1RGRA

Cyclic peptides targeting pdz domains of psd-95: structural basis for enhanced affinity and enzymatic stability
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Presynaptic density protein 95
publication title Targeting Specific PDZ Domains of PSD-95; Structural Basis for Enhanced Affinity and Enzymatic Stability of a Cyclic Peptide.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/de novo protein
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2003-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1rgrA00
3I4WA 5E1YA 4NMOA 1FC7A 1RZXA 1N6FA 2QG1A 4NNLA 5B6LA 1UEWA 3GSLA 3OU0A 2I6VA 3AXAA 1UEZA 4NXRA 1GQ4A 2EDZA 5HEBA 1YBOA 4NMVA 1U38A 1MC7A 1V62A 2CSJA 2HGAA 3ID1A 4OAJA 4WYUA 2DB5A 3VQGA 5G1EA 2EAQA 5E22A 3QGLA 2V90A 1I92A 5HF1A 3EGGC 1ZOKA 3K82A 1P1EA 4YYXA 2EGKA 2KPKA 5DTHA 2REYA 2LC7A 3PS4A 4R2ZA 1BFEA 1TE0A 2JINA 1X8SA 4OEOA 3CS0A 2I4SA 1OBYA 4H11A 2W4FA 2IWQA 5D13A 4GHNA 1WHAA 2EEIA 1WFGA 4JOEA 3DIWA 1UITA 4HOPA 4EDJA 3SOEA 3TSZA 1IHJA 2EDPA 5HETA 4XHVA 1VCWA 1UEQA 2ENOA 1W9QA 2OQSA 4AMHA 2YTWA 5EZ0A 4OEPA 1WHDA 2JXOA 3SFJA 1Y7NA 2MX6A 1WI4A 4Q2QA 3GDSA 2M0TA 3GDVA 4Q6SA 1T2MA 2JIKA 2L97A 3CBXA 2DKRA 1MFLA 1IU2A 4NXQA 1U3BA 4K6YA 3GGEA 4KFVA 3WKMA 2DM8A 3MH7A 3CBZA 4JOFA 2OSGA 4GVDA 1VJ6A 2KJKA 2ZPLA 1Y8TA 5HFCA 3K50A 3FY5A 4NMPA 1WFVA 2MHOA 2LOBA 3QE1A 4JL7A 3LNYA 1B8QA 2KBSA 3GJ9A 4MPAA 2LUIA 1X6DA 2I0IA 4Z33A 3BPUA 2IWOA 1XZ9A 3GCOA 1Q3OA 3OTPA 4NNMA 1N6DA 2EGNA 1KWAA 2CSSA 3CBYA 1N7EA 2RRMA 1UJVA 4Q3HA 2PA1A 2EHRA 1UM7A 2JOAA 4P2AB 1WI2A 1W9OA 1UM1A 3QJNA 3NFKA 3HPKA 3RL7A 4GVCA 3HVQC 3R0HA 1W9EA 1QAVB 4JOKA 4PQWA 3SHUA 5E11A 5FB8C 2EGOA 1LCYA 3SUZA 5F3XA 2KJPA 2KL1A 2P3WA 4JOGA 1V6BA 2OZFA 1UHPA 1X5NA 3PV2A 1QAVA 3I1EA 3R68A 2H3LA 4UU5A 5HEYA 2D90A 4NMQA 2PNTA 2AWWA 4JOJA 2M3MA 1PDRA 2AWXA 3DJ3A 3ID2A 1SOZA 1U37A 1U39A 4NXPA 2DC2A 2JILA 3ID3A 2KPLA 3RLEA 3WKLA 1Z87A 1V1TA 2QKUA 2YT8A 2R3YA 2M0VA 2KYLA 1WF7A 2AWUA 2G5MB 3NFLA 2I0LA 1NF3C 1I16A 2DAZA 2QKVA 2L4TA 1MFGA 2O2TA 2KRGA 4IC6A 2M10A 2H2CA 1QLCA 2VZ5A 2OGPA 1G9OA 2RCZA 3CYYA 1X5RA 2F5YA 2YUBA 1WIFA 1D5GA 1TP3A 1Z86A 2JREA 4F8KA 2LA8A 4G69A 4FGMA 1RGWA 3TMHA 1VB7A 2DLUA 2LC6A 1WJLA 2FN5A 3PDZA 3MH4A 3MH6A 4K75A 5HF4A 4E3BA 2PKTA 2YT7A 3GCNA 2VWRA 1TQ3A 2WL7A 2DJTA 3QO6A 3PDVA 1R6JA 1WH1A 2KOMA 2R4HA 3PV5A 2Z17A 2AINA 2H3MA 1RGRA 2W7RA 3O46A 2QT5A 1KEFA 3TSVA 5I7ZA 1IU0A 3PV4A 4K78A 2JWEA 2EEHA 2KAWA 4Z8JA 3DJAA 2DMZA 5HEDA 2HE4A 1Q7XA 1UJUA 3HPMA 2PDZA 4Q2NA 1V5LA 2FCFA 3GDUA 1L6OA 4JOPA 2OS6A 2EJYA 3VQFA 2EEGA 5FHTA 4K72A 2D92A 2I1NA 2Q3GA 2EDVA 2F0AA 2KA9A 5GLJA 1VAEA 3TSWA 4NMTA 1X5QA 3O5NA 1K32A 1X45A 3QDOA 2PZDA 3QJMA 4REYA 1P1DA 2EXGA 4NMRA 2KOJA 3R69A 1OBXA 3QIKA 1UF1A 5E21A 2IWNA 2ZPMA 3ZRTA 4K76A 2E7KA 3CH8A 2VRFA 2Q9VA 2HE2A 3DORA 2EEJA 1N7FA 1RY4A 4Q6HA 5GNDA 4YDPA 2KJDA 5EYZA 1WF8A 2KG2A 3LNXA 2OPGA 1NTEA 4UU6A 4Q2PA 3JXTA 2UZCA 2QBWA 2VSPA 5HFBA 1SOTA 2DLSA 3CC0A 