3ID4A

Crystal structure of rsep pdz2 domain fused gkaspv peptide
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
MIEPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGIEPKGKASPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of sigma E protease
publication title Cleavage of RseA by RseP requires a carboxyl-terminal hydrophobic amino acid following DegS cleavage
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 19
structure length 93
sequence length 93
ec nomenclature ec 3.4.24.-:
pdb deposition date 2009-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3id4A00
4YDPA 1V1TA 2EHRA 1K32A 4JORA 5G1EA 2EDVA 1WG6A 2H3MA 2DKRA 2M3MA 3LNYA 2I1NA 2X7ZA 2LC7A 1VAEA 1TQ3A 3SHWA 1KWAA 2I04A 5I7ZA 2RCZA 3DORA 4JOGA 1UITA 2ZPMA 3O46A 3ZRTA 3QJMA 1FC9A 4O06A 3GSLA 4EDJA 4AMHA 1QLCA 3HPMA 2BYGA 1WFGA 1UF1A 2DMZA 2JOAA 1X5QA 1N7TA 1VB7A 4NMTA 1V5LA 4K72A 4JOFA 3ID4A 2G5MB 2LOBA 1QAVA 1GM1A 3JXTA 2KBSA 2M0TA 4JOHA 2QT5A 2GZVA 2YUBA 4F8KA 4HOPB 3PV2A 4NMVA 2KPLA 5EYZA 1V6BA 3QJNA 4Q6SA 4Q2PA 3K50A 2AWUA 2KG2A 1U39A 3RL7A 2VSPA 4JOKA 3HVQC 1PDRA 2L4TA 2D90A 5D13A 5E6PB 2OZFA 3GDVA 2M0UA 4IC6A 2EEJA 4K78A 2VWRA 4YYXA 1T2MA 2FE5A 1IHJA 4GVCA 2EGNA 2KA9A 2KAWA 3MH4A 2OSGA 3KHFA 4L8NA 2D8IA 1WI2A 1MFGA 2KRGA 3GGEA 1W9QA 5HEDA 2CSJA 2KQFA 1N7EA 1UM7A 3QDOA 4R2ZA 2YTWA 1UM1A 1P1EA 5FB8C 1UEPA 2CSSA 2OCSA 4K76A 5HDYA 1Q3PA 5E22A 3SUZA 2OGPA 1Z87A 2M0ZA 3ID3A 1TP5A 2H2CA 2HE2A 3EGGC 4GHNA 5A2PA 2DM8A 2KOHA 2VPHA 3QIKA 4KFWA 4REYA 2KPKA 4OEOA 1TE0A 2I6VA 3I4WA 2HE4A 2QG1A 2EEGA 2OQSA 2FCFA 3ID2A 1BFEA 3OTPA 4FGMA 3TMHA 2EEHA 2PZDA 4K6YA 5F3XA 2YUYA 1UEQA 2H3LA 3SOEA 5G1DA 3STJA 1N7FA 4OAJA 2Z17A 2CS5A 4NXQA 2DC2A 1WHDA 1WIFA 2JREA 1R6JA 1U3BA 2KOMA 2MX6A 4UU5A 4P2AB 3HPKA 4K75A 3CYYA 2AINA 2KV8A 2PKTA 2YT8A 3KZEA 5H3JA 2KJDA 3PV4A 5HF4A 2DLSA 2EDZA 2EGOA 2WL7A 5FHTA 2KJPA 2OS6A 1RGWA 2L97A 2RRMA 3BPUA 3R0HA 1I16A 3E17A 1YBOA 2FNEA 1N6FA 3MH7A 4PQWA 3KZDA 1Y7NA 1WI4A 2AWXA 1WF7A 2REYA 3QO6A 2LC6A 2VZ5A 4OEPA 2F5YA 2AWWA 2ZPLA 4Z33A 2I4SA 2DB5A 2MHOA 3GCNA 2F0AA 3CBYA 1ZOKA 3GJ9A 2IWNA 3QE1A 1LCYA 3PDZA 5HJ1A 2Q9VA 1N6EA 4WYUA 4NMRA 4E35A 1U38A 3PDVA 1GQ5A 4RI0A 4JOPA 3TSWA 4LMMA 2P3WA 2V1WA 3PV5A 4NMQA 1M5ZA 1WH1A 2EXGA 3CBXA 5HF1A 3I1EA 1GQ4A 2JXOA 1FC7A 4NMOA 2PA1A 4E3BA 1WJLA 3NGHA 2VRFA 5HFDA 1RGRA 2Z9IA 5HFBA 2JWEA 2EDPA 2EJYA 4Z8JA 1W9OA 3MH6A 4WYTA 3VQFA 1X5RA 2KOJA 2D92A 4Q2QA 1X5NA 2EAQA 2V90A 3GDSA 2KJKA 2K1ZA 4P0CA 2R3YA 4Q2OA 1UJUA 1IU0A 4XHVA 5HFCA 1OBXA 3CH8A 1SOTA 1X45A 1Y8TA 1VJ6A 1Z86A 3ID1A 4NNMA 2W7RA 2QKTA 3NFKA 2QKUA 1KEFA 2EV8A 3WKMA 4Q2NA 2HGAA 3R68A 1OZIA 4HOPA 1UFXA 2LUIA 1TP3A 5HFFA 1VA8A 1QAUA 2DAZA 1NTEA 4E34A 1X8SA 4KFVA 1IU2A 2YT7A 2M10A 4Q3HA 2OPGA 4JL7A 5DTHA 1OBZA 5F67A 1V62A 3RLEA 3GDUA 3CS0A 3WKLA 4N6XA 2DJTA 1B8QA 4GVDA 1VCWA 1WHAA 2PNTA 2KYLA 1FC6A 3K1RA 2ENOA 1N6DA 4NMPA 3L4FD 1L6OA 2PDZA 4JOJA 3B76A 3CC0A 5GLJA 2L4SA 2QBWA 3DJAA 2JINA 3QGLA 