3AXAA

Crystal structure of afadin pdz domain in complex with the c-terminal peptide from nectin-3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
PEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIRREWYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Afadin, Nectin-3
publication title Crystal structure of afadin PDZ domain-nectin-3 complex shows the structural plasticity of the ligand-binding site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 17
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3axaA00
3HVQC 2I0LA 1QAVB 2L97A 3PV2A 2VPHA 3WKMA 2OGPA 4UU6A 5GNDA 2JWEA 1B8QA 3GGEA 4JOJA 2KPLA 2KJKA 4K78A 2JILA 5HFBA 5HEDA 2ZPMA 1Q3PA 3O46A 2KBSA 4NMOA 3RLEA 4EDJA 1VJ6A 2H3LA 4NXQA 2ENOA 3QE1A 4NMQA 4FGMA 4OEOA 1WFGA 5HDYA 1NTEA 2DLUA 2KL1A 1UJVA 3QGLA 5JXBA 2DC2A 3HPKA 5D13A 2EEJA 2ZPLA 2HGAA 3MH7A 5HETA 2KOJA 2CSSA 3NFLA 4JL7A 5E22A 1N6DA 1QAVA 4Q3HA 2JIKA 2QG1A 4MPAA 2OCSA 5FB8C 2M0UA 1WIFA 5EYZA 2H2CA 1GM1A 3K82A 4Q6SA 1VA8A 4JORA 1WJLA 1SOZA 4O06A 3HPMA 1FC7A 1WF7A 2QBWA 1N7EA 4YYXA 3DJ3A 2KG2A 2DAZA 2KPKA 3VQFA 2YT7A 2REYA 5HFEA 3SHWA 2VZ5A 3CBYA 1WH1A 3CC0A 4JOPA 1RGRA 3OTPA 3QIKA 3BPUA 2DM8A 2MHOA 1I92A 2DLSA 2EXGA 3R69A 4Z8JA 1Q3OA 4Z33A 2VRFA 2G2LA 2EDVA 1VCWA 2CSJA 1VB7A 1N6FA 1N7FA 1RZXA 3GCOA 2I1NA 4AMHA 3QJNA 5F3XA 2KAWA 1UJDA 5HFDA 2JINA 1V5QA 5H3JA 2EDZA 2OQSA 2I4SA 2JXOA 3PDZA 3PDVA 1I16A 3SOEA 2I04A 1UM1A 3STJA 1V1TA 2V1WA 1R6JA 1OBXA 1UEZA 1Y7NA 2JOAA 4UU5A 3JXTA 1UEQA 2F5YA 3PS4A 3QDOA 1X5NA 5DTHA 2FNEA 2EDPA 1FCFA 2I6VA 2DJTA 5E11A 2M0TA 4NMSA 2R4HA 2EEHA 1W9EA 3MH6A 2M10A 4R2ZA 4K72A 2H2BA 3GSLA 2AINA 5G1EA 4K6YA 2PZDA 2PKTA 3KZDA 2F0AA 1XZ9A 2K20A 1BFEA 1PDRA 5HF4A 2G5MB 4Q6HA 1L6OA 1UFXA 2KA9A 2Q3GA 2PDZA 1OBZA 4NMRA 1WHDA 2EJYA 4E35A 1X5RA 2RRMA 1OZIA 2EGNA 1X6DA 3TMHA 1U37A 2VSVA 2PNTA 4PQWA 2LUIA 3QO6A 1WHAA 2IWNA 1X8SA 2KQFA 5HEYA 4NMVA 3FY5A 1RGWA 4OEPA 4IC6A 3I4WA 2EHRA 2L4TA 1UHPA 1KEFA 3I18A 1N7TA 4JOKA 3TSWA 2EEGA 1ZOKA 1NF3C 1Z86A 2EEIA 1OBYA 2E7KA 2EGOA 3TSVA 2AWWA 2UZCA 2QKTA 2D90A 3GDSA 1FC6A 1YBOA 2FN5A 5GLJA 2V90A 5A2PA 2HE2A 5HFCA 