2UZCA

Structure of human pdlim5 in complex with the c-terminal peptide of human alpha-actinin-1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
87
structure length
87
Chain Sequence
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVLSIDGINAQGMTHLEAQNKIKGCTGSLNMTLQRESDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ AND LIM DOMAIN 5
publication title Unusual binding interactions in PDZ domain crystal structures help explain binding mechanisms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 87
sequence length 87
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2uzcA00
2KPKA 2DMZA 1WF8A 2HE2A 2KPLA 1RGWA 2PDZA 5HFEA 2KV8A 1XZ9A 2FE5A 2M0VA 1VCWA 4JOFA 2DLUA 2HGAA 2M0UA 3MH4A 2DB5A 4NNMA 2WL7A 1P1DA 1ZOKA 4NMRA 3RL7A 4Q6SA 5HFFA 2KOJA 5E1YA 5HDYA 2QKUA 1D5GA 4K78A 3I4WA 1UEPA 2GZVA 2W4FA 1W9OA 3I1EA 3DJ3A 2M3MA 5G1EA 3ID4A 2Z9IA 4H11A 4KFWA 2OGPA 3GCOA 2D90A 3HPKA 5HF1A 4NMPA 4JOPA 1MFLA 3PV4A 3HVQC 3STJA 1FC9A 2VZ5A 4Q2QA 5D13A 4GVCA 4LMMA 2YT7A 1X8SA 5H3JA 3SUZA 2EJYA 1M5ZA 1RY4A 1SOTA 1W9EA 3PDVA 1N6DA 4NMTA 1N7TA 1Z87A 3B76A 5JXBA 1BFEA 2OZFA 2MX6A 3RL8A 2W7RA 5E21A 1WJLA 2KG2A 2KRGA 2EDVA 2I1NA 1WFVA 4NMVA 1IHJA 2CSSA 1FC6A 1WHAA 2EEHA 1OBZA 1Y7NA 3PDZA 2EEGA 2P3WA 2KA9A 4UU6A 3FY5A 2ZPMA 2FCFA 1KWAA 5I7ZA 3GGEA 4JORA 4Z8JA 2EGOA 3E17A 3DORA 4UU5A 1WIFA 2DLSA 2KOHA 2QBWA 1Y8TA 4GHNA 5HFDA 1G9OA 2IWNA 2DKRA 1IU0A 4JOHA 5EZ0A 3ID3A 3QE1A 4OEPA 3TSZA 5G1DA 1MC7A 1UFXA 2Z17A 2DC2A 3DJAA 1FC7A 2R3YA 3ID2A 4L8NA 4NNLA 5DTHA 3PS4A 1N99A 3K1RA 2YUYA 2VSVA 4P0CA 1OBXA 3O46A 1RZXA 3GDVA 1V6BA 2OQSA 2ZPLA 4NMQA 2Q3GA 1FCFA 1UJVA 1NF3C 1UHPA 1WHDA 4IC6A 4OEOA 2V1WA 2KOMA 1ZUBA 2KJKA 2REYA 1BE9A 2M0ZA 3QJMA 3OU0A 4Q2OA 1Q7XA 3I18A 1I16A 3CBYA 1UM7A 5HEBA 3PV5A 4K76A 2VSPA 3QDOA 3HPMA 2QG1A 2EXGA 5GLJA 4EDJA 4XHVA 2HE4A 2CS5A 3R0HA 1UJUA 1V5QA 5HFBA 3AXAA 4OAJA 3CS0A 2VWRA 4JOGA 3DJ1A 4RI0A 3MH6A 2CSJA 2EHRA 3QGLA 3WKMA 2EAQA 2DJTA 2YT8A 2I0IA 2G5MB 4E35A 3SHWA 2PKUA 1N6EA 4Q2NA 2I04A 2KL1A 4AMHA 4NMSA 2VPHA 3K50A 4NXQA 2JIKA 1UJDA 1V62A 3GCNA 1TP5A 2YUBA 2H3MA 1QLCA 5F67A 2LUIA 1GQ5A 2JILA 3GDUA 4N6XA 3VQGA 2EGNA 1I92A 1WFGA 2LC6A 4JOJA 2K20A 1VB7A 2H2BA 4HOPB 2KJPA 2I0LA 4Q3HA 3CYYA 2IWPA 4KFVA 3VQFA 4NXPA 3SFJA 3NGHA 3WKLA 1OBYA 2JREA 4Q2PA 2LOBA 3NFKA 2F5YA 2PZDA 3CBZA 3KZEA 2L4SA 1VAEA 1UITA 3CC0A 1WI2A 2E7KA 2D92A 3R68A 1TE0A 2AWUA 3GDSA 2AWWA 2PNTA 2O2TA 3OTPA 2H3LA 2JWEA 2JOAA 3KZDA 4O06A 3LNYA 2KBSA 3QO6A 4JL7A 2Q9VA 4WYUA 1UF1A 2EDZA 1SOZA 4NXRA 3JXTA 2VRFA 4K6YA 2PKTA 1U37A 2I4SA 2EEJA 1QAVB 1TP3A 2LA8A 1RGRA 5HFCA 1V5LA 1L6OA 1V1TA 2QKVA 2MHOA 1Q3OA 1OZIA 1TQ3A 2PA1A 1N7EA 4YDPA 3KHFA 1U3BA 1UM1A 1QAVA 3SOEA 3PV2A 1VA8A 3MH7A 2RRMA 2K1ZA 1X45A 3NFLA 2H2CA 3SHUA 1Z86A 1UEZA 2M0TA 3CH8A 2AINA 5HEDA 5A2PA 4P2AB 2D8IA 2F0AA 2OPGA 4E3BA 1U39A 1LCYA 2FNEA 2QT5A 4REYA 3GSLA 2L4TA 1N6FA 4K72A 4NMOA 3L4FD 1X5QA 2YTWA 3EGGC 2DM8A 4WYTA 1NTEA 2IWQA 3EGHC 1UEWA 