1KY9A 3RL8A 1OBYA 3K82A 2PKUA 2JILA 2H2BA 1UJVA 3R69A 4NMSA 5EZ0A 1G9OA 3LNXA 1MFLA 3O5NA 3NFLA 1Q3OA 1Q7XA 1W9EA 3DJ3A 4JOEA 1UEZA 2QKVA 3EGHC 1N99A 2KL1A 2JIKA 1SOZA 2E7KA 4MPAA 2IWQA 4NNLA 1D5GA 2DLUA 3AXAA 2VSVA 3PS4A 3SFJA 4Q6HA 5HEBA 1MC7A 1P1DA 2W4FA 1WFVA 5E11A 2O2TA 3TSVA 2LA8A 5GNDA 3GCOA 1BE9A 5E1YA 5HEYA 2I0IA 3FY5A 1ZUBA 1V5QA 1WF8A 4UU6A 2FN5A 3TSZA 3DIWA 2K20A 4NXPA 3I18A 3DJ1A 2Q3GA 1I92A 5JXBA 3CBZA 4H11A 1QAVB 5HFEA 3SHUA 1X6DA 2IWOA 3OU0A 1XZ9A 2I0LA 4NXRA 2M0VA 1UHPA 5HETA 3VQGA 1NF3C 1RY4A 2R4HA 2G2LA 1FCFA 4G69A 1UJDA 1UEWA 2UZCA 1U37A 2OMJA 2IWPA 5E21A 2EGKA 1RZXA 2EEIA 5B6LA
chains in the Genus database with same CATH superfamily
4YDPA 1V1TA 2EHRA 1K32A 4JORA 5G1EA 2EDVA 1WG6A 2H3MA 2DKRA 2M3MA 3LNYA 3NCVA 2I1NA 2X7ZA 2LC7A 1VAEA 1TQ3A 3SHWA 1KWAA 2I04A 5I7ZA 2RCZA 3DORA 4JOGA 1UITA 2ZPMA 3O46A 3ZRTA 3QJMA 1FC9A 4O06A 3GSLA 4EDJA 4AMHA 1QLCA 3HPMA 2BYGA 1WFGA 1UF1A 2DMZA 2JOAA 1X5QA 1N7TA 1VB7A 4NMTA 1V5LA 4K72A 4JOFA 3ID4A 2G5MB 2LOBA 1QAVA 1GM1A 3JXTA 2KBSA 5IL9A 2M0TA 4JOHA 2QT5A 2GZVA 2YUBA 4F8KA 4HOPB 3PV2A 4NMVA 2KPLA 5EYZA 4JJ3A 1V6BA 3QJNA 4Q6SA 4Q2PA 3K50A 2AWUA 2KG2A 1U39A 3RL7A 2VSPA 4JOKA 3HVQC 1PDRA 2L4TA 2D90A 5D13A 5E6PB 2OZFA 3GDVA 2M0UA 4IC6A 2EEJA 4K78A 2VWRA 4YYXA 1T2MA 2FE5A 1IHJA 4GVCA 2EGNA 2KA9A 2KAWA 3MH4A 2OSGA 3KHFA 4L8NA 2D8IA 1WI2A 1MFGA 2KRGA 3GGEA 1W9QA 5HEDA 2CSJA 2KQFA 1N7EA 1UM7A 3QDOA 4R2ZA 2YTWA 1UM1A 1P1EA 5FB8C 1UEPA 2CSSA 2OCSA 4JJ0A 4K76A 5HDYA 1Q3PA 5E22A 3SUZA 2OGPA 1Z87A 4FLNA 2M0ZA 3ID3A 1TP5A 2H2CA 2HE2A 3EGGC 4GHNA 5A2PA 2DM8A 2KOHA 2VPHA 3QIKA 4KFWA 4REYA 2KPKA 4OEOA 1TE0A 2I6VA 3I4WA 2HE4A 2QG1A 2EEGA 2OQSA 2FCFA 3ID2A 1BFEA 3OTPA 4FGMA 3TMHA 2EEHA 2PZDA 4K6YA 5F3XA 2YUYA 1UEQA 2H3LA 3SOEA 5G1DA 3STJA 1N7FA 4OAJA 2Z17A 2CS5A 4NXQA 2DC2A 1WHDA 1WIFA 2JREA 1R6JA 1U3BA 2KOMA 2MX6A 4UU5A 4P2AB 3HPKA 5ILBA 4K75A 3CYYA 2AINA 2KV8A 2PKTA 2YT8A 2JSNA 3KZEA 5H3JA 2KJDA 3PV4A 5HF4A 2DLSA 2EDZA 2EGOA 2WL7A 5FHTA 2KJPA 2OS6A 1RGWA 2L97A 2RRMA 3BPUA 3R0HA 1I16A 3E17A 1YBOA 2FNEA 1N6FA 3MH7A 4PQWA 3KZDA 1X9ZA 1Y7NA 1WI4A 2AWXA 1WF7A 2REYA 3QO6A 2LC6A 2VZ5A 4OEPA 2F5YA 2AWWA 2ZPLA 4Z33A 2I4SA 3GABA 2DB5A 2MHOA 3GCNA 2F0AA 3CBYA 1ZOKA 3GJ9A 2IWNA 3QE1A 1LCYA 3PDZA 5HJ1A 2Q9VA 1N6EA 4WYUA 4NMRA 4E35A 1U38A 3PDVA 1GQ5A 4RI0A 4JOPA 3TSWA 4LMMA 2P3WA 2V1WA 3PV5A 4NMQA 1M5ZA 1WH1A 2EXGA 3CBXA 5HF1A 3I1EA 1GQ4A 2JXOA 1FC7A 4NMOA 2PA1A 4E3BA 1WJLA 3NGHA 2VRFA 5HFDA 1RGRA 2Z9IA 5HFBA 2JWEA 2EDPA 2EJYA 4Z8JA 1W9OA 3MH6A 4WYTA 3VQFA 1X5RA 2KOJA 5B42A 2D92A 4Q2QA 1X5NA 2EAQA 2V90A 3GDSA 2KJKA 2K1ZA 4P0CA 2R3YA 4Q2OA 1UJUA 1IU0A 4XHVA 5HFCA 1OBXA 3CH8A 1SOTA 1X45A 1Y8TA 1VJ6A 1Z86A 3ID1A 4NNMA 2W7RA 2QKTA 3NFKA 2QKUA 1KEFA 2EV8A 3WKMA 4Q2NA 2HGAA 3R68A 1OZIA 4HOPA 1UFXA 2LUIA 1TP3A 5HFFA 1VA8A 1QAUA 2DAZA 1NTEA 4E34A 1X8SA 4KFVA 1IU2A 2YT7A 2M10A 4Q3HA 2OPGA 4JL7A 5DTHA 1OBZA 5F67A 1V62A 3RLEA 3GDUA 3CS0A 3WKLA 4N6XA 2DJTA 1B8QA 