U37 A;  1WH1 A;  2R4H A;  1LCY A;  4NMS A;  1UHP A;  4YYX A;  2OCS A;  1PDR A;  2KQF A;  3MH7 A;  3GDS A;  1N7E A;  1X5Q A;  2Q9V A;  5HF1 A;  3BPU A;  2MHO A;  1WHD A;  3TSV A;  1KWA A;  2CSS A;  1GM1 A;  3O5N A;  2K1Z A;  4JOR A;  2PZD A;  5FHT A;  2DJT A;  5HET A;  2EXG A;  3PV2 A;  3NGH A;  2ZPM A;  1VAE A;  1M5Z A;  3ZRT A;  1VCW A;  2FE5 A;  1BE9 A;  4K75 A;  2EV8 A;  3ID4 A;  2W4F A;  1IHJ A;  3SUZ A;  2JRE A;  3PV4 A;  5EZ0 A;  5A2P A;  3GCN A;  3KZD A;  1QLC A;  2EAQ A;  2H3L A;  4H11 A;  4OEP A;  3ID2 A;  5E21 A;  2EJY A;  1T2M A;  2X7Z A;  1V6B A;  4Q3H A;  3FY5 A;  4F8K A;  2I0L A;  5HF4 A;  5B6L A;  3E17 A;  2YTW A;  1N6D A;  1G9O A;  3QIK A;  1TP5 A;  2GZV A;  1BFE A;  3CBY A;  2IWP A;  3GGE A;  2KOJ A;  2MX6 A;  1N6E A;  2EEI A;  2EHR A;  1KY9 A;  2UZC A;  1U39 A;  2M0T A;  2DC2 A;  3CH8 A;  3K50 A;  1I16 A;  1OBX A;  1Y8T A;  5GLJ A;  1Q7X A;  2W7R A;  4KFV A;  3SFJ A;  2EEH A;  2KBS A;  2LC6 A;  2Z9I A;  4YDP A;  4JOE A;  4Z8J A;  2QBW A;  1FC7 A;  5HFB A;  3STJ A;  1WFG A;  5G1D A;  2EEJ A;  1FC6 A;  2KOM A;  1Y7N A;  1X8S A;  3ID1 A;  3MH6 A;  2IWN A;  2PDZ A;  3KHF A;  2K20 A;  2EDZ A;  4JOF A;  1YBO A;  2AWU A;  2I4S A;  1OZI A;  5E11 A;  3CS0 A;  2D92 A;  3DIW A;  3R0H A;  5FB8 C;  4JOJ A;  1ZOK A;  1OBZ A;  3QJN A;  3LNX A;  5HFF A;  3SOE A;  1UF1 A;  3VQF A;  1W9O A;  2YT7 A;  2O2T A;  2LC7 A;  2DLS A;  2KG2 A;  2Z17 A;  2VSV A;  4NNL A;  1N99 A;  2H2B A;  2KV8 A;  4NMQ A;  1MC7 A;  1L6O A;  3QJM A;  1ZUB A;  2FNE A;  1WF7 A;  3GDU A;  3NFK A;  3ID3 A;  3K1R A;  4JOK A;  1WF8 A;  2HE4 A;  1MFG A;  2EGK A;  2E7K A;  1QAU A;  4NMP A;  2M0V A;  3L4F D;  4NXR A;  3DJA A;  2G5M B;  1UJU A;  1RY4 A;  2KRG A;  1UIT A;  2JXO A;  4WYU A;  4L8N A;  2I0I A;  2I1N A;  1TQ3 A;  4P0C A;  2KPL A;  3HVQ C;  2EGN A;  5GND A;  3TMH A;  3R69 A;  4NMO A;  4JOH A;  2VRF A;  2VZ5 A;  2PKU A;  3I4W A;  2KJP A;  4NMT A;  1RGR A;  4NMV A;  1OBY A;  1UM7 A;  2L4T A;  3LNY A;  5DTH A;  1Z86 A;  