4HOPB 4NMSA 5HDYA 2GZVA 4WYTA 1N6EA 3E17A 5HFFA 5JXBA 4LMMA 3L4FD 3I18A 5HJ1A 3STJA 2CS5A 1WG6A 1FC6A 1OZIA 1UJDA 1GM1A 2G2LA 5HFDA 3K1RA 3KZDA 4RI0A 2M0ZA 2QKTA 1TP5A 2M0UA 4O06A 2L4SA 2D8IA 5H3JA 3KZEA 2Z9IA 5E6PB 2FE5A 3KHFA 3ID4A 2PKUA 2KV8A 3RL8A 2I04A 1UFXA 2BYGA 2IWPA 5G1DA 3B76A 2K1ZA 1GQ5A 5A2PA 3DJ1A 1FCFA 1V5QA 1UEPA 1FC9A 1QAUA 2V1WA 2KQFA 1BE9A 2VPHA 5HFEA 4N6XA 1KY9A 2KOHA 1OBZA 3EGHC 2EV8A 4JORA 2OMJA 3NGHA 2OCSA 2YUYA 2X7ZA 1Q3PA 2H2BA 1M5ZA 3SHWA 4JOHA 4E35A 4L8NA 1N99A 4Q2OA 4E34A 4KFWA 1ZUBA 1VA8A 4P0CA 1N7TA 2FNEA 5F67A 2VSVA 2K20A
chains in the Genus database with same CATH superfamily
3I4WA 5E1YA 4NMOA 1FC7A 1RZXA 1N6FA 2QG1A 4NNLA 5B6LA 1UEWA 3GSLA 3OU0A 2I6VA 3AXAA 1UEZA 4NXRA 1GQ4A 2EDZA 5HEBA 1YBOA 4NMVA 1U38A 1MC7A 1V62A 2CSJA 2HGAA 3ID1A 4OAJA 4WYUA 2DB5A 3VQGA 5G1EA 2EAQA 5E22A 3QGLA 2V90A 1I92A 5HF1A 3EGGC 1ZOKA 3K82A 1P1EA 4YYXA 2EGKA 2KPKA 5DTHA 2REYA 2LC7A 3PS4A 4R2ZA 1BFEA 1TE0A 2JINA 1X8SA 4OEOA 3NCVA 3CS0A 2I4SA 1OBYA 4H11A 2W4FA 2IWQA 5D13A 4GHNA 1WHAA 2EEIA 1WFGA 4JOEA 3GABA 3DIWA 1UITA 4HOPA 4EDJA 3SOEA 3TSZA 1IHJA 2EDPA 5HETA 4XHVA 1VCWA 1UEQA 2ENOA 1W9QA 2OQSA 4AMHA 2YTWA 5EZ0A 4OEPA 1WHDA 2JXOA 3SFJA 1Y7NA 2MX6A 1WI4A 4Q2QA 3GDSA 2M0TA 3GDVA 4Q6SA 1T2MA 2JIKA 2L97A 3CBXA 2DKRA 1MFLA 1IU2A 4NXQA 1U3BA 4K6YA 3GGEA 4KFVA 3WKMA 2DM8A 3MH7A 3CBZA 4JOFA 2OSGA 4GVDA 1VJ6A 2KJKA 2ZPLA 1X9ZA 1Y8TA 5HFCA 3K50A 3FY5A 4NMPA 1WFVA 2MHOA 2LOBA 3QE1A 4JL7A 3LNYA 1B8QA 2KBSA 3GJ9A 4MPAA 3KDGA 2LUIA 1X6DA 2I0IA 4Z33A 3BPUA 2IWOA 1XZ9A 3GCOA 1Q3OA 3OTPA 4NNMA 1N6DA 2EGNA 1KWAA 2CSSA 3CBYA 1N7EA 2RRMA 1UJVA 4Q3HA 2PA1A 4FLNA 2EHRA 1UM7A 2JOAA 4P2AB 1WI2A 1W9OA 1UM1A 3QJNA 3NFKA 3HPKA 3RL7A 4GVCA 3HVQC 3R0HA 1W9EA 1QAVB 4JOKA 4PQWA 3SHUA 2JSNA 4JJ3A 5E11A 5FB8C 2EGOA 1LCYA 3SUZA 5F3XA 2KJPA 2KL1A 2P3WA 4JOGA 1V6BA 2OZFA 1UHPA 1X5NA 3PV2A 1QAVA 3I1EA 3R68A 2H3LA 4UU5A 5HEYA 2D90A 4NMQA 2PNTA 2AWWA 4JOJA 2M3MA 1PDRA 2AWXA 3DJ3A 3ID2A 1SOZA 1U37A 1U39A 4NXPA 2DC2A 2JILA 3ID3A 2KPLA 3RLEA 3WKLA 1Z87A 5ILBA 1V1TA 2QKUA 2YT8A 2R3YA 4JJ0A 2M0VA 2KYLA 1WF7A 2AWUA 2G5MB 3NFLA 2I0LA 1NF3C 1I16A 2DAZA 2QKVA 2L4TA 1MFGA 2O2TA 2KRGA 4IC6A 2M10A 2H2CA 1QLCA 2VZ5A 2OGPA 1G9OA 2RCZA 3CYYA 1X5RA 2F5YA 2YUBA 1WIFA 1D5GA 1TP3A 1Z86A 2JREA 4F8KA 2LA8A 4G69A 4FGMA 1RGWA 3TMHA 1VB7A 2DLUA 2LC6A 1WJLA 2FN5A 3PDZA 3KDKA 3MH4A 3MH6A 4K75A 5HF4A 4E3BA 2PKTA 2YT7A 3GCNA 2VWRA 1TQ3A 2WL7A 2DJTA 3QO6A 3PDVA 1R6JA 1WH1A 2KOMA 2R4HA 3PV5A 2Z17A 2AINA 2H3MA 1RGRA 2W7RA 3O46A 2QT5A 1KEFA 3TSVA 5I7ZA 1IU0A 3PV4A 4K78A 2JWEA 2EEHA 2KAWA 4Z8JA 3DJAA 2DMZA 5HEDA 2HE4A 1Q7XA 1UJUA 3HPMA 2PDZA 4Q2NA 1V5LA 2FCFA 3GDUA 1L6OA 4JOPA 2OS6A 2EJYA 3VQFA 2EEGA 5FHTA 4K72A 2D92A 2I1NA 2Q3GA 2EDVA 2F0AA 2KA9A 5GLJA 1VAEA 3TSWA 4NMTA 1X5QA 3O5NA 1K32A 1X45A 3QDOA 2PZDA 3QJMA 4REYA 1P1DA 2EXGA 4NMRA 2KOJA 3R69A 1OBXA 3QIKA 1UF1A 5E21A 2IWNA 2ZPMA 3ZRTA 4K76A 2E7KA 3CH8A 2VRFA 2Q9VA 2HE2A 3DORA 