4GVDA 1VCWA 1WHAA 2PNTA 2KYLA 1FC6A 3K1RA 2ENOA 1N6DA 4NMPA 3L4FD 1L6OA 2PDZA 4JOJA 3B76A 3CC0A 5GLJA 2L4SA 2QBWA 3DJAA 2JINA 3QGLA 1KY9A 3RL8A 1OBYA 3K82A 2PKUA 2JILA 2H2BA 1UJVA 3R69A 4NMSA 5EZ0A 1G9OA 3LNXA 1MFLA 3O5NA 3NFLA 1Q3OA 1Q7XA 1W9EA 3DJ3A 4JOEA 1UEZA 2QKVA 3EGHC 1N99A 2KL1A 2JIKA 1SOZA 2E7KA 4MPAA 2IWQA 4NNLA 1D5GA 2DLUA 3AXAA 2VSVA 2GEFA 3PS4A 3KDGA 3SFJA 4Q6HA 5HEBA 1MC7A 1P1DA 2W4FA 1WFVA 5E11A 2O2TA 3TSVA 2LA8A 5GNDA 3GCOA 1BE9A 5E1YA 5HEYA 2I0IA 3FY5A 1ZUBA 1V5QA 1WF8A 4UU6A 2FN5A 3TSZA 3DIWA 2K20A 4NXPA 3I18A 3DJ1A 2Q3GA 1I92A 5JXBA 3CBZA 4H11A 1QAVB 5HFEA 3KDKA 3SHUA 1X6DA 2IWOA 3OU0A 1XZ9A 2I0LA 4NXRA 2M0VA 1UHPA 5HETA 3VQGA 1NF3C 1RY4A 2R4HA 2G2LA 1FCFA 4G69A 1UJDA 1UEWA 2UZCA 1U37A 2OMJA 2IWPA 5E21A 2EGKA 1RZXA 2EEIA 5B6LA
chains in the Genus database with same CATH topology
4YDPA 1V1TA 2EHRA 1K32A 4JORA 5G1EA 2EDVA 1WG6A 2H3MA 2DKRA 2M3MA 3LNYA 3NCVA 2I1NA 2X7ZA 2LC7A 1VAEA 1TQ3A 3SHWA 1KWAA 2I04A 5I7ZA 2RCZA 3DORA 4JOGA 1UITA 2ZPMA 3O46A 3ZRTA 3QJMA 1FC9A 4O06A 3GSLA 4EDJA 4AMHA 1QLCA 3HPMA 2BYGA 1WFGA 1UF1A 2DMZA 2JOAA 1X5QA 1N7TA 1VB7A 4NMTA 1V5LA 4K72A 4JOFA 3ID4A 2G5MB 2LOBA 1QAVA 1GM1A 3JXTA 2KBSA 5IL9A 2M0TA 4JOHA 2QT5A 2GZVA 2YUBA 4F8KA 4HOPB 3PV2A 4NMVA 2KPLA 5EYZA 4JJ3A 1V6BA 3QJNA 4Q6SA 4Q2PA 3K50A 2AWUA 2KG2A 1U39A 3RL7A 2VSPA 4JOKA 3HVQC 1PDRA 2L4TA 2D90A 5D13A 5E6PB 2OZFA 3GDVA 2M0UA 4IC6A 2EEJA 4K78A 2VWRA 4YYXA 1T2MA 2FE5A 1IHJA 4GVCA 2EGNA 2KA9A 2KAWA 3MH4A 2OSGA 3KHFA 4L8NA 2D8IA 1WI2A 1MFGA 2KRGA 3GGEA 1W9QA 5HEDA 2CSJA 2KQFA 1N7EA 1UM7A 3QDOA 4R2ZA 2YTWA 1UM1A 1P1EA 5FB8C 1UEPA 2CSSA 2OCSA 4JJ0A 4K76A 5HDYA 1Q3PA 5E22A 3SUZA 2OGPA 1Z87A 4FLNA 2M0ZA 3ID3A 1TP5A 2H2CA 2HE2A 3EGGC 4GHNA 5A2PA 2DM8A 2KOHA 2VPHA 3QIKA 4KFWA 4REYA 2KPKA 4OEOA 1TE0A 2I6VA 3I4WA 2HE4A 2QG1A 2EEGA 2OQSA 2FCFA 3ID2A 1BFEA 3OTPA 4FGMA 3TMHA 2EEHA 2PZDA 4K6YA 5F3XA 2YUYA 1UEQA 2H3LA 3SOEA 5G1DA 3STJA 1N7FA 4OAJA 2Z17A 2CS5A 4NXQA 2DC2A 1WHDA 1WIFA 2JREA 1R6JA 1U3BA 2KOMA 2MX6A 4UU5A 4P2AB 3HPKA 5ILBA 4K75A 3CYYA 2AINA 2KV8A 2PKTA 2YT8A 2JSNA 3KZEA 5H3JA 2KJDA 3PV4A 5HF4A 2DLSA 2EDZA 2EGOA 2WL7A 5FHTA 2KJPA 2OS6A 1RGWA 2L97A 2RRMA 3BPUA 3R0HA 1I16A 3E17A 1YBOA 2FNEA 1N6FA 3MH7A 4PQWA 3KZDA 1X9ZA 1Y7NA 1WI4A 2AWXA 1WF7A 2REYA 3QO6A 2LC6A 2VZ5A 4OEPA 2F5YA 2AWWA 2ZPLA 4Z33A 2I4SA 3GABA 2DB5A 2MHOA 3GCNA 2F0AA 3CBYA 1ZOKA 3GJ9A 2IWNA 3QE1A 1LCYA 3PDZA 5HJ1A 2Q9VA 1N6EA 4WYUA 4NMRA 4E35A 1U38A 3PDVA 1GQ5A 4RI0A 4JOPA 3TSWA 4LMMA 2P3WA 2V1WA 3PV5A 4NMQA 1M5ZA 1WH1A 2EXGA 3CBXA 5HF1A 3I1EA 1GQ4A 2JXOA 1FC7A 4NMOA 2PA1A 4E3BA 1WJLA 3NGHA 2VRFA 5HFDA 1RGRA 2Z9IA 5HFBA 2JWEA 2EDPA 2EJYA 4Z8JA 1W9OA 3MH6A 4WYTA 3VQFA 1X5RA 2KOJA 5B42A 2D92A 4Q2QA 1X5NA 2EAQA 2V90A 3GDSA 2KJKA 2K1ZA 4P0CA 2R3YA 4Q2OA 1UJUA 1IU0A 4XHVA 5HFCA 1OBXA 3CH8A 1SOTA 1X45A 1Y8TA 1VJ6A 1Z86A 3ID1A 4NNMA 2W7RA 2QKTA 3NFKA 2QKUA 1KEFA 2EV8A 3WKMA 4Q2NA 2HGAA 3R68A 1OZIA 4HOPA 1UFXA 2LUIA 1TP3A 5HFFA 