1KEF A;  4Q2O A;  2DLU A;  2AWW A;  5HEB A;  1FCF A;  4P2A B;  5D13 A;  5E1Y A;  2RRM A;  2L4S A;  4LMM A;  1V5L A;  3RL7 A;  2FN5 A;  2REY A;  3NFL A;  1N6F A;  4K72 A;  1XZ9 A;  2D8I A;  4RI0 A;  1U38 A;  2OSG A;  5HED A;  1K32 A;  3CBZ A;  2LUI A;  2KPK A;  2ZPL A;  4FGM A;  2DAZ A;  2M0U A;  4HOP B;  2F5Y A;  5F3X A;  1P1E A;  2LOB A;  1VA8 A;  3TSW A;  1RGW A;  3PV5 A;  2ENO A;  2OGP A;  4JOP A;  4MPA A;  1WI4 A;  3OTP A;  2V1W A;  5I7Z A;  1Q3O A;  2D90 A;  4Q2Q A;  1NF3 C;  4E34 A;  3AXA A;  1WIF A;  1UEZ A;  4JOG A;  2CS5 A;  3QDO A;  3CC0 A;  4G69 A;  2EDV A;  2I04 A;  2P3W A;  4O06 A;  4E35 A;  2RCZ A;  2DKR A;  2JIL A;  1D5G A;  3OU0 A;  1GQ4 A;  2M10 A;  3DJ1 A;  3I18 A;  5EYZ A;  1N7F A;  4Q6S A; 
#chains in the Genus database with same CATH topology
 1W9Q A;  2H2C A;  2JWE A;  1WHA A;  2JOA A;  2M0Z A;  2OS6 A;  3CBX A;  1Z87 A;  2R3Y A;  2QG1 A;  3EGH C;  2HGA A;  2F0A A;  3WKM A;  1B8Q A;  2G2L A;  1UEW A;  1UM1 A;  3DOR A;  5E22 A;  1Q3P A;  3DJ3 A;  2KAW A;  1GQ5 A;  4EDJ A;  3JXT A;  4GHN A;  4Q2P A;  4HOP A;  4K78 A;  2KJK A;  1X5N A;  5HFD A;  2OZF A;  1UEP A;  2QKU A;  5HFE A;  1IU2 A;  2PA1 A;  4NMR A;  3KZE A;  1WFV A;  3SHU A;  3PDZ A;  1V62 A;  2FCF A;  5H3J A;  5ILB A;  2WL7 A;  2QT5 A;  2OMJ A;  3B76 A;  4GVC A;  5E6P B;  2KYL A;  1SOT A;  1WI2 A;  3QE1 A;  2OQS A;  2DMZ A;  2BYG A;  1UJD A;  3MH4 A;  5HEY A;  2EEG A;  1V1T A;  4GVD A;  1U3B A;  1QAV A;  2OPG A;  5F67 A;  4NXP A;  2JIN A;  3QGL A;  2PKT A;  4OAJ A;  1UEQ A;  3WKL A;  2KJD A;  1X6D A;  2CSJ A;  2YUY A;  3CYY A;  3GDV A;  4R2Z A;  1FC9 A;  3GCO A;  3GSL A;  2EGO A;  3O46 A;  4NNM A;  5JXB A;  2V90 A;  4K6Y A;  3TSZ A;  1V5Q A;  4N6X A;  3PDV A;  4PQW A;  5HDY A;  4XHV A;  3EGG C;  1N7T A;  5B42 A;  4NXQ A;  3K82 A;  2AWX A;  2VSP A;  3VQG A;  4Z33 A;  2IWO A;  1X5R A;  2HE2 A;  2IWQ A;  2JIK A;  2QKV A;  1UJV A;  4WYT A;  4Q2N A;  1TE0 A;  4UU5 A;  2YT8 A;  2M3M A;  3HPM A;  3SHW A;  2VWR A;  4FLN A;  