5E6PB 2EGKA 1UEQA 5HEYA 4E34A 1X6DA 1PDRA 3TSWA 5E22A 2KJDA 2EDPA 2AWXA 2KYLA 5HF4A 2JINA 2I6VA 1MFGA 2X7ZA 4F8KA 1B8QA 2LC7A 2DAZA 1WG6A 3BPUA 2QKTA 5HETA 2R4HA 2KAWA 4YYXA 3LNXA 2JXOA 2OMJA 3DIWA 2UZCA 1GM1A 1WH1A 5HJ1A 4MPAA 4JOEA 2EV8A 3ZRTA 2ENOA 5E11A 1QAUA 2KQFA 1U38A 2M10A 3TMHA 1X5NA 2BYGA 2FN5A 2OS6A 1YBOA 1KY9A 4FGMA 4PQWA 4GVDA 3R69A 4JOKA 1R6JA 1N7FA 1Q3PA 5FHTA 4Q6HA 4HOPA 3CBXA 4Z33A 1GQ4A 2L97A 5B6LA 2V90A 5GNDA 2EEIA 1IU2A 3K82A 1WI4A 2G2LA 5FB8C 4K75A 3O5NA 3GJ9A 1W9QA 4G69A 2RCZA 5EYZA 1T2MA 4R2ZA 1KEFA 1P1EA 1K32A 3TSVA 3QIKA 5F3XA 2OCSA 3RLEA 1VJ6A 2OSGA 2IWOA 1WF7A 1X5RA 3QJNA 3ID1A
chains in the Genus database with same CATH superfamily
2KPKA 2DMZA 1WF8A 2HE2A 2KPLA 1RGWA 2PDZA 5HFEA 2KV8A 1XZ9A 2FE5A 2M0VA 1VCWA 4JOFA 2DLUA 2HGAA 2M0UA 3MH4A 2DB5A 4NNMA 2WL7A 1P1DA 1ZOKA 4NMRA 3RL7A 4Q6SA 5HFFA 2KOJA 5E1YA 5HDYA 2QKUA 1D5GA 4K78A 3I4WA 1UEPA 2GZVA 2W4FA 1W9OA 3I1EA 3DJ3A 2M3MA 5G1EA 3ID4A 2Z9IA 4H11A 4KFWA 2OGPA 3GCOA 2D90A 3HPKA 5HF1A 4NMPA 4JOPA 1MFLA 3GABA 3PV4A 3HVQC 3STJA 1FC9A 2VZ5A 4Q2QA 5D13A 4GVCA 4LMMA 2YT7A 1X8SA 5H3JA 1X9ZA 5B42A 3SUZA 2EJYA 1M5ZA 1RY4A 1SOTA 1W9EA 3PDVA 1N6DA 4NMTA 1N7TA 1Z87A 3B76A 5JXBA 1BFEA 2OZFA 2MX6A 3RL8A 2W7RA 5E21A 1WJLA 2KG2A 2KRGA 2EDVA 2I1NA 1WFVA 4NMVA 1IHJA 2CSSA 1FC6A 1WHAA 2EEHA 5IL9A 1OBZA 1Y7NA 3PDZA 2EEGA 2P3WA 2KA9A 4UU6A 3FY5A 2ZPMA 2FCFA 1KWAA 5I7ZA 3GGEA 4JORA 4Z8JA 2EGOA 3E17A 3DORA 4UU5A 1WIFA 2DLSA 2KOHA 2QBWA 4FLNA 1Y8TA 4GHNA 5HFDA 1G9OA 2IWNA 2DKRA 1IU0A 4JOHA 5EZ0A 4JJ3A 3ID3A 3QE1A 4OEPA 2JSNA 3TSZA 5G1DA 1MC7A 1UFXA 2Z17A 2DC2A 3DJAA 1FC7A 2R3YA 3ID2A 4L8NA 4NNLA 5DTHA 3PS4A 1N99A 3K1RA 2YUYA 3KDKA 2VSVA 4P0CA 1OBXA 3O46A 1RZXA 3GDVA 1V6BA 2OQSA 2ZPLA 4NMQA 2Q3GA 1FCFA 1UJVA 1NF3C 1UHPA 1WHDA 4IC6A 4OEOA 2V1WA 2KOMA 1ZUBA 2KJKA 2REYA 1BE9A 2M0ZA 3QJMA 3OU0A 4Q2OA 1Q7XA 3I18A 1I16A 3CBYA 1UM7A 5HEBA 3PV5A 4K76A 2VSPA 3QDOA 3HPMA 2QG1A 2EXGA 5GLJA 4EDJA 4XHVA 2HE4A 2CS5A 3R0HA 1UJUA 1V5QA 5HFBA 3AXAA 4OAJA 3CS0A 2VWRA 4JOGA 3DJ1A 4RI0A 3MH6A 2CSJA 2EHRA 3QGLA 3WKMA 2EAQA 2DJTA 2YT8A 2I0IA 2G5MB 4E35A 3SHWA 2PKUA 1N6EA 4Q2NA 2I04A 2KL1A 4AMHA 4NMSA 2VPHA 3K50A 4NXQA 2JIKA 1UJDA 1V62A 3GCNA 1TP5A 2YUBA 2H3MA 1QLCA 5F67A 2LUIA 1GQ5A 2JILA 3GDUA 4N6XA 3VQGA 2EGNA 1I92A 1WFGA 2LC6A 4JOJA 2K20A 1VB7A 2H2BA 4HOPB 2KJPA 2I0LA 4Q3HA 3CYYA 2IWPA 4KFVA 3VQFA 4NXPA 3SFJA 3NGHA 3WKLA 1OBYA 2JREA 5ILBA 4Q2PA 2LOBA 3NFKA 2F5YA 2PZDA 3CBZA 3KZEA 2L4SA 1VAEA 1UITA 3CC0A 1WI2A 2E7KA 2D92A 3R68A 1TE0A 2AWUA 3GDSA 2AWWA 2PNTA 2O2TA 3OTPA 2H3LA 2JWEA 2JOAA 3KZDA 4O06A 3LNYA 2KBSA 3QO6A 4JL7A 2Q9VA 4WYUA 1UF1A 2EDZA 1SOZA 4NXRA 3JXTA 2VRFA 4K6YA 2PKTA 1U37A 2I4SA 2EEJA 1QAVB 1TP3A 2LA8A 1RGRA 5HFCA 1V5LA 1L6OA 1V1TA 2QKVA 2MHOA 1Q3OA 1OZIA 1TQ3A 2PA1A 1N7EA 4YDPA 3KHFA 1U3BA 1UM1A 1QAVA 3SOEA 3PV2A 1VA8A 3MH7A 2RRMA 2K1ZA 1X45A 3NFLA 2H2CA 3SHUA 1Z86A 1UEZA 2M0TA 3CH8A 2AINA 4JJ0A 5HEDA 5A2PA 4P2AB 2D8IA 2F0AA 