1VA8A 1QAUA 2DAZA 1NTEA 4E34A 1X8SA 4KFVA 1IU2A 2YT7A 2M10A 4Q3HA 2OPGA 4JL7A 5DTHA 1OBZA 5F67A 1V62A 3RLEA 3GDUA 3CS0A 3WKLA 4N6XA 2DJTA 1B8QA 4GVDA 1VCWA 1WHAA 2PNTA 2KYLA 1FC6A 3K1RA 2ENOA 1N6DA 4NMPA 3L4FD 1L6OA 2PDZA 4JOJA 3B76A 3CC0A 5GLJA 2L4SA 2QBWA 3DJAA 2JINA 3QGLA 1KY9A 3RL8A 1OBYA 3K82A 2PKUA 2JILA 2H2BA 1UJVA 3R69A 4NMSA 5EZ0A 1G9OA 3LNXA 1MFLA 3O5NA 3NFLA 1Q3OA 1Q7XA 1W9EA 3DJ3A 4JOEA 1UEZA 2QKVA 3EGHC 1N99A 2KL1A 2JIKA 1SOZA 2E7KA 4MPAA 2IWQA 4NNLA 1D5GA 2DLUA 3AXAA 2VSVA 2GEFA 3PS4A 3KDGA 3SFJA 4Q6HA 5HEBA 1MC7A 1P1DA 2W4FA 1WFVA 5E11A 2O2TA 3TSVA 2LA8A 5GNDA 3GCOA 1BE9A 5E1YA 5HEYA 2I0IA 3FY5A 1ZUBA 1V5QA 1WF8A 4UU6A 2FN5A 3TSZA 3DIWA 2K20A 4NXPA 3I18A 3DJ1A 2Q3GA 1I92A 5JXBA 3CBZA 4H11A 1QAVB 5HFEA 3KDKA 3SHUA 1X6DA 2IWOA 3OU0A 1XZ9A 2I0LA 4NXRA 2M0VA 1UHPA 5HETA 3VQGA 1NF3C 1RY4A 2R4HA 2G2LA 1FCFA 4G69A 1UJDA 1UEWA 2UZCA 1U37A 2OMJA 2IWPA 5E21A 2EGKA 1RZXA 2EEIA 5B6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDP A;  1V1T A;  2EHR A;  1K32 A;  4JOR A;  5G1E A;  2EDV A;  1WG6 A;  2H3M A;  2DKR A;  2M3M A;  3LNY A;  2I1N A;  2X7Z A;  2LC7 A;  1VAE A;  1TQ3 A;  3SHW A;  1KWA A;  2I04 A;  5I7Z A;  2RCZ A;  3DOR A;  4JOG A;  1UIT A;  2ZPM A;  3O46 A;  3ZRT A;  3QJM A;  1FC9 A;  4O06 A;  3GSL A;  4EDJ A;  4AMH A;  1QLC A;  3HPM A;  2BYG A;  1WFG A;  1UF1 A;  2DMZ A;  2JOA A;  1X5Q A;  1N7T A;  1VB7 A;  4NMT A;  1V5L A;  4K72 A;  4JOF A;  3ID4 A;  2G5M B;  2LOB A;  1QAV A;  1GM1 A;  3JXT A;  2KBS A;  2M0T A;  4JOH A;  2QT5 A;  2GZV A;  2YUB A;  4F8K A;  4HOP B;  3PV2 A;  4NMV A;  2KPL A;  5EYZ A;  1V6B A;  3QJN A;  4Q6S A;  4Q2P A;  3K50 A;  2AWU A;  2KG2 A;  1U39 A;  3RL7 A;  2VSP A;  4JOK A;  3HVQ C;  1PDR A;  2L4T A;  2D90 A;  5D13 A;  5E6P B;  2OZF A;  3GDV A;  2M0U A;  4IC6 A;  2EEJ A;  4K78 A;  2VWR A;  4YYX A;  1T2M A;  2FE5 A;  1IHJ A;  4GVC A;  2EGN A;  2KA9 A;  2KAW A;  3MH4 A;  2OSG A;  3KHF A;  4L8N A;  2D8I A;  1WI2 A;  1MFG A;  2KRG A;  3GGE A;  1W9Q A;  5HED A;  2CSJ A;  2KQF A;  1N7E A;  1UM7 A;  3QDO A;  4R2Z A;  2YTW A;  1UM1 A;  1P1E A;  5FB8 C;  1UEP A;  2CSS A;  2OCS A;  4K76 A;  5HDY A;  1Q3P A;  5E22 A;  3SUZ A;  2OGP A;  1Z87 A;  2M0Z A;  3ID3 A;  1TP5 A;  2H2C A;  2HE2 A;  3EGG C;  4GHN A;  5A2P A;  2DM8 A;  2KOH A;  2VPH A;  3QIK A;  4KFW A;  4REY A;  2KPK A;  4OEO A;  1TE0 A;  2I6V A;  3I4W A;  2HE4 A;  2QG1 A;  2EEG A;  2OQS A;  2FCF A;  3ID2 A;  1BFE A;  3OTP A;  4FGM A;  3TMH A;  2EEH A;  2PZD A;  4K6Y A;  5F3X A;  2YUY A;  1UEQ A;  2H3L A;  3SOE A;  5G1D A;  3STJ A;  1N7F A;  4OAJ A;  2Z17 A;  2CS5 A;  4NXQ A;  2DC2 A;  1WHD A;  1WIF A;  2JRE A;  1R6J A;  1U3B A;  2KOM A;  2MX6 A;  4UU5 A;  4P2A B;  3HPK A;  4K75 A;  3CYY A;  2AIN A;  2KV8 A;  2PKT A;  2YT8 A;  3KZE A;  5H3J A;  2KJD A;  3PV4 A;  5HF4 A;  2DLS A;  2EDZ A;  2EGO A;  2WL7 A;  5FHT A;  2KJP A;  2OS6 A;  1RGW A;  2L97 A;  2RRM A;  3BPU A;  3R0H A;  1I16 A;  