2EEJA 1N7FA 1RY4A 4Q6HA 5GNDA 4YDPA 2KJDA 2GEFA 5EYZA 1WF8A 2KG2A 3LNXA 2OPGA 1NTEA 4UU6A 4Q2PA 3JXTA 2UZCA 2QBWA 2VSPA 5HFBA 1SOTA 2DLSA 3CC0A 4HOPB 4NMSA 5HDYA 2GZVA 4WYTA 1N6EA 5IL9A 3E17A 5HFFA 5JXBA 4LMMA 3L4FD 3I18A 5HJ1A 3STJA 2CS5A 1WG6A 1FC6A 1OZIA 1UJDA 1GM1A 2G2LA 5HFDA 3K1RA 3KZDA 4RI0A 2M0ZA 2QKTA 1TP5A 2M0UA 4O06A 2L4SA 2D8IA 5H3JA 3KZEA 2Z9IA 5E6PB 2FE5A 3KHFA 3ID4A 2PKUA 2KV8A 3RL8A 2I04A 1UFXA 2BYGA 2IWPA 5G1DA 3B76A 2K1ZA 5B42A 1GQ5A 5A2PA 3DJ1A 1FCFA 1V5QA 1UEPA 1FC9A 1QAUA 2V1WA 2KQFA 1BE9A 2VPHA 5HFEA 4N6XA 1KY9A 2KOHA 1OBZA 3EGHC 2EV8A 4JORA 2OMJA 3NGHA 2OCSA 2YUYA 2X7ZA 1Q3PA 2H2BA 1M5ZA 3SHWA 4JOHA 4E35A 4L8NA 1N99A 4Q2OA 4E34A 4KFWA 1ZUBA 1VA8A 4P0CA 1N7TA 2FNEA 5F67A 2VSVA 2K20A
chains in the Genus database with same CATH topology
3I4WA 5E1YA 4NMOA 1FC7A 1RZXA 1N6FA 2QG1A 4NNLA 5B6LA 1UEWA 3GSLA 3OU0A 2I6VA 3AXAA 1UEZA 4NXRA 1GQ4A 2EDZA 5HEBA 1YBOA 4NMVA 1U38A 1MC7A 1V62A 2CSJA 2HGAA 3ID1A 4OAJA 4WYUA 2DB5A 3VQGA 5G1EA 2EAQA 5E22A 3QGLA 2V90A 1I92A 5HF1A 3EGGC 1ZOKA 3K82A 1P1EA 4YYXA 2EGKA 2KPKA 5DTHA 2REYA 2LC7A 3PS4A 4R2ZA 1BFEA 1TE0A 2JINA 1X8SA 4OEOA 3NCVA 3CS0A 2I4SA 1OBYA 4H11A 2W4FA 2IWQA 5D13A 4GHNA 1WHAA 2EEIA 1WFGA 4JOEA 3GABA 3DIWA 1UITA 4HOPA 4EDJA 3SOEA 3TSZA 1IHJA 2EDPA 5HETA 4XHVA 1VCWA 1UEQA 2ENOA 1W9QA 2OQSA 4AMHA 2YTWA 5EZ0A 4OEPA 1WHDA 2JXOA 3SFJA 1Y7NA 2MX6A 1WI4A 4Q2QA 3GDSA 2M0TA 3GDVA 4Q6SA 1T2MA 2JIKA 2L97A 3CBXA 2DKRA 1MFLA 1IU2A 4NXQA 1U3BA 4K6YA 3GGEA 4KFVA 3WKMA 2DM8A 3MH7A 3CBZA 4JOFA 2OSGA 4GVDA 1VJ6A 2KJKA 2ZPLA 1X9ZA 1Y8TA 5HFCA 3K50A 3FY5A 4NMPA 1WFVA 2MHOA 2LOBA 3QE1A 4JL7A 3LNYA 1B8QA 2KBSA 3GJ9A 4MPAA 3KDGA 2LUIA 1X6DA 2I0IA 4Z33A 3BPUA 2IWOA 1XZ9A 3GCOA 1Q3OA 3OTPA 4NNMA 1N6DA 2EGNA 1KWAA 2CSSA 3CBYA 1N7EA 2RRMA 1UJVA 4Q3HA 2PA1A 4FLNA 2EHRA 1UM7A 2JOAA 4P2AB 1WI2A 1W9OA 1UM1A 3QJNA 3NFKA 3HPKA 3RL7A 4GVCA 3HVQC 3R0HA 1W9EA 1QAVB 4JOKA 4PQWA 3SHUA 2JSNA 4JJ3A 5E11A 5FB8C 2EGOA 1LCYA 3SUZA 5F3XA 2KJPA 2KL1A 2P3WA 4JOGA 1V6BA 2OZFA 1UHPA 1X5NA 3PV2A 1QAVA 3I1EA 3R68A 2H3LA 4UU5A 5HEYA 2D90A 4NMQA 2PNTA 2AWWA 4JOJA 2M3MA 1PDRA 2AWXA 3DJ3A 3ID2A 1SOZA 1U37A 1U39A 4NXPA 2DC2A 2JILA 3ID3A 2KPLA 3RLEA 3WKLA 1Z87A 5ILBA 1V1TA 2QKUA 2YT8A 2R3YA 4JJ0A 2M0VA 2KYLA 1WF7A 2AWUA 2G5MB 3NFLA 2I0LA 1NF3C 1I16A 2DAZA 2QKVA 2L4TA 1MFGA 2O2TA 2KRGA 4IC6A 2M10A 2H2CA 1QLCA 2VZ5A 2OGPA 1G9OA 2RCZA 3CYYA 1X5RA 2F5YA 2YUBA 1WIFA 1D5GA 1TP3A 1Z86A 2JREA 4F8KA 2LA8A 4G69A 4FGMA 1RGWA 3TMHA 1VB7A 2DLUA 2LC6A 1WJLA 2FN5A 3PDZA 3KDKA 3MH4A 3MH6A 4K75A 5HF4A 4E3BA 2PKTA 2YT7A 3GCNA 2VWRA 1TQ3A 2WL7A 2DJTA 3QO6A 3PDVA 1R6JA 1WH1A 2KOMA 2R4HA 3PV5A 2Z17A 2AINA 2H3MA 1RGRA 2W7RA 3O46A 2QT5A 1KEFA 3TSVA 5I7ZA 1IU0A 3PV4A 4K78A 2JWEA 2EEHA 2KAWA 4Z8JA 3DJAA 2DMZA 5HEDA 2HE4A 1Q7XA 1UJUA 3HPMA 2PDZA 4Q2NA 1V5LA 2FCFA 3GDUA 1L6OA 4JOPA 2OS6A 2EJYA 3VQFA 2EEGA 5FHTA 4K72A 2D92A 2I1NA 2Q3GA 2EDVA 2F0AA 2KA9A 5GLJA 1VAEA 3TSWA 4NMTA 1X5QA 3O5NA 