1VJ6 A;  3R68 A;  3PS4 A;  1NTE A;  1MFL A;  2KOH A;  1IU0 A;  2VPH A;  1X45 A;  3HPK A;  5HJ1 A;  3I1E A;  5G1E A;  4E3B A;  1P1D A;  2LA8 A;  1QAV B;  2I6V A;  5HFC A;  3QO6 A;  2Q3G A;  1R6J A;  2PNT A;  2KA9 A;  2EDP A;  2YUB A;  1VB7 A;  1WG6 A;  4UU6 A;  2KL1 A;  1UFX A;  1W9E A;  4Q6H A;  1SOZ A;  1TP3 A;  4IC6 A;  3RLE A;  3RL8 A;  4JL7 A;  2AIN A;  2DB5 A;  4K76 A;  1RZX A;  4AMH A;  2QKT A;  4REY A;  4OEO A;  2DM8 A;  3GJ9 A;  2L97 A;  4KFW A;  1I92 A;  1WJL A;  2H3M A;  1U37 A;  1WH1 A;  2R4H A;  1LCY A;  4NMS A;  1UHP A;  4YYX A;  2OCS A;  1PDR A;  2KQF A;  3MH7 A;  3GDS A;  1N7E A;  1X5Q A;  2Q9V A;  5HF1 A;  3BPU A;  2MHO A;  1WHD A;  3TSV A;  1KWA A;  2CSS A;  1GM1 A;  3O5N A;  2K1Z A;  4JOR A;  2PZD A;  5FHT A;  2DJT A;  5HET A;  2EXG A;  3PV2 A;  3NGH A;  2ZPM A;  1VAE A;  1M5Z A;  3ZRT A;  1VCW A;  2FE5 A;  1BE9 A;  4K75 A;  2EV8 A;  3ID4 A;  2W4F A;  1IHJ A;  3SUZ A;  2JRE A;  3PV4 A;  5EZ0 A;  5A2P A;  3GCN A;  3KZD A;  1QLC A;  3KDG A;  2EAQ A;  2H3L A;  4H11 A;  4OEP A;  3ID2 A;  5E21 A;  2EJY A;  1T2M A;  2X7Z A;  1V6B A;  4Q3H A;  3FY5 A;  4F8K A;  2I0L A;  5HF4 A;  5B6L A;  3E17 A;  2YTW A;  1N6D A;  1G9O A;  3QIK A;  1TP5 A;  2GZV A;  1BFE A;  3CBY A;  2IWP A;  3GGE A;  4JJ0 A;  2KOJ A;  2MX6 A;  1N6E A;  2EEI A;  2EHR A;  1KY9 A;  2UZC A;  1U39 A;  2M0T A;  2DC2 A;  3CH8 A;  3K50 A;  1I16 A;  1OBX A;  1Y8T A;  5GLJ A;  1Q7X A;  2W7R A;  4KFV A;  3SFJ A;  2EEH A;  2KBS A;  2LC6 A;  2Z9I A;  4YDP A;  4JOE A;  4Z8J A;  2QBW A;  1FC7 A;  5HFB A;  3STJ A;  1WFG A;  5G1D A;  2EEJ A;  4JJ3 A;  1FC6 A;  2KOM A;  1Y7N A;  1X8S A;  3ID1 A;  3MH6 A;  2IWN A;  2PDZ A;  3KHF A;  2K20 A;  2EDZ A;  4JOF A;  1YBO A;  2AWU A;  2I4S A;  1OZI A;  5E11 A;  3CS0 A;  2D92 A;  3DIW A;  3R0H A;  5FB8 C;  4JOJ A;  1ZOK A;  1OBZ A;  3QJN A;  3LNX A;  5HFF A;  3SOE A;  1UF1 A;  3VQF A;  1W9O A;  2YT7 A;  2O2T A;  2LC7 A;  2DLS A;  2KG2 A;  2Z17 A;  2VSV A;  4NNL A;  1N99 A;  2H2B A;  2KV8 A;  