3E17 A;  1YBO A;  2FNE A;  1N6F A;  3MH7 A;  4PQW A;  3KZD A;  1Y7N A;  1WI4 A;  2AWX A;  1WF7 A;  2REY A;  3QO6 A;  2LC6 A;  2VZ5 A;  4OEP A;  2F5Y A;  2AWW A;  2ZPL A;  4Z33 A;  2I4S A;  2DB5 A;  2MHO A;  3GCN A;  2F0A A;  3CBY A;  1ZOK A;  3GJ9 A;  2IWN A;  3QE1 A;  1LCY A;  3PDZ A;  5HJ1 A;  2Q9V A;  1N6E A;  4WYU A;  4NMR A;  4E35 A;  1U38 A;  3PDV A;  1GQ5 A;  4RI0 A;  4JOP A;  3TSW A;  4LMM A;  2P3W A;  2V1W A;  3PV5 A;  4NMQ A;  1M5Z A;  1WH1 A;  2EXG A;  3CBX A;  5HF1 A;  3I1E A;  1GQ4 A;  2JXO A;  1FC7 A;  4NMO A;  2PA1 A;  4E3B A;  1WJL A;  3NGH A;  2VRF A;  5HFD A;  1RGR A;  2Z9I A;  5HFB A;  2JWE A;  2EDP A;  2EJY A;  4Z8J A;  1W9O A;  3MH6 A;  4WYT A;  3VQF A;  1X5R A;  2KOJ A;  2D92 A;  4Q2Q A;  1X5N A;  2EAQ A;  2V90 A;  3GDS A;  2KJK A;  2K1Z A;  4P0C A;  2R3Y A;  4Q2O A;  1UJU A;  1IU0 A;  4XHV A;  5HFC A;  1OBX A;  3CH8 A;  1SOT A;  1X45 A;  1Y8T A;  1VJ6 A;  1Z86 A;  3ID1 A;  4NNM A;  2W7R A;  2QKT A;  3NFK A;  2QKU A;  1KEF A;  2EV8 A;  3WKM A;  4Q2N A;  2HGA A;  3R68 A;  1OZI A;  4HOP A;  1UFX A;  2LUI A;  1TP3 A;  5HFF A;  1VA8 A;  1QAU A;  2DAZ A;  1NTE A;  4E34 A;  1X8S A;  4KFV A;  1IU2 A;  2YT7 A;  2M10 A;  4Q3H A;  2OPG A;  4JL7 A;  5DTH A;  1OBZ A;  5F67 A;  1V62 A;  3RLE A;  3GDU A;  3CS0 A;  3WKL A;  4N6X A;  2DJT A;  1B8Q A;  4GVD A;  1VCW A;  1WHA A;  2PNT A;  2KYL A;  1FC6 A;  3K1R A;  2ENO A;  1N6D A;  4NMP A;  3L4F D;  1L6O A;  2PDZ A;  4JOJ A;  3B76 A;  3CC0 A;  5GLJ A;  2L4S A;  2QBW A;  3DJA A;  2JIN A;  3QGL A;  1KY9 A;  3RL8 A;  1OBY A;  3K82 A;  2PKU A;  2JIL A;  2H2B A;  1UJV A;  3R69 A;  4NMS A;  5EZ0 A;  1G9O A;  3LNX A;  1MFL A;  3O5N A;  3NFL A;  1Q3O A;  1Q7X A;  1W9E A;  3DJ3 A;  4JOE A;  1UEZ A;  2QKV A;  3EGH C;  1N99 A;  2KL1 A;  2JIK A;  1SOZ A;  2E7K A;  4MPA A;  2IWQ A;  4NNL A;  1D5G A;  2DLU A;  3AXA A;  2VSV A;  3PS4 A;  3SFJ A;  4Q6H A;  5HEB A;  1MC7 A;  1P1D A;  2W4F A;  1WFV A;  5E11 A;  2O2T A;  3TSV A;  2LA8 A;  5GND A;  3GCO A;  1BE9 A;  5E1Y A;  5HEY A;  2I0I A;  3FY5 A;  1ZUB A;  1V5Q A;  1WF8 A;  4UU6 A;  2FN5 A;  3TSZ A;  3DIW A;  2K20 A;  4NXP A;  3I18 A;  3DJ1 A;  2Q3G A;  1I92 A;  5JXB A;  3CBZ A;  4H11 A;  1QAV B;  5HFE A;  3SHU A;  1X6D A;  2IWO A;  3OU0 A;  1XZ9 A;  2I0L A;  4NXR A;  2M0V A;  1UHP A;  5HET A;  3VQG A;  1NF3 C;  1RY4 A;  2R4H A;  2G2L A;  1FCF A;  4G69 A;  1UJD A;  1UEW A;  2UZC A;  1U37 A;  2OMJ A;  2IWP A;  5E21 A;  2EGK A;  1RZX A;  2EEI A;  5B6L A; 
#chains in the Genus database with same CATH topology