2OPGA 4E3BA 1U39A 1LCYA 2FNEA 2QT5A 4REYA 3GSLA 2L4TA 1N6FA 4K72A 4NMOA 3L4FD 1X5QA 2YTWA 3EGGC 2DM8A 4WYTA 1NTEA 2IWQA 2GEFA 3EGHC 1UEWA 5E6PB 2EGKA 1UEQA 5HEYA 4E34A 1X6DA 1PDRA 3TSWA 5E22A 2KJDA 2EDPA 2AWXA 2KYLA 5HF4A 2JINA 2I6VA 1MFGA 2X7ZA 4F8KA 1B8QA 2LC7A 2DAZA 1WG6A 3BPUA 2QKTA 5HETA 2R4HA 2KAWA 4YYXA 3LNXA 2JXOA 2OMJA 3DIWA 2UZCA 1GM1A 1WH1A 5HJ1A 4MPAA 4JOEA 2EV8A 3ZRTA 2ENOA 5E11A 1QAUA 2KQFA 1U38A 2M10A 3TMHA 1X5NA 3NCVA 2BYGA 2FN5A 2OS6A 1YBOA 1KY9A 4FGMA 4PQWA 4GVDA 3KDGA 3R69A 4JOKA 1R6JA 1N7FA 1Q3PA 5FHTA 4Q6HA 4HOPA 3CBXA 4Z33A 1GQ4A 2L97A 5B6LA 2V90A 5GNDA 2EEIA 1IU2A 3K82A 1WI4A 2G2LA 5FB8C 4K75A 3O5NA 3GJ9A 1W9QA 4G69A 2RCZA 5EYZA 1T2MA 4R2ZA 1KEFA 1P1EA 1K32A 3TSVA 3QIKA 5F3XA 2OCSA 3RLEA 1VJ6A 2OSGA 2IWOA 1WF7A 1X5RA 3QJNA 3ID1A
chains in the Genus database with same CATH topology
2KPKA 2DMZA 1WF8A 2HE2A 2KPLA 1RGWA 2PDZA 5HFEA 2KV8A 1XZ9A 2FE5A 2M0VA 1VCWA 4JOFA 2DLUA 2HGAA 2M0UA 3MH4A 2DB5A 4NNMA 2WL7A 1P1DA 1ZOKA 4NMRA 3RL7A 4Q6SA 5HFFA 2KOJA 5E1YA 5HDYA 2QKUA 1D5GA 4K78A 3I4WA 1UEPA 2GZVA 2W4FA 1W9OA 3I1EA 3DJ3A 2M3MA 5G1EA 3ID4A 2Z9IA 4H11A 4KFWA 2OGPA 3GCOA 2D90A 3HPKA 5HF1A 4NMPA 4JOPA 1MFLA 3GABA 3PV4A 3HVQC 3STJA 1FC9A 2VZ5A 4Q2QA 5D13A 4GVCA 4LMMA 2YT7A 1X8SA 5H3JA 1X9ZA 5B42A 3SUZA 2EJYA 1M5ZA 1RY4A 1SOTA 1W9EA 3PDVA 1N6DA 4NMTA 1N7TA 1Z87A 3B76A 5JXBA 1BFEA 2OZFA 2MX6A 3RL8A 2W7RA 5E21A 1WJLA 2KG2A 2KRGA 2EDVA 2I1NA 1WFVA 4NMVA 1IHJA 2CSSA 1FC6A 1WHAA 2EEHA 5IL9A 1OBZA 1Y7NA 3PDZA 2EEGA 2P3WA 2KA9A 4UU6A 3FY5A 2ZPMA 2FCFA 1KWAA 5I7ZA 3GGEA 4JORA 4Z8JA 2EGOA 3E17A 3DORA 4UU5A 1WIFA 2DLSA 2KOHA 2QBWA 4FLNA 1Y8TA 4GHNA 5HFDA 1G9OA 2IWNA 2DKRA 1IU0A 4JOHA 5EZ0A 4JJ3A 3ID3A 3QE1A 4OEPA 2JSNA 3TSZA 5G1DA 1MC7A 1UFXA 2Z17A 2DC2A 3DJAA 1FC7A 2R3YA 3ID2A 4L8NA 4NNLA 5DTHA 3PS4A 1N99A 3K1RA 2YUYA 3KDKA 2VSVA 4P0CA 1OBXA 3O46A 1RZXA 3GDVA 1V6BA 2OQSA 2ZPLA 4NMQA 2Q3GA 1FCFA 1UJVA 1NF3C 1UHPA 1WHDA 4IC6A 4OEOA 2V1WA 2KOMA 1ZUBA 2KJKA 2REYA 1BE9A 2M0ZA 3QJMA 3OU0A 4Q2OA 1Q7XA 3I18A 1I16A 3CBYA 1UM7A 5HEBA 3PV5A 4K76A 2VSPA 3QDOA 3HPMA 2QG1A 2EXGA 5GLJA 4EDJA 4XHVA 2HE4A 2CS5A 3R0HA 1UJUA 1V5QA 5HFBA 3AXAA 4OAJA 3CS0A 2VWRA 4JOGA 3DJ1A 4RI0A 3MH6A 2CSJA 2EHRA 3QGLA 3WKMA 2EAQA 2DJTA 2YT8A 2I0IA 2G5MB 4E35A 3SHWA 2PKUA 1N6EA 4Q2NA 2I04A 2KL1A 4AMHA 4NMSA 2VPHA 3K50A 4NXQA 2JIKA 1UJDA 1V62A 3GCNA 1TP5A 2YUBA 2H3MA 1QLCA 5F67A 2LUIA 1GQ5A 2JILA 3GDUA 4N6XA 3VQGA 2EGNA 1I92A 1WFGA 2LC6A 4JOJA 2K20A 1VB7A 2H2BA 4HOPB 2KJPA 2I0LA 4Q3HA 3CYYA 2IWPA 4KFVA 3VQFA 4NXPA 3SFJA 3NGHA 3WKLA 1OBYA 2JREA 5ILBA 4Q2PA 2LOBA 3NFKA 2F5YA 2PZDA 3CBZA 3KZEA 2L4SA 1VAEA 1UITA 3CC0A 1WI2A 2E7KA 2D92A 3R68A 1TE0A 2AWUA 3GDSA 2AWWA 2PNTA 2O2TA 3OTPA 2H3LA 2JWEA 2JOAA 3KZDA 4O06A 3LNYA 2KBSA 3QO6A 4JL7A 2Q9VA 4WYUA 1UF1A 2EDZA 1SOZA 4NXRA 3JXTA 2VRFA 4K6YA 2PKTA 1U37A 2I4SA 2EEJA 1QAVB 1TP3A 2LA8A 1RGRA 5HFCA 1V5LA 1L6OA 1V1TA 2QKVA 2MHOA 1Q3OA 1OZIA 1TQ3A 2PA1A 1N7EA 4YDPA 3KHFA 