4NMQ A;  1MC7 A;  1L6O A;  3QJM A;  1ZUB A;  2JSN A;  2FNE A;  1WF7 A;  3GDU A;  3NFK A;  3ID3 A;  3K1R A;  4JOK A;  1WF8 A;  2HE4 A;  1MFG A;  2EGK A;  2E7K A;  1QAU A;  4NMP A;  2M0V A;  3L4F D;  4NXR A;  3DJA A;  2G5M B;  1UJU A;  1RY4 A;  3NCV A;  2KRG A;  1UIT A;  2JXO A;  4WYU A;  4L8N A;  2I0I A;  2I1N A;  1TQ3 A;  4P0C A;  2KPL A;  3HVQ C;  2EGN A;  5GND A;  3TMH A;  3R69 A;  4NMO A;  4JOH A;  2VRF A;  2VZ5 A;  2PKU A;  3I4W A;  2KJP A;  4NMT A;  1RGR A;  4NMV A;  1OBY A;  1UM7 A;  2L4T A;  3LNY A;  5DTH A;  2GEF A;  1Z86 A;  1KEF A;  4Q2O A;  2DLU A;  2AWW A;  5HEB A;  1FCF A;  4P2A B;  5D13 A;  5E1Y A;  2RRM A;  2L4S A;  4LMM A;  1V5L A;  3RL7 A;  2FN5 A;  2REY A;  3NFL A;  1N6F A;  4K72 A;  1XZ9 A;  2D8I A;  4RI0 A;  1U38 A;  2OSG A;  5HED A;  1K32 A;  3CBZ A;  2LUI A;  2KPK A;  2ZPL A;  4FGM A;  5IL9 A;  2DAZ A;  2M0U A;  4HOP B;  2F5Y A;  3GAB A;  5F3X A;  1P1E A;  2LOB A;  1VA8 A;  1X9Z A;  3TSW A;  1RGW A;  3PV5 A;  2ENO A;  2OGP A;  4JOP A;  4MPA A;  1WI4 A;  3OTP A;  2V1W A;  5I7Z A;  1Q3O A;  2D90 A;  4Q2Q A;  1NF3 C;  4E34 A;  3AXA A;  1WIF A;  1UEZ A;  4JOG A;  2CS5 A;  3QDO A;  3CC0 A;  4G69 A;  2EDV A;  2I04 A;  2P3W A;  4O06 A;  4E35 A;  2RCZ A;  2DKR A;  2JIL A;  1D5G A;  3OU0 A;  1GQ4 A;  3KDK A;  2M10 A;  3DJ1 A;  3I18 A;  5EYZ A;  1N7F A;  4Q6S A; 
#chains in the Genus database with same CATH homology
 1W9Q A;  2H2C A;  2JWE A;  1WHA A;  2JOA A;  2M0Z A;  2OS6 A;  3CBX A;  1Z87 A;  2R3Y A;  2QG1 A;  3EGH C;  2HGA A;  2F0A A;  3WKM A;  1B8Q A;  2G2L A;  1UEW A;  1UM1 A;  3DOR A;  5E22 A;  1Q3P A;  3DJ3 A;  2KAW A;  1GQ5 A;  4EDJ A;  3JXT A;  4GHN A;  4Q2P A;  4HOP A;  4K78 A;  2KJK A;  1X5N A;  5HFD A;  2OZF A;  1UEP A;  2QKU A;  5HFE A;  1IU2 A;  2PA1 A;  4NMR A;  3KZE A;  1WFV A;  3SHU A;  3PDZ A;  1V62 A;  2FCF A;  5H3J A;  5ILB A;  2WL7 A;  2QT5 A;  2OMJ A;  3B76 A;  4GVC A;  5E6P B;  2KYL A;  1SOT A;  1WI2 A;  3QE1 A;  2OQS A;  2DMZ A;  2BYG A;  1UJD A;  3MH4 