 4YDP A;  1V1T A;  2EHR A;  1K32 A;  4JOR A;  5G1E A;  2EDV A;  1WG6 A;  2H3M A;  2DKR A;  2M3M A;  3LNY A;  3NCV A;  2I1N A;  2X7Z A;  2LC7 A;  1VAE A;  1TQ3 A;  3SHW A;  1KWA A;  2I04 A;  5I7Z A;  2RCZ A;  3DOR A;  4JOG A;  1UIT A;  2ZPM A;  3O46 A;  3ZRT A;  3QJM A;  1FC9 A;  4O06 A;  3GSL A;  4EDJ A;  4AMH A;  1QLC A;  3HPM A;  2BYG A;  1WFG A;  1UF1 A;  2DMZ A;  2JOA A;  1X5Q A;  1N7T A;  1VB7 A;  4NMT A;  1V5L A;  4K72 A;  4JOF A;  3ID4 A;  2G5M B;  2LOB A;  1QAV A;  1GM1 A;  3JXT A;  2KBS A;  5IL9 A;  2M0T A;  4JOH A;  2QT5 A;  2GZV A;  2YUB A;  4F8K A;  4HOP B;  3PV2 A;  4NMV A;  2KPL A;  5EYZ A;  4JJ3 A;  1V6B A;  3QJN A;  4Q6S A;  4Q2P A;  3K50 A;  2AWU A;  2KG2 A;  1U39 A;  3RL7 A;  2VSP A;  4JOK A;  3HVQ C;  1PDR A;  2L4T A;  2D90 A;  5D13 A;  5E6P B;  2OZF A;  3GDV A;  2M0U A;  4IC6 A;  2EEJ A;  4K78 A;  2VWR A;  4YYX A;  1T2M A;  2FE5 A;  1IHJ A;  4GVC A;  2EGN A;  2KA9 A;  2KAW A;  3MH4 A;  2OSG A;  3KHF A;  4L8N A;  2D8I A;  1WI2 A;  1MFG A;  2KRG A;  3GGE A;  1W9Q A;  5HED A;  2CSJ A;  2KQF A;  1N7E A;  1UM7 A;  3QDO A;  4R2Z A;  2YTW A;  1UM1 A;  1P1E A;  5FB8 C;  1UEP A;  2CSS A;  2OCS A;  4JJ0 A;  4K76 A;  5HDY A;  1Q3P A;  5E22 A;  3SUZ A;  2OGP A;  1Z87 A;  4FLN A;  2M0Z A;  3ID3 A;  1TP5 A;  2H2C A;  2HE2 A;  3EGG C;  4GHN A;  5A2P A;  2DM8 A;  2KOH A;  2VPH A;  3QIK A;  4KFW A;  4REY A;  2KPK A;  4OEO A;  1TE0 A;  2I6V A;  3I4W A;  2HE4 A;  2QG1 A;  2EEG A;  2OQS A;  2FCF A;  3ID2 A;  1BFE A;  3OTP A;  4FGM A;  3TMH A;  2EEH A;  2PZD A;  4K6Y A;  5F3X A;  2YUY A;  1UEQ A;  2H3L A;  3SOE A;  5G1D A;  3STJ A;  1N7F A;  4OAJ A;  2Z17 A;  2CS5 A;  4NXQ A;  2DC2 A;  1WHD A;  1WIF A;  2JRE A;  1R6J A;  1U3B A;  2KOM A;  2MX6 A;  4UU5 A;  4P2A B;  3HPK A;  5ILB A;  4K75 A;  3CYY A;  2AIN A;  2KV8 A;  2PKT A;  2YT8 A;  2JSN A;  3KZE A;  5H3J A;  2KJD A;  3PV4 A;  5HF4 A;  2DLS A;  2EDZ A;  2EGO A;  2WL7 A;  5FHT A;  2KJP A;  2OS6 A;  1RGW A;  2L97 A;  2RRM A;  3BPU A;  3R0H A;  1I16 A;  3E17 A;  1YBO A;  2FNE A;  1N6F A;  3MH7 A;  4PQW A;  3KZD A;  1X9Z A;  1Y7N A;  1WI4 A;  2AWX A;  1WF7 A;  2REY A;  3QO6 A;  2LC6 A;  2VZ5 A;  4OEP A;  2F5Y A;  2AWW A;  2ZPL A;  4Z33 A;  2I4S A;  3GAB A;  2DB5 A;  2MHO A;  3GCN A;  2F0A A;  3CBY A;  1ZOK A;  3GJ9 A;  2IWN A;  3QE1 A;  1LCY A;  3PDZ A;  5HJ1 A;  2Q9V A;  1N6E A;  4WYU A;  4NMR A;  4E35 A;  1U38 A;  3PDV A;  1GQ5 A;  4RI0 A;  4JOP A;  3TSW A;  4LMM A;  2P3W A;  2V1W A;  3PV5 A;  4NMQ A;  1M5Z A;  1WH1 A;  2EXG A;  3CBX A;  5HF1 A;  3I1E A;  1GQ4 A;  2JXO A;  1FC7 A;  4NMO A;  2PA1 A;  4E3B A;  1WJL A;  3NGH A;  2VRF A;  5HFD A;  1RGR A;  2Z9I A;  5HFB A;  2JWE A;  2EDP A;  2EJY A;  4Z8J A;  1W9O A;  3MH6 A;  4WYT A;  3VQF A;  1X5R A;  2KOJ A;  5B42 A;  2D92 A;  4Q2Q A;  1X5N A;  2EAQ A;  2V90 A;  3GDS A;  2KJK A;  2K1Z A;  4P0C A;  2R3Y A;  4Q2O A;  1UJU A;  1IU0 A;  4XHV A;  5HFC A;  1OBX A;  3CH8 A;  1SOT A;  1X45 A;  1Y8T A;  1VJ6 A;  1Z86 A;  3ID1 A;  4NNM A;  2W7R A;  2QKT A;  3NFK A;  2QKU A;  1KEF A;  2EV8 A;  3WKM A;  4Q2N A;  2HGA A;  3R68 A;  1OZI A;  4HOP A;  1UFX A;  2LUI A;  1TP3 A;  5HFF A;  1VA8 A;  1QAU A;  2DAZ A;  1NTE A;  4E34 A;  1X8S A;  4KFV A;  1IU2 A;  2YT7 A;  2M10 A;  4Q3H A;  2OPG A;  4JL7 A;  5DTH A;  1OBZ A;  5F67 A;  1V62 A;  3RLE A;  3GDU A;  3CS0 A;  3WKL