1K32A 1X45A 3QDOA 2PZDA 3QJMA 4REYA 1P1DA 2EXGA 4NMRA 2KOJA 3R69A 1OBXA 3QIKA 1UF1A 5E21A 2IWNA 2ZPMA 3ZRTA 4K76A 2E7KA 3CH8A 2VRFA 2Q9VA 2HE2A 3DORA 2EEJA 1N7FA 1RY4A 4Q6HA 5GNDA 4YDPA 2KJDA 2GEFA 5EYZA 1WF8A 2KG2A 3LNXA 2OPGA 1NTEA 4UU6A 4Q2PA 3JXTA 2UZCA 2QBWA 2VSPA 5HFBA 1SOTA 2DLSA 3CC0A 4HOPB 4NMSA 5HDYA 2GZVA 4WYTA 1N6EA 5IL9A 3E17A 5HFFA 5JXBA 4LMMA 3L4FD 3I18A 5HJ1A 3STJA 2CS5A 1WG6A 1FC6A 1OZIA 1UJDA 1GM1A 2G2LA 5HFDA 3K1RA 3KZDA 4RI0A 2M0ZA 2QKTA 1TP5A 2M0UA 4O06A 2L4SA 2D8IA 5H3JA 3KZEA 2Z9IA 5E6PB 2FE5A 3KHFA 3ID4A 2PKUA 2KV8A 3RL8A 2I04A 1UFXA 2BYGA 2IWPA 5G1DA 3B76A 2K1ZA 5B42A 1GQ5A 5A2PA 3DJ1A 1FCFA 1V5QA 1UEPA 1FC9A 1QAUA 2V1WA 2KQFA 1BE9A 2VPHA 5HFEA 4N6XA 1KY9A 2KOHA 1OBZA 3EGHC 2EV8A 4JORA 2OMJA 3NGHA 2OCSA 2YUYA 2X7ZA 1Q3PA 2H2BA 1M5ZA 3SHWA 4JOHA 4E35A 4L8NA 1N99A 4Q2OA 4E34A 4KFWA 1ZUBA 1VA8A 4P0CA 1N7TA 2FNEA 5F67A 2VSVA 2K20A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4W A;  5E1Y A;  4NMO A;  1FC7 A;  1RZX A;  1N6F A;  2QG1 A;  4NNL A;  5B6L A;  1UEW A;  3GSL A;  3OU0 A;  2I6V A;  3AXA A;  1UEZ A;  4NXR A;  1GQ4 A;  2EDZ A;  5HEB A;  1YBO A;  4NMV A;  1U38 A;  1MC7 A;  1V62 A;  2CSJ A;  2HGA A;  3ID1 A;  4OAJ A;  4WYU A;  2DB5 A;  3VQG A;  5G1E A;  2EAQ A;  5E22 A;  3QGL A;  2V90 A;  1I92 A;  5HF1 A;  3EGG C;  1ZOK A;  3K82 A;  1P1E A;  4YYX A;  2EGK A;  2KPK A;  5DTH A;  2REY A;  2LC7 A;  3PS4 A;  4R2Z A;  1BFE A;  1TE0 A;  2JIN A;  1X8S A;  4OEO A;  3CS0 A;  2I4S A;  1OBY A;  4H11 A;  2W4F A;  2IWQ A;  5D13 A;  4GHN A;  1WHA A;  2EEI A;  1WFG A;  4JOE A;  3DIW A;  1UIT A;  4HOP A;  4EDJ A;  3SOE A;  3TSZ A;  1IHJ A;  2EDP A;  5HET A;  4XHV A;  1VCW A;  1UEQ A;  2ENO A;  1W9Q A;  2OQS A;  4AMH A;  2YTW A;  5EZ0 A;  4OEP A;  1WHD A;  2JXO A;  3SFJ A;  1Y7N A;  2MX6 A;  1WI4 A;  4Q2Q A;  3GDS A;  2M0T A;  3GDV A;  4Q6S A;  1T2M A;  2JIK A;  2L97 A;  3CBX A;  2DKR A;  1MFL A;  1IU2 A;  4NXQ A;  1U3B A;  4K6Y A;  3GGE A;  4KFV A;  3WKM A;  2DM8 A;  3MH7 A;  3CBZ A;  4JOF A;  2OSG A;  4GVD A;  1VJ6 A;  2KJK A;  2ZPL A;  1Y8T A;  5HFC A;  3K50 A;  3FY5 A;  4NMP A;  1WFV A;  2MHO A;  2LOB A;  3QE1 A;  4JL7 A;  3LNY A;  1B8Q A;  2KBS A;  3GJ9 A;  4MPA A;  2LUI A;  1X6D A;  2I0I A;  4Z33 A;  3BPU A;  2IWO A;  1XZ9 A;  3GCO A;  1Q3O A;  3OTP A;  4NNM A;  1N6D A;  2EGN A;  1KWA A;  2CSS A;  3CBY A;  1N7E A;  2RRM A;  1UJV A;  4Q3H A;  2PA1 A;  2EHR A;  1UM7 A;  2JOA A;  4P2A B;  1WI2 A;  1W9O A;  1UM1 A;  3QJN A;  3NFK A;  3HPK A;  3RL7 A;  4GVC A;  3HVQ C;  3R0H A;  1W9E A;  1QAV B;  4JOK A;  4PQW A;  3SHU A;  5E11 A;  5FB8 C;  2EGO A;  1LCY A;  3SUZ A;  5F3X A;  2KJP A;  2KL1 A;  2P3W A;  4JOG A;  1V6B A;  2OZF A;  1UHP A;  1X5N A;  3PV2 A;  1QAV A;  3I1E A;  3R68 A;  2H3L A;  4UU5 A;  5HEY A;  2D90 A;  4NMQ A;  2PNT A;  2AWW A;  4JOJ A;  2M3M A;  1PDR A;  2AWX A;  3DJ3 A;  3ID2 A;  1SOZ A;  1U37 A;  1U39 A;  4NXP A;  2DC2 A;  2JIL A;  