1U3BA 1UM1A 1QAVA 3SOEA 3PV2A 1VA8A 3MH7A 2RRMA 2K1ZA 1X45A 3NFLA 2H2CA 3SHUA 1Z86A 1UEZA 2M0TA 3CH8A 2AINA 4JJ0A 5HEDA 5A2PA 4P2AB 2D8IA 2F0AA 2OPGA 4E3BA 1U39A 1LCYA 2FNEA 2QT5A 4REYA 3GSLA 2L4TA 1N6FA 4K72A 4NMOA 3L4FD 1X5QA 2YTWA 3EGGC 2DM8A 4WYTA 1NTEA 2IWQA 2GEFA 3EGHC 1UEWA 5E6PB 2EGKA 1UEQA 5HEYA 4E34A 1X6DA 1PDRA 3TSWA 5E22A 2KJDA 2EDPA 2AWXA 2KYLA 5HF4A 2JINA 2I6VA 1MFGA 2X7ZA 4F8KA 1B8QA 2LC7A 2DAZA 1WG6A 3BPUA 2QKTA 5HETA 2R4HA 2KAWA 4YYXA 3LNXA 2JXOA 2OMJA 3DIWA 2UZCA 1GM1A 1WH1A 5HJ1A 4MPAA 4JOEA 2EV8A 3ZRTA 2ENOA 5E11A 1QAUA 2KQFA 1U38A 2M10A 3TMHA 1X5NA 3NCVA 2BYGA 2FN5A 2OS6A 1YBOA 1KY9A 4FGMA 4PQWA 4GVDA 3KDGA 3R69A 4JOKA 1R6JA 1N7FA 1Q3PA 5FHTA 4Q6HA 4HOPA 3CBXA 4Z33A 1GQ4A 2L97A 5B6LA 2V90A 5GNDA 2EEIA 1IU2A 3K82A 1WI4A 2G2LA 5FB8C 4K75A 3O5NA 3GJ9A 1W9QA 4G69A 2RCZA 5EYZA 1T2MA 4R2ZA 1KEFA 1P1EA 1K32A 3TSVA 3QIKA 5F3XA 2OCSA 3RLEA 1VJ6A 2OSGA 2IWOA 1WF7A 1X5RA 3QJNA 3ID1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPK A;  2DMZ A;  1WF8 A;  2HE2 A;  2KPL A;  1RGW A;  2PDZ A;  5HFE A;  2KV8 A;  1XZ9 A;  2FE5 A;  2M0V A;  1VCW A;  4JOF A;  2DLU A;  2HGA A;  2M0U A;  3MH4 A;  2DB5 A;  4NNM A;  2WL7 A;  1P1D A;  1ZOK A;  4NMR A;  3RL7 A;  4Q6S A;  5HFF A;  2KOJ A;  5E1Y A;  5HDY A;  2QKU A;  1D5G A;  4K78 A;  3I4W A;  1UEP A;  2GZV A;  2W4F A;  1W9O A;  3I1E A;  3DJ3 A;  2M3M A;  5G1E A;  3ID4 A;  2Z9I A;  4H11 A;  4KFW A;  2OGP A;  3GCO A;  2D90 A;  3HPK A;  5HF1 A;  4NMP A;  4JOP A;  1MFL A;  3PV4 A;  3HVQ C;  3STJ A;  1FC9 A;  2VZ5 A;  4Q2Q A;  5D13 A;  4GVC A;  4LMM A;  2YT7 A;  1X8S A;  5H3J A;  3SUZ A;  2EJY A;  1M5Z A;  1RY4 A;  1SOT A;  1W9E A;  3PDV A;  1N6D A;  4NMT A;  1N7T A;  1Z87 A;  3B76 A;  5JXB A;  1BFE A;  2OZF A;  2MX6 A;  3RL8 A;  2W7R A;  5E21 A;  1WJL A;  2KG2 A;  2KRG A;  2EDV A;  2I1N A;  1WFV A;  4NMV A;  1IHJ A;  2CSS A;  1FC6 A;  1WHA A;  2EEH A;  1OBZ A;  1Y7N A;  3PDZ A;  2EEG A;  2P3W A;  2KA9 A;  4UU6 A;  3FY5 A;  2ZPM A;  2FCF A;  1KWA A;  5I7Z A;  3GGE A;  4JOR A;  4Z8J A;  2EGO A;  3E17 A;  3DOR A;  4UU5 A;  1WIF A;  2DLS A;  2KOH A;  2QBW A;  1Y8T A;  4GHN A;  5HFD A;  1G9O A;  2IWN A;  2DKR A;  1IU0 A;  4JOH A;  5EZ0 A;  3ID3 A;  3QE1 A;  4OEP A;  3TSZ A;  5G1D A;  1MC7 A;  1UFX A;  2Z17 A;  2DC2 A;  3DJA A;  1FC7 A;  2R3Y A;  3ID2 A;  4L8N A;  4NNL A;  5DTH A;  3PS4 A;  1N99 A;  3K1R A;  2YUY A;  2VSV A;  4P0C A;  1OBX A;  3O46 A;  1RZX A;  3GDV A;  1V6B A;  2OQS A;  2ZPL A;  4NMQ A;  2Q3G A;  1FCF A;  1UJV A;  1NF3 C;  1UHP A;  1WHD A;  4IC6 A;  4OEO A;  2V1W A;  2KOM A;  1ZUB A;  2KJK A;  2REY A;  1BE9 A;  2M0Z A;  3QJM A;  3OU0 A;  4Q2O A;  1Q7X A;  3I18 A;  1I16 A;  3CBY A;  1UM7 A;  5HEB A;  3PV5 A;  4K76 A;  2VSP A;  3QDO A;  3HPM A;  2QG1 A;  2EXG A;  5GLJ A;  4EDJ A;  4XHV A;  2HE4 A;  2CS5 A;  3R0H A;  1UJU A;  1V5Q A;  5HFB A;  3AXA A;  4OAJ A;  3CS0 A;  2VWR A;  4JOG A;  3DJ1 A;  4RI0 A;  3MH6 A;  2CSJ A;  