A;  4N6X A;  2DJT A;  1B8Q A;  4GVD A;  1VCW A;  1WHA A;  2PNT A;  2KYL A;  1FC6 A;  3K1R A;  2ENO A;  1N6D A;  4NMP A;  3L4F D;  1L6O A;  2PDZ A;  4JOJ A;  3B76 A;  3CC0 A;  5GLJ A;  2L4S A;  2QBW A;  3DJA A;  2JIN A;  3QGL A;  1KY9 A;  3RL8 A;  1OBY A;  3K82 A;  2PKU A;  2JIL A;  2H2B A;  1UJV A;  3R69 A;  4NMS A;  5EZ0 A;  1G9O A;  3LNX A;  1MFL A;  3O5N A;  3NFL A;  1Q3O A;  1Q7X A;  1W9E A;  3DJ3 A;  4JOE A;  1UEZ A;  2QKV A;  3EGH C;  1N99 A;  2KL1 A;  2JIK A;  1SOZ A;  2E7K A;  4MPA A;  2IWQ A;  4NNL A;  1D5G A;  2DLU A;  3AXA A;  2VSV A;  2GEF A;  3PS4 A;  3KDG A;  3SFJ A;  4Q6H A;  5HEB A;  1MC7 A;  1P1D A;  2W4F A;  1WFV A;  5E11 A;  2O2T A;  3TSV A;  2LA8 A;  5GND A;  3GCO A;  1BE9 A;  5E1Y A;  5HEY A;  2I0I A;  3FY5 A;  1ZUB A;  1V5Q A;  1WF8 A;  4UU6 A;  2FN5 A;  3TSZ A;  3DIW A;  2K20 A;  4NXP A;  3I18 A;  3DJ1 A;  2Q3G A;  1I92 A;  5JXB A;  3CBZ A;  4H11 A;  1QAV B;  5HFE A;  3KDK A;  3SHU A;  1X6D A;  2IWO A;  3OU0 A;  1XZ9 A;  2I0L A;  4NXR A;  2M0V A;  1UHP A;  5HET A;  3VQG A;  1NF3 C;  1RY4 A;  2R4H A;  2G2L A;  1FCF A;  4G69 A;  1UJD A;  1UEW A;  2UZC A;  1U37 A;  2OMJ A;  2IWP A;  5E21 A;  2EGK A;  1RZX A;  2EEI A;  5B6L A; 
#chains in the Genus database with same CATH homology
 4YDP A;  1V1T A;  2EHR A;  1K32 A;  4JOR A;  5G1E A;  2EDV A;  1WG6 A;  2H3M A;  2DKR A;  2M3M A;  3LNY A;  3NCV A;  2I1N A;  2X7Z A;  2LC7 A;  1VAE A;  1TQ3 A;  3SHW A;  1KWA A;  2I04 A;  5I7Z A;  2RCZ A;  3DOR A;  4JOG A;  1UIT A;  2ZPM A;  3O46 A;  3ZRT A;  3QJM A;  1FC9 A;  4O06 A;  3GSL A;  4EDJ A;  4AMH A;  1QLC A;  3HPM A;  2BYG A;  1WFG A;  1UF1 A;  2DMZ A;  2JOA A;  1X5Q A;  1N7T A;  1VB7 A;  4NMT A;  1V5L A;  4K72 A;  4JOF A;  3ID4 A;  2G5M B;  2LOB A;  1QAV A;  1GM1 A;  3JXT A;  2KBS A;  5IL9 A;  2M0T A;  4JOH A;  2QT5 A;  2GZV A;  2YUB A;  4F8K A;  4HOP B;  3PV2 A;  4NMV A;  2KPL A;  5EYZ A;  4JJ3 A;  1V6B A;  3QJN A;  4Q6S A;  4Q2P A;  3K50 A;  2AWU A;  2KG2 A;  1U39 A;  3RL7 A;  2VSP A;  4JOK A;  3HVQ C;  1PDR A;  2L4T A;  2D90 A;  5D13 A;  5E6P B;  2OZF A;  3GDV A;  2M0U A;  4IC6 A;  2EEJ A;  4K78 A;  2VWR A;  4YYX A;  1T2M A;  2FE5 A;  1IHJ A;  4GVC A;  2EGN A;  2KA9 A;  2KAW A;  3MH4 A;  2OSG A;  3KHF A;  4L8N A;  2D8I A;  1WI2 A;  1MFG A;  2KRG A;  3GGE A;  1W9Q A;  5HED A;  2CSJ A;  2KQF A;  1N7E A;  1UM7 A;  3QDO A;  4R2Z A;  2YTW A;  1UM1 A;  1P1E A;  5FB8 C;  1UEP A;  2CSS A;  2OCS A;  4JJ0 A;  4K76 A;  5HDY A;  1Q3P A;  5E22 A;  3SUZ A;  2OGP A;  1Z87 A;  4FLN A;  2M0Z A;  3ID3 A;  1TP5 A;  2H2C A;  2HE2 A;  3EGG C;  4GHN A;  5A2P A;  2DM8 A;  2KOH A;  2VPH A;  3QIK A;  4KFW A;  4REY A;  2KPK A;  4OEO A;  1TE0 A;  2I6V A;  3I4W A;  2HE4 A;  2QG1 A;  2EEG A;  2OQS A;  2FCF A;  3ID2 A;  1BFE A;  3OTP A;  4FGM A;  3TMH A;  2EEH A;  2PZD A;  4K6Y A;  5F3X A;  2YUY A;  1UEQ A;  2H3L A;  3SOE A;  5G1D A;  3STJ A;  1N7F A;  4OAJ A;  2Z17 A;  2CS5 A;  4NXQ A;  