3ID3 A;  2KPL A;  3RLE A;  3WKL A;  1Z87 A;  1V1T A;  2QKU A;  2YT8 A;  2R3Y A;  2M0V A;  2KYL A;  1WF7 A;  2AWU A;  2G5M B;  3NFL A;  2I0L A;  1NF3 C;  1I16 A;  2DAZ A;  2QKV A;  2L4T A;  1MFG A;  2O2T A;  2KRG A;  4IC6 A;  2M10 A;  2H2C A;  1QLC A;  2VZ5 A;  2OGP A;  1G9O A;  2RCZ A;  3CYY A;  1X5R A;  2F5Y A;  2YUB A;  1WIF A;  1D5G A;  1TP3 A;  1Z86 A;  2JRE A;  4F8K A;  2LA8 A;  4G69 A;  4FGM A;  1RGW A;  3TMH A;  1VB7 A;  2DLU A;  2LC6 A;  1WJL A;  2FN5 A;  3PDZ A;  3MH4 A;  3MH6 A;  4K75 A;  5HF4 A;  4E3B A;  2PKT A;  2YT7 A;  3GCN A;  2VWR A;  1TQ3 A;  2WL7 A;  2DJT A;  3QO6 A;  3PDV A;  1R6J A;  1WH1 A;  2KOM A;  2R4H A;  3PV5 A;  2Z17 A;  2AIN A;  2H3M A;  1RGR A;  2W7R A;  3O46 A;  2QT5 A;  1KEF A;  3TSV A;  5I7Z A;  1IU0 A;  3PV4 A;  4K78 A;  2JWE A;  2EEH A;  2KAW A;  4Z8J A;  3DJA A;  2DMZ A;  5HED A;  2HE4 A;  1Q7X A;  1UJU A;  3HPM A;  2PDZ A;  4Q2N A;  1V5L A;  2FCF A;  3GDU A;  1L6O A;  4JOP A;  2OS6 A;  2EJY A;  3VQF A;  2EEG A;  5FHT A;  4K72 A;  2D92 A;  2I1N A;  2Q3G A;  2EDV A;  2F0A A;  2KA9 A;  5GLJ A;  1VAE A;  3TSW A;  4NMT A;  1X5Q A;  3O5N A;  1K32 A;  1X45 A;  3QDO A;  2PZD A;  3QJM A;  4REY A;  1P1D A;  2EXG A;  4NMR A;  2KOJ A;  3R69 A;  1OBX A;  3QIK A;  1UF1 A;  5E21 A;  2IWN A;  2ZPM A;  3ZRT A;  4K76 A;  2E7K A;  3CH8 A;  2VRF A;  2Q9V A;  2HE2 A;  3DOR A;  2EEJ A;  1N7F A;  1RY4 A;  4Q6H A;  5GND A;  4YDP A;  2KJD A;  5EYZ A;  1WF8 A;  2KG2 A;  3LNX A;  2OPG A;  1NTE A;  4UU6 A;  4Q2P A;  3JXT A;  2UZC A;  2QBW A;  2VSP A;  5HFB A;  1SOT A;  2DLS A;  3CC0 A;  4HOP B;  4NMS A;  5HDY A;  2GZV A;  4WYT A;  1N6E A;  3E17 A;  5HFF A;  5JXB A;  4LMM A;  3L4F D;  3I18 A;  5HJ1 A;  3STJ A;  2CS5 A;  1WG6 A;  1FC6 A;  1OZI A;  1UJD A;  1GM1 A;  2G2L A;  5HFD A;  3K1R A;  3KZD A;  4RI0 A;  2M0Z A;  2QKT A;  1TP5 A;  2M0U A;  4O06 A;  2L4S A;  2D8I A;  5H3J A;  3KZE A;  2Z9I A;  5E6P B;  2FE5 A;  3KHF A;  3ID4 A;  2PKU A;  2KV8 A;  3RL8 A;  2I04 A;  1UFX A;  2BYG A;  2IWP A;  5G1D A;  3B76 A;  2K1Z A;  1GQ5 A;  5A2P A;  3DJ1 A;  1FCF A;  1V5Q A;  1UEP A;  1FC9 A;  1QAU A;  2V1W A;  2KQF A;  1BE9 A;  2VPH A;  5HFE A;  4N6X A;  1KY9 A;  2KOH A;  1OBZ A;  3EGH C;  2EV8 A;  4JOR A;  2OMJ A;  3NGH A;  2OCS A;  2YUY A;  2X7Z A;  1Q3P A;  2H2B A;  1M5Z A;  3SHW A;  4JOH A;  4E35 A;  4L8N A;  1N99 A;  4Q2O A;  4E34 A;  4KFW A;  1ZUB A;  1VA8 A;  4P0C A;  1N7T A;  2FNE A;  5F67 A;  2VSV A;  2K20 A; 
#chains in the Genus database with same CATH topology