2EHR A;  3QGL A;  3WKM A;  2EAQ A;  2DJT A;  2YT8 A;  2I0I A;  2G5M B;  4E35 A;  3SHW A;  2PKU A;  1N6E A;  4Q2N A;  2I04 A;  2KL1 A;  4AMH A;  4NMS A;  2VPH A;  3K50 A;  4NXQ A;  2JIK A;  1UJD A;  1V62 A;  3GCN A;  1TP5 A;  2YUB A;  2H3M A;  1QLC A;  5F67 A;  2LUI A;  1GQ5 A;  2JIL A;  3GDU A;  4N6X A;  3VQG A;  2EGN A;  1I92 A;  1WFG A;  2LC6 A;  4JOJ A;  2K20 A;  1VB7 A;  2H2B A;  4HOP B;  2KJP A;  2I0L A;  4Q3H A;  3CYY A;  2IWP A;  4KFV A;  3VQF A;  4NXP A;  3SFJ A;  3NGH A;  3WKL A;  1OBY A;  2JRE A;  4Q2P A;  2LOB A;  3NFK A;  2F5Y A;  2PZD A;  3CBZ A;  3KZE A;  2L4S A;  1VAE A;  1UIT A;  3CC0 A;  1WI2 A;  2E7K A;  2D92 A;  3R68 A;  1TE0 A;  2AWU A;  3GDS A;  2AWW A;  2PNT A;  2O2T A;  3OTP A;  2H3L A;  2JWE A;  2JOA A;  3KZD A;  4O06 A;  3LNY A;  2KBS A;  3QO6 A;  4JL7 A;  2Q9V A;  4WYU A;  1UF1 A;  2EDZ A;  1SOZ A;  4NXR A;  3JXT A;  2VRF A;  4K6Y A;  2PKT A;  1U37 A;  2I4S A;  2EEJ A;  1QAV B;  1TP3 A;  2LA8 A;  1RGR A;  5HFC A;  1V5L A;  1L6O A;  1V1T A;  2QKV A;  2MHO A;  1Q3O A;  1OZI A;  1TQ3 A;  2PA1 A;  1N7E A;  4YDP A;  3KHF A;  1U3B A;  1UM1 A;  1QAV A;  3SOE A;  3PV2 A;  1VA8 A;  3MH7 A;  2RRM A;  2K1Z A;  1X45 A;  3NFL A;  2H2C A;  3SHU A;  1Z86 A;  1UEZ A;  2M0T A;  3CH8 A;  2AIN A;  5HED A;  5A2P A;  4P2A B;  2D8I A;  2F0A A;  2OPG A;  4E3B A;  1U39 A;  1LCY A;  2FNE A;  2QT5 A;  4REY A;  3GSL A;  2L4T A;  1N6F A;  4K72 A;  4NMO A;  3L4F D;  1X5Q A;  2YTW A;  3EGG C;  2DM8 A;  4WYT A;  1NTE A;  2IWQ A;  3EGH C;  1UEW A;  5E6P B;  2EGK A;  1UEQ A;  5HEY A;  4E34 A;  1X6D A;  1PDR A;  3TSW A;  5E22 A;  2KJD A;  2EDP A;  2AWX A;  2KYL A;  5HF4 A;  2JIN A;  2I6V A;  1MFG A;  2X7Z A;  4F8K A;  1B8Q A;  2LC7 A;  2DAZ A;  1WG6 A;  3BPU A;  2QKT A;  5HET A;  2R4H A;  2KAW A;  4YYX A;  3LNX A;  2JXO A;  2OMJ A;  3DIW A;  2UZC A;  1GM1 A;  1WH1 A;  5HJ1 A;  4MPA A;  4JOE A;  2EV8 A;  3ZRT A;  2ENO A;  5E11 A;  1QAU A;  2KQF A;  1U38 A;  2M10 A;  3TMH A;  1X5N A;  2BYG A;  2FN5 A;  2OS6 A;  1YBO A;  1KY9 A;  4FGM A;  4PQW A;  4GVD A;  3R69 A;  4JOK A;  1R6J A;  1N7F A;  1Q3P A;  5FHT A;  4Q6H A;  4HOP A;  3CBX A;  4Z33 A;  1GQ4 A;  2L97 A;  5B6L A;  2V90 A;  5GND A;  2EEI A;  1IU2 A;  3K82 A;  1WI4 A;  2G2L A;  5FB8 C;  4K75 A;  3O5N A;  3GJ9 A;  1W9Q A;  4G69 A;  2RCZ A;  5EYZ A;  1T2M A;  4R2Z A;  1KEF A;  1P1E A;  1K32 A;  3TSV A;  3QIK A;  5F3X A;  2OCS A;  3RLE A;  1VJ6 A;  2OSG A;  2IWO A;  1WF7 A;  1X5R A;  3QJN A;  3ID1 A; 
#chains in the Genus database with same CATH topology