2R3YA 1RY4A 2VSPA 5I7ZA 5E21A 3DIWA 2Z17A 2OPGA 2YUYA 1U39A 3E17A 1UJUA 4NXRA 4Q2OA 1M5ZA 2FE5A 1WF8A 2QKVA 1UEWA 3CYYA 5E6PB 4GHNA 2IWOA 2KRGA 1QAUA 4RI0A 1VAEA 5E1YA 4E34A 1V5LA 2HE4A 3OU0A 2VWRA 4JOHA 1MFGA 3GJ9A 3DORA 3LNXA 4XHVA 1P1DA 3B76A 1TP5A 2KOMA 4K76A 3RL8A 3L4FD 2YTWA 3TSZA 3R0HA 4JOFA 3QJMA 1QLCA 3KZEA 1D5GA 3VQGA 3CBXA 1Y8TA 1FC9A 3SUZA 2YT8A 2OSGA 1Z87A 3PV4A 1P1EA 3AXAA 5HEBA 3WKLA 2IWPA 1GQ5A 3CS0A 3EGGC 3GCNA 1WI2A 2D92A 4Q2NA 4LMMA 3LNYA 2H3MA 2AWXA 4REYA 3PV5A 3NFKA 4F8KA 1BE9A 3MH4A 4NXPA 5F67A 4NMPA 4HOPB 1IHJA 2LA8A 1X45A 2LC7A 4YDPA 2LOBA 1TQ3A 1UM7A 1G9OA 3ID1A 3K1RA 2BYGA 4NNMA 2FCFA 3DJAA 2QT5A 2CS5A 1T2MA 2L4SA 3EGHC 1X5QA 1KWAA 3RL7A 2Q9VA 4Q2QA 5G1DA 5HJ1A 2DMZA 4H11A 4N6XA 3ID4A 1UITA 1U38A 2O2TA 1U3BA 3ID2A 3DJ1A 1W9QA 2YUBA 3ID3A 2M3MA 4GVCA 1WG6A 3O5NA 2EGKA 4KFVA 2W4FA 2EV8A 2LC6A 1TP3A 5FHTA 4GVDA 1N6EA 1N99A 2Z9IA 1WFVA 4HOPA 1SOTA 3SFJA 3SHUA 3GDUA 2OS6A 4K75A 2JREA 3GDVA 2P3WA 2KV8A 1TE0A 1KY9A 3KHFA 5HF1A 4JOEA 1ZUBA 1UF1A 4NNLA 3R68A 4KFWA 2PKUA 2RCZA 3I1EA 2OZFA 1GQ4A 5B6LA 2EAQA 4G69A 2K1ZA 1K32A 2OMJA 2DKRA 2M0ZA 2I0IA 4OAJA 2MX6A 4WYUA 4E3BA 4JOGA 4WYTA 3ZRTA 1UEPA 2IWQA 1IU0A 2D8IA 2KJDA 2KJPA 2PA1A 5HFFA 4Q2PA 4P2AB 1V62A 1MC7A 1WI4A 2AWUA 2QKUA 2KYLA 2X7ZA 1LCYA 4P0CA 1MFLA 2DB5A 2W7RA 3CH8A 1Q7XA 3K50A 2M0VA 2KOHA 4NMTA 5EZ0A 3NGHA 4L8NA 1W9OA 3CBZA 2GZVA 1IU2A 1V6BA 2WL7A
chains in the Genus database with same CATH superfamily
3HVQC 2I0LA 1QAVB 2L97A 3PV2A 2VPHA 3WKMA 2OGPA 4UU6A 5GNDA 2JWEA 1B8QA 3GGEA 4JOJA 2KPLA 2KJKA 4K78A 2JILA 5HFBA 5HEDA 2ZPMA 1Q3PA 3O46A 2KBSA 4NMOA 3RLEA 4EDJA 1VJ6A 2H3LA 4NXQA 2ENOA 3QE1A 4NMQA 4FGMA 4OEOA 1WFGA 5HDYA 1NTEA 2DLUA 2KL1A 1UJVA 3QGLA 5JXBA 2DC2A 3HPKA 5D13A 2EEJA 2ZPLA 2HGAA 3MH7A 5HETA 2KOJA 2CSSA 3NFLA 4JL7A 5E22A 1N6DA 1QAVA 4Q3HA 2JIKA 2QG1A 4MPAA 2OCSA 5FB8C 2M0UA 1WIFA 5EYZA 2H2CA 1GM1A 3K82A 4Q6SA 1VA8A 4JORA 1WJLA 1SOZA 4O06A 3HPMA 1FC7A 1WF7A 2QBWA 1N7EA 4YYXA 3DJ3A 2KG2A 2DAZA 2KPKA 3VQFA 2YT7A 2REYA 5HFEA 3SHWA 2VZ5A 3CBYA 1WH1A 3CC0A 4JOPA 1RGRA 3OTPA 3QIKA 3BPUA 2DM8A 2MHOA 1I92A 2DLSA 