 3I4W A;  5E1Y A;  4NMO A;  1FC7 A;  1RZX A;  1N6F A;  2QG1 A;  4NNL A;  5B6L A;  1UEW A;  3GSL A;  3OU0 A;  2I6V A;  3AXA A;  1UEZ A;  4NXR A;  1GQ4 A;  2EDZ A;  5HEB A;  1YBO A;  4NMV A;  1U38 A;  1MC7 A;  1V62 A;  2CSJ A;  2HGA A;  3ID1 A;  4OAJ A;  4WYU A;  2DB5 A;  3VQG A;  5G1E A;  2EAQ A;  5E22 A;  3QGL A;  2V90 A;  1I92 A;  5HF1 A;  3EGG C;  1ZOK A;  3K82 A;  1P1E A;  4YYX A;  2EGK A;  2KPK A;  5DTH A;  2REY A;  2LC7 A;  3PS4 A;  4R2Z A;  1BFE A;  1TE0 A;  2JIN A;  1X8S A;  4OEO A;  3NCV A;  3CS0 A;  2I4S A;  1OBY A;  4H11 A;  2W4F A;  2IWQ A;  5D13 A;  4GHN A;  1WHA A;  2EEI A;  1WFG A;  4JOE A;  3GAB A;  3DIW A;  1UIT A;  4HOP A;  4EDJ A;  3SOE A;  3TSZ A;  1IHJ A;  2EDP A;  5HET A;  4XHV A;  1VCW A;  1UEQ A;  2ENO A;  1W9Q A;  2OQS A;  4AMH A;  2YTW A;  5EZ0 A;  4OEP A;  1WHD A;  2JXO A;  3SFJ A;  1Y7N A;  2MX6 A;  1WI4 A;  4Q2Q A;  3GDS A;  2M0T A;  3GDV A;  4Q6S A;  1T2M A;  2JIK A;  2L97 A;  3CBX A;  2DKR A;  1MFL A;  1IU2 A;  4NXQ A;  1U3B A;  4K6Y A;  3GGE A;  4KFV A;  3WKM A;  2DM8 A;  3MH7 A;  3CBZ A;  4JOF A;  2OSG A;  4GVD A;  1VJ6 A;  2KJK A;  2ZPL A;  1X9Z A;  1Y8T A;  5HFC A;  3K50 A;  3FY5 A;  4NMP A;  1WFV A;  2MHO A;  2LOB A;  3QE1 A;  4JL7 A;  3LNY A;  1B8Q A;  2KBS A;  3GJ9 A;  4MPA A;  3KDG A;  2LUI A;  1X6D A;  2I0I A;  4Z33 A;  3BPU A;  2IWO A;  1XZ9 A;  3GCO A;  1Q3O A;  3OTP A;  4NNM A;  1N6D A;  2EGN A;  1KWA A;  2CSS A;  3CBY A;  1N7E A;  2RRM A;  1UJV A;  4Q3H A;  2PA1 A;  4FLN A;  2EHR A;  1UM7 A;  2JOA A;  4P2A B;  1WI2 A;  1W9O A;  1UM1 A;  3QJN A;  3NFK A;  3HPK A;  3RL7 A;  4GVC A;  3HVQ C;  3R0H A;  1W9E A;  1QAV B;  4JOK A;  4PQW A;  3SHU A;  2JSN A;  4JJ3 A;  5E11 A;  5FB8 C;  2EGO A;  1LCY A;  3SUZ A;  5F3X A;  2KJP A;  2KL1 A;  2P3W A;  4JOG A;  1V6B A;  2OZF A;  1UHP A;  1X5N A;  3PV2 A;  1QAV A;  3I1E A;  3R68 A;  2H3L A;  4UU5 A;  5HEY A;  2D90 A;  4NMQ A;  2PNT A;  2AWW A;  4JOJ A;  2M3M A;  1PDR A;  2AWX A;  3DJ3 A;  3ID2 A;  1SOZ A;  1U37 A;  1U39 A;  4NXP A;  2DC2 A;  2JIL A;  3ID3 A;  2KPL A;  3RLE A;  3WKL A;  1Z87 A;  5ILB A;  1V1T A;  2QKU A;  2YT8 A;  2R3Y A;  4JJ0 A;  2M0V A;  2KYL A;  1WF7 A;  2AWU A;  2G5M B;  3NFL A;  2I0L A;  1NF3 C;  1I16 A;  2DAZ A;  2QKV A;  2L4T A;  1MFG A;  2O2T A;  2KRG A;  4IC6 A;  2M10 A;  2H2C A;  1QLC A;  2VZ5 A;  2OGP A;  1G9O A;  2RCZ A;  3CYY A;  1X5R A;  2F5Y A;  2YUB A;  1WIF A;  1D5G A;  1TP3 A;  1Z86 A;  2JRE A;  4F8K A;  2LA8 A;  4G69 A;  4FGM A;  1RGW A;  3TMH A;  1VB7 A;  2DLU A;  2LC6 A;  1WJL A;  2FN5 A;  3PDZ A;  3KDK A;  3MH4 A;  3MH6 A;  4K75 A;  5HF4 A;  4E3B A;  2PKT A;  2YT7 A;  3GCN A;  2VWR A;  1TQ3 A;  2WL7 A;  2DJT A;  3QO6 A;  3PDV A;  1R6J A;  1WH1 A;  2KOM A;  2R4H A;  3PV5 A;  2Z17 A;  2AIN A;  2H3M A;  1RGR A;  2W7R A;  3O46 A;  2QT5 A;  1KEF A;  3TSV A;  5I7Z A;  1IU0 A;  3PV4 A;  4K78 A;  2JWE A;  2EEH A;  2KAW A;  4Z8J A;  3DJA A;  2DMZ A;  5HED A;  2HE4 A;  1Q7X A;  1UJU A;  3HPM A;  2PDZ A;  4Q2N A;  1V5L A;  2FCF A;  3GDU A;  1L6O A;  4JOP A;  2OS6 A;  2EJY A;  3VQF A;  2EEG A;  5FHT A;  4K72 A;  2D92 A;  2I1N A;  2Q3G A;  2EDV A;  2F0A A;  2KA9 A;  5GLJ A;  1VAE A;  3TSW A;  4NMT A;  1X5Q A;  3O5N A;  1K32 A;  1X45 A;  3QDO A;  2PZD A;  3QJM A;  4REY A;  1P1D A;  2EXG A;  4NMR A;  2KOJ A;  3R69 A;  1OBX A;  3QIK A;  1UF1 A;  5E21 A;  2IWN A;  