 2KPK A;  2DMZ A;  1WF8 A;  2HE2 A;  2KPL A;  1RGW A;  2PDZ A;  5HFE A;  2KV8 A;  1XZ9 A;  2FE5 A;  2M0V A;  1VCW A;  4JOF A;  2DLU A;  2HGA A;  2M0U A;  3MH4 A;  2DB5 A;  4NNM A;  2WL7 A;  1P1D A;  1ZOK A;  4NMR A;  3RL7 A;  4Q6S A;  5HFF A;  2KOJ A;  5E1Y A;  5HDY A;  2QKU A;  1D5G A;  4K78 A;  3I4W A;  1UEP A;  2GZV A;  2W4F A;  1W9O A;  3I1E A;  3DJ3 A;  2M3M A;  5G1E A;  3ID4 A;  2Z9I A;  4H11 A;  4KFW A;  2OGP A;  3GCO A;  2D90 A;  3HPK A;  5HF1 A;  4NMP A;  4JOP A;  1MFL A;  3GAB A;  3PV4 A;  3HVQ C;  3STJ A;  1FC9 A;  2VZ5 A;  4Q2Q A;  5D13 A;  4GVC A;  4LMM A;  2YT7 A;  1X8S A;  5H3J A;  1X9Z A;  5B42 A;  3SUZ A;  2EJY A;  1M5Z A;  1RY4 A;  1SOT A;  1W9E A;  3PDV A;  1N6D A;  4NMT A;  1N7T A;  1Z87 A;  3B76 A;  5JXB A;  1BFE A;  2OZF A;  2MX6 A;  3RL8 A;  2W7R A;  5E21 A;  1WJL A;  2KG2 A;  2KRG A;  2EDV A;  2I1N A;  1WFV A;  4NMV A;  1IHJ A;  2CSS A;  1FC6 A;  1WHA A;  2EEH A;  5IL9 A;  1OBZ A;  1Y7N A;  3PDZ A;  2EEG A;  2P3W A;  2KA9 A;  4UU6 A;  3FY5 A;  2ZPM A;  2FCF A;  1KWA A;  5I7Z A;  3GGE A;  4JOR A;  4Z8J A;  2EGO A;  3E17 A;  3DOR A;  4UU5 A;  1WIF A;  2DLS A;  2KOH A;  2QBW A;  4FLN A;  1Y8T A;  4GHN A;  5HFD A;  1G9O A;  2IWN A;  2DKR A;  1IU0 A;  4JOH A;  5EZ0 A;  4JJ3 A;  3ID3 A;  3QE1 A;  4OEP A;  2JSN A;  3TSZ A;  5G1D A;  1MC7 A;  1UFX A;  2Z17 A;  2DC2 A;  3DJA A;  1FC7 A;  2R3Y A;  3ID2 A;  4L8N A;  4NNL A;  5DTH A;  3PS4 A;  1N99 A;  3K1R A;  2YUY A;  3KDK A;  2VSV A;  4P0C A;  1OBX A;  3O46 A;  1RZX A;  3GDV A;  1V6B A;  2OQS A;  2ZPL A;  4NMQ A;  2Q3G A;  1FCF A;  1UJV A;  1NF3 C;  1UHP A;  1WHD A;  4IC6 A;  4OEO A;  2V1W A;  2KOM A;  1ZUB A;  2KJK A;  2REY A;  1BE9 A;  2M0Z A;  3QJM A;  3OU0 A;  4Q2O A;  1Q7X A;  3I18 A;  1I16 A;  3CBY A;  1UM7 A;  5HEB A;  3PV5 A;  4K76 A;  2VSP A;  3QDO A;  3HPM A;  2QG1 A;  2EXG A;  5GLJ A;  4EDJ A;  4XHV A;  2HE4 A;  2CS5 A;  3R0H A;  1UJU A;  1V5Q A;  5HFB A;  3AXA A;  4OAJ A;  3CS0 A;  2VWR A;  4JOG A;  3DJ1 A;  4RI0 A;  3MH6 A;  2CSJ A;  2EHR A;  3QGL A;  3WKM A;  2EAQ A;  2DJT A;  2YT8 A;  2I0I A;  2G5M B;  4E35 A;  3SHW A;  2PKU A;  1N6E A;  4Q2N A;  2I04 A;  2KL1 A;  4AMH A;  4NMS A;  2VPH A;  3K50 A;  4NXQ A;  2JIK A;  1UJD A;  1V62 A;  3GCN A;  1TP5 A;  2YUB A;  2H3M A;  1QLC A;  5F67 A;  2LUI A;  1GQ5 A;  2JIL A;  3GDU A;  4N6X A;  3VQG A;  2EGN A;  1I92 A;  1WFG A;  2LC6 A;  4JOJ A;  2K20 A;  1VB7 A;  2H2B A;  4HOP B;  2KJP A;  2I0L A;  4Q3H A;  3CYY A;  2IWP A;  4KFV A;  3VQF A;  4NXP A;  3SFJ A;  3NGH A;  3WKL A;  1OBY A;  2JRE A;  5ILB A;  4Q2P A;  2LOB A;  3NFK A;  2F5Y A;  2PZD A;  3CBZ A;  3KZE A;  2L4S A;  1VAE A;  1UIT A;  3CC0 A;  1WI2 A;  2E7K A;  2D92 A;  3R68 A;  1TE0 A;  2AWU A;  3GDS A;  2AWW A;  2PNT A;  2O2T A;  3OTP A;  2H3L A;  2JWE A;  2JOA A;  3KZD A;  4O06 A;  3LNY A;  2KBS A;  3QO6 A;  4JL7 A;  2Q9V A;  4WYU A;  1UF1 A;  2EDZ A;  1SOZ A;  4NXR A;  3JXT A;  2VRF A;  4K6Y A;  2PKT A;  1U37 A;  2I4S A;  2EEJ A;  1QAV B;  1TP3 A;  2LA8 A;  1RGR A;  5HFC A;  1V5L A;  1L6O A;  1V1T A;  2QKV A;  2MHO A;  1Q3O A;  1OZI A;  1TQ3 A;  2PA1 A;  1N7E A;  4YDP A;  3KHF A;  1U3B A;  1UM1 A;  1QAV A;  3SOE A;  3PV2 A;  1VA8 A;  3MH7 A;  2RRM A;  2K1Z A;  1X45 A;  3NFL A;  2H2C A;  3SHU A;  1Z86 A;  1UEZ A;  2M0T A;  3CH8 A;  2AIN A;  4JJ0 A;  5HED A;  5A2P A;  