A;  5HEY A;  2EEG A;  1V1T A;  4GVD A;  1U3B A;  1QAV A;  2OPG A;  5F67 A;  4NXP A;  2JIN A;  3QGL A;  2PKT A;  4OAJ A;  1UEQ A;  3WKL A;  2KJD A;  1X6D A;  2CSJ A;  2YUY A;  3CYY A;  3GDV A;  4R2Z A;  1FC9 A;  3GCO A;  3GSL A;  2EGO A;  3O46 A;  4NNM A;  5JXB A;  2V90 A;  4K6Y A;  3TSZ A;  1V5Q A;  4N6X A;  3PDV A;  4PQW A;  5HDY A;  4XHV A;  3EGG C;  1N7T A;  5B42 A;  4NXQ A;  3K82 A;  2AWX A;  2VSP A;  3VQG A;  4Z33 A;  2IWO A;  1X5R A;  2HE2 A;  2IWQ A;  2JIK A;  2QKV A;  1UJV A;  4WYT A;  4Q2N A;  1TE0 A;  4UU5 A;  2YT8 A;  2M3M A;  3HPM A;  3SHW A;  2VWR A;  4FLN A;  1VJ6 A;  3R68 A;  3PS4 A;  1NTE A;  1MFL A;  2KOH A;  1IU0 A;  2VPH A;  1X45 A;  3HPK A;  5HJ1 A;  3I1E A;  5G1E A;  4E3B A;  1P1D A;  2LA8 A;  1QAV B;  2I6V A;  5HFC A;  3QO6 A;  2Q3G A;  1R6J A;  2PNT A;  2KA9 A;  2EDP A;  2YUB A;  1VB7 A;  1WG6 A;  4UU6 A;  2KL1 A;  1UFX A;  1W9E A;  4Q6H A;  1SOZ A;  1TP3 A;  4IC6 A;  3RLE A;  3RL8 A;  4JL7 A;  2AIN A;  2DB5 A;  4K76 A;  1RZX A;  4AMH A;  2QKT A;  4REY A;  4OEO A;  2DM8 A;  3GJ9 A;  2L97 A;  4KFW A;  1I92 A;  1WJL A;  2H3M A;  1U37 A;  1WH1 A;  2R4H A;  1LCY A;  4NMS A;  1UHP A;  4YYX A;  2OCS A;  1PDR A;  2KQF A;  3MH7 A;  3GDS A;  1N7E A;  1X5Q A;  2Q9V A;  5HF1 A;  3BPU A;  2MHO A;  1WHD A;  3TSV A;  1KWA A;  2CSS A;  1GM1 A;  3O5N A;  2K1Z A;  4JOR A;  2PZD A;  5FHT A;  2DJT A;  5HET A;  2EXG A;  3PV2 A;  3NGH A;  2ZPM A;  1VAE A;  1M5Z A;  3ZRT A;  1VCW A;  2FE5 A;  1BE9 A;  4K75 A;  2EV8 A;  3ID4 A;  2W4F A;  1IHJ A;  3SUZ A;  2JRE A;  3PV4 A;  5EZ0 A;  5A2P A;  3GCN A;  3KZD A;  1QLC A;  3KDG A;  2EAQ A;  2H3L A;  4H11 A;  4OEP A;  3ID2 A;  5E21 A;  2EJY A;  1T2M A;  2X7Z A;  1V6B A;  4Q3H A;  3FY5 A;  4F8K A;  2I0L A;  5HF4 A;  5B6L A;  3E17 A;  2YTW A;  1N6D A;  1G9O A;  3QIK A;  1TP5 A;  2GZV A;  1BFE A;  3CBY A;  2IWP A;  3GGE A;  4JJ0 A;  2KOJ A;  2MX6 A;  1N6E A;  2EEI A;  2EHR A;  1KY9 A;  2UZC A;  1U39 A;  2M0T A;  2DC2 A;  3CH8 A;  3K50 A;  1I16 A;  1OBX