2ZPM A;  3ZRT A;  4K76 A;  2E7K A;  3CH8 A;  2VRF A;  2Q9V A;  2HE2 A;  3DOR A;  2EEJ A;  1N7F A;  1RY4 A;  4Q6H A;  5GND A;  4YDP A;  2KJD A;  2GEF A;  5EYZ A;  1WF8 A;  2KG2 A;  3LNX A;  2OPG A;  1NTE A;  4UU6 A;  4Q2P A;  3JXT A;  2UZC A;  2QBW A;  2VSP A;  5HFB A;  1SOT A;  2DLS A;  3CC0 A;  4HOP B;  4NMS A;  5HDY A;  2GZV A;  4WYT A;  1N6E A;  5IL9 A;  3E17 A;  5HFF A;  5JXB A;  4LMM A;  3L4F D;  3I18 A;  5HJ1 A;  3STJ A;  2CS5 A;  1WG6 A;  1FC6 A;  1OZI A;  1UJD A;  1GM1 A;  2G2L A;  5HFD A;  3K1R A;  3KZD A;  4RI0 A;  2M0Z A;  2QKT A;  1TP5 A;  2M0U A;  4O06 A;  2L4S A;  2D8I A;  5H3J A;  3KZE A;  2Z9I A;  5E6P B;  2FE5 A;  3KHF A;  3ID4 A;  2PKU A;  2KV8 A;  3RL8 A;  2I04 A;  1UFX A;  2BYG A;  2IWP A;  5G1D A;  3B76 A;  2K1Z A;  5B42 A;  1GQ5 A;  5A2P A;  3DJ1 A;  1FCF A;  1V5Q A;  1UEP A;  1FC9 A;  1QAU A;  2V1W A;  2KQF A;  1BE9 A;  2VPH A;  5HFE A;  4N6X A;  1KY9 A;  2KOH A;  1OBZ A;  3EGH C;  2EV8 A;  4JOR A;  2OMJ A;  3NGH A;  2OCS A;  2YUY A;  2X7Z A;  1Q3P A;  2H2B A;  1M5Z A;  3SHW A;  4JOH A;  4E35 A;  4L8N A;  1N99 A;  4Q2O A;  4E34 A;  4KFW A;  1ZUB A;  1VA8 A;  4P0C A;  1N7T A;  2FNE A;  5F67 A;  2VSV A;  2K20 A; 
#chains in the Genus database with same CATH homology
 3I4W A;  5E1Y A;  4NMO A;  1FC7 A;  1RZX A;  1N6F A;  2QG1 A;  4NNL A;  5B6L A;  1UEW A;  3GSL A;  3OU0 A;  2I6V A;  3AXA A;  1UEZ A;  4NXR A;  1GQ4 A;  2EDZ A;  5HEB A;  1YBO A;  4NMV A;  1U38 A;  1MC7 A;  1V62 A;  2CSJ A;  2HGA A;  3ID1 A;  4OAJ A;  4WYU A;  2DB5 A;  3VQG A;  5G1E A;  2EAQ A;  5E22 A;  3QGL A;  2V90 A;  1I92 A;  5HF1 A;  3EGG C;  1ZOK A;  3K82 A;  1P1E A;  4YYX A;  2EGK A;  2KPK A;  5DTH A;  2REY A;  2LC7 A;  3PS4 A;  4R2Z A;  1BFE A;  1TE0 A;  2JIN A;  1X8S A;  4OEO A;  3NCV A;  3CS0 A;  2I4S A;  1OBY A;  4H11 A;  2W4F A;  2IWQ A;  5D13 A;  4GHN A;  1WHA A;  2EEI A;  1WFG A;  4JOE A;  3GAB A;  3DIW A;  1UIT A;  4HOP A;  4EDJ A;  3SOE A;  3TSZ A;  1IHJ A;  2EDP A;  5HET A;  4XHV A;  1VCW A;  1UEQ A;  2ENO A;  1W9Q A;  2OQS A;  4AMH A;  2YTW A;  5EZ0 A;  4OEP A;  1WHD A;  2JXO A;  3SFJ A;  1Y7N A;  2MX6 A;  1WI4 A;  4Q2Q A;  3GDS A;  2M0T A;  3GDV A;  4Q6S A;  1T2M A;  2JIK A;  2L97 A;  3CBX A;  2DKR A;  1MFL A;  1IU2 A;  4NXQ A;  1U3B A;  4K6Y A;  3GGE A;  4KFV A;  3WKM A;  2DM8 A;  3MH7 A;  3CBZ A;  4JOF A;  2OSG A;  4GVD A;  1VJ6 A;  2KJK A;  2ZPL A;  1X9Z A;  1Y8T A;  5HFC A;  3K50 A;  3FY5 A;  4NMP A;  1WFV A;  2MHO A;  2LOB A;  3QE1 A;  4JL7 A;  3LNY A;  1B8Q A;  2KBS A;  3GJ9 A;  4MPA A;  3KDG A;  2LUI A;  1X6D A;  2I0I A;  4Z33 A;  3BPU A;  2IWO A;  1XZ9 A;  3GCO A;  1Q3O A;  3OTP A;  4NNM A;  1N6D A;  2EGN A;  1KWA A;  2CSS A;  3CBY A;  1N7E A;  2RRM A;  1UJV A;  4Q3H A;  2PA1 A;  4FLN A;  2EHR A;  1UM7 A;  2JOA A;  4P2A B;  1WI2 A;  1W9O A;  1UM1 A;  3QJN A;  3NFK A;  3HPK A;  3RL7 A;  4GVC A;  3HVQ C;  3R0H A;  1W9E A;  1QAV B;  4JOK A;  4PQW A;  3SHU A;  