4P2A B;  2D8I A;  2F0A A;  2OPG A;  4E3B A;  1U39 A;  1LCY A;  2FNE A;  2QT5 A;  4REY A;  3GSL A;  2L4T A;  1N6F A;  4K72 A;  4NMO A;  3L4F D;  1X5Q A;  2YTW A;  3EGG C;  2DM8 A;  4WYT A;  1NTE A;  2IWQ A;  2GEF A;  3EGH C;  1UEW A;  5E6P B;  2EGK A;  1UEQ A;  5HEY A;  4E34 A;  1X6D A;  1PDR A;  3TSW A;  5E22 A;  2KJD A;  2EDP A;  2AWX A;  2KYL A;  5HF4 A;  2JIN A;  2I6V A;  1MFG A;  2X7Z A;  4F8K A;  1B8Q A;  2LC7 A;  2DAZ A;  1WG6 A;  3BPU A;  2QKT A;  5HET A;  2R4H A;  2KAW A;  4YYX A;  3LNX A;  2JXO A;  2OMJ A;  3DIW A;  2UZC A;  1GM1 A;  1WH1 A;  5HJ1 A;  4MPA A;  4JOE A;  2EV8 A;  3ZRT A;  2ENO A;  5E11 A;  1QAU A;  2KQF A;  1U38 A;  2M10 A;  3TMH A;  1X5N A;  3NCV A;  2BYG A;  2FN5 A;  2OS6 A;  1YBO A;  1KY9 A;  4FGM A;  4PQW A;  4GVD A;  3KDG A;  3R69 A;  4JOK A;  1R6J A;  1N7F A;  1Q3P A;  5FHT A;  4Q6H A;  4HOP A;  3CBX A;  4Z33 A;  1GQ4 A;  2L97 A;  5B6L A;  2V90 A;  5GND A;  2EEI A;  1IU2 A;  3K82 A;  1WI4 A;  2G2L A;  5FB8 C;  4K75 A;  3O5N A;  3GJ9 A;  1W9Q A;  4G69 A;  2RCZ A;  5EYZ A;  1T2M A;  4R2Z A;  1KEF A;  1P1E A;  1K32 A;  3TSV A;  3QIK A;  5F3X A;  2OCS A;  3RLE A;  1VJ6 A;  2OSG A;  2IWO A;  1WF7 A;  1X5R A;  3QJN A;  3ID1 A; 
#chains in the Genus database with same CATH homology
 2KPK A;  2DMZ A;  1WF8 A;  2HE2 A;  2KPL A;  1RGW A;  2PDZ A;  5HFE A;  2KV8 A;  1XZ9 A;  2FE5 A;  2M0V A;  1VCW A;  4JOF A;  2DLU A;  2HGA A;  2M0U A;  3MH4 A;  2DB5 A;  4NNM A;  2WL7 A;  1P1D A;  1ZOK A;  4NMR A;  3RL7 A;  4Q6S A;  5HFF A;  2KOJ A;  5E1Y A;  5HDY A;  2QKU A;  1D5G A;  4K78 A;  3I4W A;  1UEP A;  2GZV A;  2W4F A;  1W9O A;  3I1E A;  3DJ3 A;  2M3M A;  5G1E A;  3ID4 A;  2Z9I A;  4H11 A;  4KFW A;  2OGP A;  3GCO A;  2D90 A;  3HPK A;  5HF1 A;  4NMP A;  4JOP A;  1MFL A;  3GAB A;  3PV4 A;  3HVQ C;  3STJ A;  1FC9 A;  2VZ5 A;  4Q2Q A;  5D13 A;  4GVC A;  4LMM A;  2YT7 A;  1X8S A;  5H3J A;  1X9Z A;  5B42 A;  3SUZ A;  2EJY A;  1M5Z A;  1RY4 A;  1SOT A;  1W9E A;  3PDV A;  1N6D A;  4NMT A;  1N7T A;  1Z87 A;  3B76 A;  5JXB A;  1BFE A;  2OZF A;  2MX6 A;  3RL8 A;  2W7R A;  5E21 A;  1WJL A;  2KG2 A;  2KRG A;  2EDV A;  2I1N A;  1WFV A;  4NMV A;  1IHJ A;  2CSS A;  1FC6 A;  1WHA A;  2EEH A;  5IL9 A;  1OBZ A;  1Y7N A;  3PDZ A;  2EEG A;  2P3W A;  2KA9 A;  4UU6 A;  3FY5 A;  2ZPM A;  2FCF A;  1KWA A;  5I7Z A;  3GGE A;  4JOR A;  4Z8J A;  2EGO A;  3E17 A;  3DOR A;  4UU5 A;  1WIF A;  2DLS A;  2KOH A;  2QBW A;  4FLN A;  1Y8T A;  4GHN A;  5HFD A;  1G9O A;  2IWN A;  2DKR A;  1IU0 A;  4JOH A;  5EZ0 A;  4JJ3 A;  3ID3 A;  3QE1 A;  4OEP A;  2JSN A;  3TSZ A;  5G1D A;  1MC7 A;  1UFX A;  2Z17 A;  2DC2 A;  3DJA A;  1FC7 A;  2R3Y A;  3ID2 A;  4L8N A;  4NNL A;  5DTH A;  3PS4 A;  1N99 A;  3K1R A;  2YUY A;  3KDK A;  2VSV A;  4P0C A;  1OBX A;  3O46 A;  1RZX A;  3GDV A;  1V6B A;  2OQS A;  2ZPL A;  4NMQ A;  2Q3G A;  1FCF A;  1UJV A;  1NF3 C;  1UHP A;  1WHD A;  4IC6 A;  4OEO A;  2V1W A;  2KOM A;  1ZUB A;  