2EXGA 3R69A 4Z8JA 1Q3OA 4Z33A 2VRFA 2G2LA 2EDVA 1VCWA 2CSJA 1VB7A 1N6FA 1N7FA 1RZXA 3GCOA 2I1NA 4AMHA 3QJNA 5F3XA 2KAWA 1UJDA 5HFDA 2JINA 1V5QA 5H3JA 2EDZA 2OQSA 2I4SA 2JXOA 3PDZA 3PDVA 1I16A 3SOEA 2I04A 1UM1A 3STJA 1V1TA 2V1WA 5B42A 1R6JA 1OBXA 1UEZA 1Y7NA 2JOAA 4UU5A 3JXTA 1UEQA 2F5YA 3PS4A 3QDOA 1X5NA 5DTHA 2FNEA 2EDPA 1FCFA 2I6VA 4FLNA 2DJTA 5E11A 2M0TA 4NMSA 2R4HA 2EEHA 3KDGA 1W9EA 3MH6A 2M10A 4R2ZA 4K72A 2H2BA 3GSLA 2AINA 3KDKA 5G1EA 4K6YA 2PZDA 2PKTA 3KZDA 2F0AA 1XZ9A 2JSNA 2K20A 1BFEA 1PDRA 5HF4A 2G5MB 4Q6HA 1L6OA 1UFXA 2KA9A 2Q3GA 2PDZA 1OBZA 4NMRA 1WHDA 2EJYA 4E35A 1X5RA 2RRMA 1OZIA 2EGNA 1X6DA 3TMHA 1U37A 2VSVA 2PNTA 5ILBA 4PQWA 2LUIA 3QO6A 1WHAA 2IWNA 1X8SA 2KQFA 5HEYA 4NMVA 3FY5A 1RGWA 4OEPA 4IC6A 3I4WA 2EHRA 2L4TA 1UHPA 1KEFA 3I18A 1N7TA 4JOKA 3TSWA 2EEGA 1ZOKA 1NF3C 1Z86A 2EEIA 1OBYA 2E7KA 2EGOA 3TSVA 2AWWA 2UZCA 2QKTA 2D90A 3GDSA 1FC6A 1YBOA 2FN5A 5GLJA 4JJ3A 2V90A 5A2PA 2HE2A 5HFCA 2R3YA 1RY4A 2VSPA 5I7ZA 5E21A 3DIWA 2Z17A 2OPGA 2YUYA 1U39A 3E17A 1UJUA 4NXRA 4Q2OA 1M5ZA 2FE5A 3GABA 1WF8A 2QKVA 1UEWA 3CYYA 5E6PB 4GHNA 2IWOA 2KRGA 1QAUA 4RI0A 1VAEA 5E1YA 4E34A 1V5LA 2HE4A 3OU0A 2VWRA 4JOHA 1MFGA 3GJ9A 3DORA 3LNXA 4XHVA 1P1DA 3B76A 1TP5A 2KOMA 4K76A 3RL8A 3L4FD 2YTWA 3TSZA 3R0HA 4JOFA 3QJMA 1QLCA 3KZEA 1D5GA 3VQGA 3CBXA 1Y8TA 1X9ZA 5IL9A 1FC9A 3SUZA 2YT8A 2OSGA 1Z87A 3PV4A 1P1EA 3AXAA 5HEBA 3WKLA 2IWPA 1GQ5A 3CS0A 3EGGC 3GCNA 1WI2A 2D92A 4Q2NA 4LMMA 3LNYA 2H3MA 2AWXA 4REYA 3PV5A 3NFKA 4F8KA 2GEFA 1BE9A 3MH4A 4NXPA 5F67A 4NMPA 4HOPB 1IHJA 2LA8A 1X45A 2LC7A 4YDPA 2LOBA 1TQ3A 1UM7A 1G9OA 3ID1A 3K1RA 2BYGA 4NNMA 2FCFA 3DJAA 2QT5A 2CS5A 1T2MA 2L4SA 3EGHC 1X5QA 1KWAA 3RL7A 2Q9VA 4Q2QA 5G1DA 5HJ1A 2DMZA 4H11A 4N6XA 3ID4A 1UITA 1U38A 2O2TA 1U3BA 3ID2A 3DJ1A 1W9QA 2YUBA 3ID3A 2M3MA 4GVCA 1WG6A 3O5NA 2EGKA 4KFVA 2W4FA 2EV8A 2LC6A 1TP3A 5FHTA 4GVDA 1N6EA 1N99A 2Z9IA 1WFVA 4HOPA 1SOTA 3SFJA 3SHUA 3GDUA 2OS6A 4K75A 2JREA 3GDVA 2P3WA 2KV8A 1TE0A 1KY9A 3KHFA 5HF1A 4JOEA 1ZUBA 1UF1A 4NNLA 3R68A 4KFWA 2PKUA 2RCZA 3I1EA 2OZFA 1GQ4A 5B6LA 2EAQA 4G69A 2K1ZA 3NCVA 1K32A 2OMJA 2DKRA 2M0ZA 2I0IA 4OAJA 2MX6A 4WYUA 4E3BA 4JOGA 4WYTA 3ZRTA 1UEPA 2IWQA 1IU0A 2D8IA 2KJDA 2KJPA 2PA1A 5HFFA 4Q2PA 4P2AB 1V62A 1MC7A 4JJ0A 1WI4A 2AWUA 2QKUA 2KYLA 2X7ZA 1LCYA 4P0CA 1MFLA 2DB5A 2W7RA 3CH8A 1Q7XA 3K50A 2M0VA 2KOHA 4NMTA 5EZ0A 3NGHA 4L8NA 1W9OA 3CBZA 2GZVA 1IU2A 1V6BA 2WL7A