A;  1Y8T A;  5GLJ A;  1Q7X A;  2W7R A;  4KFV A;  3SFJ A;  2EEH A;  2KBS A;  2LC6 A;  2Z9I A;  4YDP A;  4JOE A;  4Z8J A;  2QBW A;  1FC7 A;  5HFB A;  3STJ A;  1WFG A;  5G1D A;  2EEJ A;  4JJ3 A;  1FC6 A;  2KOM A;  1Y7N A;  1X8S A;  3ID1 A;  3MH6 A;  2IWN A;  2PDZ A;  3KHF A;  2K20 A;  2EDZ A;  4JOF A;  1YBO A;  2AWU A;  2I4S A;  1OZI A;  5E11 A;  3CS0 A;  2D92 A;  3DIW A;  3R0H A;  5FB8 C;  4JOJ A;  1ZOK A;  1OBZ A;  3QJN A;  3LNX A;  5HFF A;  3SOE A;  1UF1 A;  3VQF A;  1W9O A;  2YT7 A;  2O2T A;  2LC7 A;  2DLS A;  2KG2 A;  2Z17 A;  2VSV A;  4NNL A;  1N99 A;  2H2B A;  2KV8 A;  4NMQ A;  1MC7 A;  1L6O A;  3QJM A;  1ZUB A;  2JSN A;  2FNE A;  1WF7 A;  3GDU A;  3NFK A;  3ID3 A;  3K1R A;  4JOK A;  1WF8 A;  2HE4 A;  1MFG A;  2EGK A;  2E7K A;  1QAU A;  4NMP A;  2M0V A;  3L4F D;  4NXR A;  3DJA A;  2G5M B;  1UJU A;  1RY4 A;  3NCV A;  2KRG A;  1UIT A;  2JXO A;  4WYU A;  4L8N A;  2I0I A;  2I1N A;  1TQ3 A;  4P0C A;  2KPL A;  3HVQ C;  2EGN A;  5GND A;  3TMH A;  3R69 A;  4NMO A;  4JOH A;  2VRF A;  2VZ5 A;  2PKU A;  3I4W A;  2KJP A;  4NMT A;  1RGR A;  4NMV A;  1OBY A;  1UM7 A;  2L4T A;  3LNY A;  5DTH A;  2GEF A;  1Z86 A;  1KEF A;  4Q2O A;  2DLU A;  2AWW A;  5HEB A;  1FCF A;  4P2A B;  5D13 A;  5E1Y A;  2RRM A;  2L4S A;  4LMM A;  1V5L A;  3RL7 A;  2FN5 A;  2REY A;  3NFL A;  1N6F A;  4K72 A;  1XZ9 A;  2D8I A;  4RI0 A;  1U38 A;  2OSG A;  5HED A;  1K32 A;  3CBZ A;  2LUI A;  2KPK A;  2ZPL A;  4FGM A;  5IL9 A;  2DAZ A;  2M0U A;  4HOP B;  2F5Y A;  3GAB A;  5F3X A;  1P1E A;  2LOB A;  1VA8 A;  1X9Z A;  3TSW A;  1RGW A;  3PV5 A;  2ENO A;  2OGP A;  4JOP A;  4MPA A;  1WI4 A;  3OTP A;  2V1W A;  5I7Z A;  1Q3O A;  2D90 A;  4Q2Q A;  1NF3 C;  4E34 A;  3AXA A;  1WIF A;  1UEZ A;  4JOG A;  2CS5 A;  3QDO A;  3CC0 A;  4G69 A;  2EDV A;  2I04 A;  2P3W A;  4O06 A;  4E35 A;  2RCZ A;  2DKR A;  2JIL A;  1D5G A;  3OU0 A;  1GQ4 A;  3KDK A;  2M10 A;  3DJ1 A;  3I18 A;  5EYZ A;  1N7F A;  4Q6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...