2JSN A;  4JJ3 A;  5E11 A;  5FB8 C;  2EGO A;  1LCY A;  3SUZ A;  5F3X A;  2KJP A;  2KL1 A;  2P3W A;  4JOG A;  1V6B A;  2OZF A;  1UHP A;  1X5N A;  3PV2 A;  1QAV A;  3I1E A;  3R68 A;  2H3L A;  4UU5 A;  5HEY A;  2D90 A;  4NMQ A;  2PNT A;  2AWW A;  4JOJ A;  2M3M A;  1PDR A;  2AWX A;  3DJ3 A;  3ID2 A;  1SOZ A;  1U37 A;  1U39 A;  4NXP A;  2DC2 A;  2JIL A;  3ID3 A;  2KPL A;  3RLE A;  3WKL A;  1Z87 A;  5ILB A;  1V1T A;  2QKU A;  2YT8 A;  2R3Y A;  4JJ0 A;  2M0V A;  2KYL A;  1WF7 A;  2AWU A;  2G5M B;  3NFL A;  2I0L A;  1NF3 C;  1I16 A;  2DAZ A;  2QKV A;  2L4T A;  1MFG A;  2O2T A;  2KRG A;  4IC6 A;  2M10 A;  2H2C A;  1QLC A;  2VZ5 A;  2OGP A;  1G9O A;  2RCZ A;  3CYY A;  1X5R A;  2F5Y A;  2YUB A;  1WIF A;  1D5G A;  1TP3 A;  1Z86 A;  2JRE A;  4F8K A;  2LA8 A;  4G69 A;  4FGM A;  1RGW A;  3TMH A;  1VB7 A;  2DLU A;  2LC6 A;  1WJL A;  2FN5 A;  3PDZ A;  3KDK A;  3MH4 A;  3MH6 A;  4K75 A;  5HF4 A;  4E3B A;  2PKT A;  2YT7 A;  3GCN A;  2VWR A;  1TQ3 A;  2WL7 A;  2DJT A;  3QO6 A;  3PDV A;  1R6J A;  1WH1 A;  2KOM A;  2R4H A;  3PV5 A;  2Z17 A;  2AIN A;  2H3M A;  1RGR A;  2W7R A;  3O46 A;  2QT5 A;  1KEF A;  3TSV A;  5I7Z A;  1IU0 A;  3PV4 A;  4K78 A;  2JWE A;  2EEH A;  2KAW A;  4Z8J A;  3DJA A;  2DMZ A;  5HED A;  2HE4 A;  1Q7X A;  1UJU A;  3HPM A;  2PDZ A;  4Q2N A;  1V5L A;  2FCF A;  3GDU A;  1L6O A;  4JOP A;  2OS6 A;  2EJY A;  3VQF A;  2EEG A;  5FHT A;  4K72 A;  2D92 A;  2I1N A;  2Q3G A;  2EDV A;  2F0A A;  2KA9 A;  5GLJ A;  1VAE A;  3TSW A;  4NMT A;  1X5Q A;  3O5N A;  1K32 A;  1X45 A;  3QDO A;  2PZD A;  3QJM A;  4REY A;  1P1D A;  2EXG A;  4NMR A;  2KOJ A;  3R69 A;  1OBX A;  3QIK A;  1UF1 A;  5E21 A;  2IWN A;  2ZPM A;  3ZRT A;  4K76 A;  2E7K A;  3CH8 A;  2VRF A;  2Q9V A;  2HE2 A;  3DOR A;  2EEJ A;  1N7F A;  1RY4 A;  4Q6H A;  5GND A;  4YDP A;  2KJD A;  2GEF A;  5EYZ A;  1WF8 A;  2KG2 A;  3LNX A;  2OPG A;  1NTE A;  4UU6 A;  4Q2P A;  3JXT A;  2UZC A;  2QBW A;  2VSP A;  5HFB A;  1SOT A;  2DLS A;  3CC0 A;  4HOP B;  4NMS A;  5HDY A;  2GZV A;  4WYT A;  1N6E A;  5IL9 A;  3E17 A;  5HFF A;  5JXB A;  4LMM A;  3L4F D;  3I18 A;  5HJ1 A;  3STJ A;  2CS5 A;  1WG6 A;  1FC6 A;  1OZI A;  1UJD A;  1GM1 A;  2G2L A;  5HFD A;  3K1R A;  3KZD A;  4RI0 A;  2M0Z A;  2QKT A;  1TP5 A;  2M0U A;  4O06 A;  2L4S A;  2D8I A;  5H3J A;  3KZE A;  2Z9I A;  5E6P B;  2FE5 A;  3KHF A;  3ID4 A;  2PKU A;  2KV8 A;  3RL8 A;  2I04 A;  1UFX A;  2BYG A;  2IWP A;  5G1D A;  3B76 A;  2K1Z A;  5B42 A;  1GQ5 A;  5A2P A;  3DJ1 A;  1FCF A;  1V5Q A;  1UEP A;  1FC9 A;  1QAU A;  2V1W A;  2KQF A;  1BE9 A;  2VPH A;  5HFE A;  4N6X A;  1KY9 A;  2KOH A;  1OBZ A;  3EGH C;  2EV8 A;  4JOR A;  2OMJ A;  3NGH A;  2OCS A;  2YUY A;  2X7Z A;  1Q3P A;  2H2B A;  1M5Z A;  3SHW A;  4JOH A;  4E35 A;  4L8N A;  1N99 A;  4Q2O A;  4E34 A;  4KFW A;  1ZUB A;  1VA8 A;  4P0C A;  1N7T A;  2FNE A;  5F67 A;  2VSV A;  2K20 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...