2DC2 A;  1WHD A;  1WIF A;  2JRE A;  1R6J A;  1U3B A;  2KOM A;  2MX6 A;  4UU5 A;  4P2A B;  3HPK A;  5ILB A;  4K75 A;  3CYY A;  2AIN A;  2KV8 A;  2PKT A;  2YT8 A;  2JSN A;  3KZE A;  5H3J A;  2KJD A;  3PV4 A;  5HF4 A;  2DLS A;  2EDZ A;  2EGO A;  2WL7 A;  5FHT A;  2KJP A;  2OS6 A;  1RGW A;  2L97 A;  2RRM A;  3BPU A;  3R0H A;  1I16 A;  3E17 A;  1YBO A;  2FNE A;  1N6F A;  3MH7 A;  4PQW A;  3KZD A;  1X9Z A;  1Y7N A;  1WI4 A;  2AWX A;  1WF7 A;  2REY A;  3QO6 A;  2LC6 A;  2VZ5 A;  4OEP A;  2F5Y A;  2AWW A;  2ZPL A;  4Z33 A;  2I4S A;  3GAB A;  2DB5 A;  2MHO A;  3GCN A;  2F0A A;  3CBY A;  1ZOK A;  3GJ9 A;  2IWN A;  3QE1 A;  1LCY A;  3PDZ A;  5HJ1 A;  2Q9V A;  1N6E A;  4WYU A;  4NMR A;  4E35 A;  1U38 A;  3PDV A;  1GQ5 A;  4RI0 A;  4JOP A;  3TSW A;  4LMM A;  2P3W A;  2V1W A;  3PV5 A;  4NMQ A;  1M5Z A;  1WH1 A;  2EXG A;  3CBX A;  5HF1 A;  3I1E A;  1GQ4 A;  2JXO A;  1FC7 A;  4NMO A;  2PA1 A;  4E3B A;  1WJL A;  3NGH A;  2VRF A;  5HFD A;  1RGR A;  2Z9I A;  5HFB A;  2JWE A;  2EDP A;  2EJY A;  4Z8J A;  1W9O A;  3MH6 A;  4WYT A;  3VQF A;  1X5R A;  2KOJ A;  5B42 A;  2D92 A;  4Q2Q A;  1X5N A;  2EAQ A;  2V90 A;  3GDS A;  2KJK A;  2K1Z A;  4P0C A;  2R3Y A;  4Q2O A;  1UJU A;  1IU0 A;  4XHV A;  5HFC A;  1OBX A;  3CH8 A;  1SOT A;  1X45 A;  1Y8T A;  1VJ6 A;  1Z86 A;  3ID1 A;  4NNM A;  2W7R A;  2QKT A;  3NFK A;  2QKU A;  1KEF A;  2EV8 A;  3WKM A;  4Q2N A;  2HGA A;  3R68 A;  1OZI A;  4HOP A;  1UFX A;  2LUI A;  1TP3 A;  5HFF A;  1VA8 A;  1QAU A;  2DAZ A;  1NTE A;  4E34 A;  1X8S A;  4KFV A;  1IU2 A;  2YT7 A;  2M10 A;  4Q3H A;  2OPG A;  4JL7 A;  5DTH A;  1OBZ A;  5F67 A;  1V62 A;  3RLE A;  3GDU A;  3CS0 A;  3WKL A;  4N6X A;  2DJT A;  1B8Q A;  4GVD A;  1VCW A;  1WHA A;  2PNT A;  2KYL A;  1FC6 A;  3K1R A;  2ENO A;  1N6D A;  4NMP A;  3L4F D;  1L6O A;  2PDZ A;  4JOJ A;  3B76 A;  3CC0 A;  5GLJ A;  2L4S A;  2QBW A;  3DJA A;  2JIN A;  3QGL A;  1KY9 A;  3RL8 A;  1OBY A;  3K82 A;  2PKU A;  2JIL A;  2H2B A;  1UJV A;  3R69 A;  4NMS A;  5EZ0 A;  1G9O A;  3LNX A;  1MFL A;  3O5N A;  3NFL A;  1Q3O A;  1Q7X A;  1W9E A;  3DJ3 A;  4JOE A;  1UEZ A;  2QKV A;  3EGH C;  1N99 A;  2KL1 A;  2JIK A;  1SOZ A;  2E7K A;  4MPA A;  2IWQ A;  4NNL A;  1D5G A;  2DLU A;  3AXA A;  2VSV A;  2GEF A;  3PS4 A;  3KDG A;  3SFJ A;  4Q6H A;  5HEB A;  1MC7 A;  1P1D A;  2W4F A;  1WFV A;  5E11 A;  2O2T A;  3TSV A;  2LA8 A;  5GND A;  3GCO A;  1BE9 A;  5E1Y A;  5HEY A;  2I0I A;  3FY5 A;  1ZUB A;  1V5Q A;  1WF8 A;  4UU6 A;  2FN5 A;  3TSZ A;  3DIW A;  2K20 A;  4NXP A;  3I18 A;  3DJ1 A;  2Q3G A;  1I92 A;  5JXB A;  3CBZ A;  4H11 A;  1QAV B;  5HFE A;  3KDK A;  3SHU A;  1X6D A;  2IWO A;  3OU0 A;  1XZ9 A;  2I0L A;  4NXR A;  2M0V A;  1UHP A;  5HET A;  3VQG A;  1NF3 C;  1RY4 A;  2R4H A;  2G2L A;  1FCF A;  4G69 A;  1UJD A;  1UEW A;  2UZC A;  1U37 A;  2OMJ A;  2IWP A;  5E21 A;  2EGK A;  1RZX A;  2EEI A;  5B6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...