2KJK A;  2REY A;  1BE9 A;  2M0Z A;  3QJM A;  3OU0 A;  4Q2O A;  1Q7X A;  3I18 A;  1I16 A;  3CBY A;  1UM7 A;  5HEB A;  3PV5 A;  4K76 A;  2VSP A;  3QDO A;  3HPM A;  2QG1 A;  2EXG A;  5GLJ A;  4EDJ A;  4XHV A;  2HE4 A;  2CS5 A;  3R0H A;  1UJU A;  1V5Q A;  5HFB A;  3AXA A;  4OAJ A;  3CS0 A;  2VWR A;  4JOG A;  3DJ1 A;  4RI0 A;  3MH6 A;  2CSJ A;  2EHR A;  3QGL A;  3WKM A;  2EAQ A;  2DJT A;  2YT8 A;  2I0I A;  2G5M B;  4E35 A;  3SHW A;  2PKU A;  1N6E A;  4Q2N A;  2I04 A;  2KL1 A;  4AMH A;  4NMS A;  2VPH A;  3K50 A;  4NXQ A;  2JIK A;  1UJD A;  1V62 A;  3GCN A;  1TP5 A;  2YUB A;  2H3M A;  1QLC A;  5F67 A;  2LUI A;  1GQ5 A;  2JIL A;  3GDU A;  4N6X A;  3VQG A;  2EGN A;  1I92 A;  1WFG A;  2LC6 A;  4JOJ A;  2K20 A;  1VB7 A;  2H2B A;  4HOP B;  2KJP A;  2I0L A;  4Q3H A;  3CYY A;  2IWP A;  4KFV A;  3VQF A;  4NXP A;  3SFJ A;  3NGH A;  3WKL A;  1OBY A;  2JRE A;  5ILB A;  4Q2P A;  2LOB A;  3NFK A;  2F5Y A;  2PZD A;  3CBZ A;  3KZE A;  2L4S A;  1VAE A;  1UIT A;  3CC0 A;  1WI2 A;  2E7K A;  2D92 A;  3R68 A;  1TE0 A;  2AWU A;  3GDS A;  2AWW A;  2PNT A;  2O2T A;  3OTP A;  2H3L A;  2JWE A;  2JOA A;  3KZD A;  4O06 A;  3LNY A;  2KBS A;  3QO6 A;  4JL7 A;  2Q9V A;  4WYU A;  1UF1 A;  2EDZ A;  1SOZ A;  4NXR A;  3JXT A;  2VRF A;  4K6Y A;  2PKT A;  1U37 A;  2I4S A;  2EEJ A;  1QAV B;  1TP3 A;  2LA8 A;  1RGR A;  5HFC A;  1V5L A;  1L6O A;  1V1T A;  2QKV A;  2MHO A;  1Q3O A;  1OZI A;  1TQ3 A;  2PA1 A;  1N7E A;  4YDP A;  3KHF A;  1U3B A;  1UM1 A;  1QAV A;  3SOE A;  3PV2 A;  1VA8 A;  3MH7 A;  2RRM A;  2K1Z A;  1X45 A;  3NFL A;  2H2C A;  3SHU A;  1Z86 A;  1UEZ A;  2M0T A;  3CH8 A;  2AIN A;  4JJ0 A;  5HED A;  5A2P A;  4P2A B;  2D8I A;  2F0A A;  2OPG A;  4E3B A;  1U39 A;  1LCY A;  2FNE A;  2QT5 A;  4REY A;  3GSL A;  2L4T A;  1N6F A;  4K72 A;  4NMO A;  3L4F D;  1X5Q A;  2YTW A;  3EGG C;  2DM8 A;  4WYT A;  1NTE A;  2IWQ A;  2GEF A;  3EGH C;  1UEW A;  5E6P B;  2EGK A;  1UEQ A;  5HEY A;  4E34 A;  1X6D A;  1PDR A;  3TSW A;  5E22 A;  2KJD A;  2EDP A;  2AWX A;  2KYL A;  5HF4 A;  2JIN A;  2I6V A;  1MFG A;  2X7Z A;  4F8K A;  1B8Q A;  2LC7 A;  2DAZ A;  1WG6 A;  3BPU A;  2QKT A;  5HET A;  2R4H A;  2KAW A;  4YYX A;  3LNX A;  2JXO A;  2OMJ A;  3DIW A;  2UZC A;  1GM1 A;  1WH1 A;  5HJ1 A;  4MPA A;  4JOE A;  2EV8 A;  3ZRT A;  2ENO A;  5E11 A;  1QAU A;  2KQF A;  1U38 A;  2M10 A;  3TMH A;  1X5N A;  3NCV A;  2BYG A;  2FN5 A;  2OS6 A;  1YBO A;  1KY9 A;  4FGM A;  4PQW A;  4GVD A;  3KDG A;  3R69 A;  4JOK A;  1R6J A;  1N7F A;  1Q3P A;  5FHT A;  4Q6H A;  4HOP A;  3CBX A;  4Z33 A;  1GQ4 A;  2L97 A;  5B6L A;  2V90 A;  5GND A;  2EEI A;  1IU2 A;  3K82 A;  1WI4 A;  2G2L A;  5FB8 C;  4K75 A;  3O5N A;  3GJ9 A;  1W9Q A;  4G69 A;  2RCZ A;  5EYZ A;  1T2M A;  4R2Z A;  1KEF A;  1P1E A;  1K32 A;  3TSV A;  3QIK A;  5F3X A;  2OCS A;  3RLE A;  1VJ6 A;  2OSG A;  2IWO A;  1WF7 A;  1X5R A;  3QJN A;  3ID1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...