chains in the Genus database with same CATH topology
3HVQC 2I0LA 1QAVB 2L97A 3PV2A 2VPHA 3WKMA 2OGPA 4UU6A 5GNDA 2JWEA 1B8QA 3GGEA 4JOJA 2KPLA 2KJKA 4K78A 2JILA 5HFBA 5HEDA 2ZPMA 1Q3PA 3O46A 2KBSA 4NMOA 3RLEA 4EDJA 1VJ6A 2H3LA 4NXQA 2ENOA 3QE1A 4NMQA 4FGMA 4OEOA 1WFGA 5HDYA 1NTEA 2DLUA 2KL1A 1UJVA 3QGLA 5JXBA 2DC2A 3HPKA 5D13A 2EEJA 2ZPLA 2HGAA 3MH7A 5HETA 2KOJA 2CSSA 3NFLA 4JL7A 5E22A 1N6DA 1QAVA 4Q3HA 2JIKA 2QG1A 4MPAA 2OCSA 5FB8C 2M0UA 1WIFA 5EYZA 2H2CA 1GM1A 3K82A 4Q6SA 1VA8A 4JORA 1WJLA 1SOZA 4O06A 3HPMA 1FC7A 1WF7A 2QBWA 1N7EA 4YYXA 3DJ3A 2KG2A 2DAZA 2KPKA 3VQFA 2YT7A 2REYA 5HFEA 3SHWA 2VZ5A 3CBYA 1WH1A 3CC0A 4JOPA 1RGRA 3OTPA 3QIKA 3BPUA 2DM8A 2MHOA 1I92A 2DLSA 2EXGA 3R69A 4Z8JA 1Q3OA 4Z33A 2VRFA 2G2LA 2EDVA 1VCWA 2CSJA 1VB7A 1N6FA 1N7FA 1RZXA 3GCOA 2I1NA 4AMHA 3QJNA 5F3XA 2KAWA 1UJDA 5HFDA 2JINA 1V5QA 5H3JA 2EDZA 2OQSA 2I4SA 2JXOA 3PDZA 3PDVA 1I16A 3SOEA 2I04A 1UM1A 3STJA 1V1TA 2V1WA 5B42A 1R6JA 1OBXA 1UEZA 1Y7NA 2JOAA 4UU5A 3JXTA 1UEQA 2F5YA 3PS4A 3QDOA 1X5NA 5DTHA 2FNEA 2EDPA 1FCFA 2I6VA 4FLNA 2DJTA 5E11A 2M0TA 4NMSA 2R4HA 2EEHA 3KDGA 1W9EA 3MH6A 2M10A 4R2ZA 4K72A 2H2BA 3GSLA 2AINA 3KDKA 5G1EA 4K6YA 2PZDA 2PKTA 3KZDA 2F0AA 1XZ9A 2JSNA 2K20A 1BFEA 1PDRA 5HF4A 2G5MB 4Q6HA 1L6OA 1UFXA 2KA9A 2Q3GA 2PDZA 1OBZA 4NMRA 1WHDA 2EJYA 4E35A 1X5RA 2RRMA 1OZIA 2EGNA 1X6DA 3TMHA 1U37A 2VSVA 2PNTA 5ILBA 4PQWA 2LUIA 3QO6A 1WHAA 2IWNA 1X8SA 2KQFA 5HEYA 4NMVA 3FY5A 1RGWA 4OEPA 4IC6A 3I4WA 2EHRA 2L4TA 1UHPA 1KEFA 3I18A 1N7TA 4JOKA 3TSWA 2EEGA 1ZOKA 1NF3C 1Z86A 2EEIA 1OBYA 2E7KA 2EGOA 3TSVA 2AWWA 2UZCA 2QKTA 2D90A 3GDSA 1FC6A 1YBOA 2FN5A 5GLJA 4JJ3A 2V90A 5A2PA 2HE2A 5HFCA 2R3YA 1RY4A 2VSPA 5I7ZA 5E21A 3DIWA 2Z17A 2OPGA 2YUYA 1U39A 3E17A 1UJUA 4NXRA 4Q2OA 1M5ZA 2FE5A 3GABA 1WF8A 2QKVA 1UEWA 3CYYA 5E6PB 4GHNA 2IWOA 2KRGA 1QAUA 4RI0A 1VAEA 5E1YA 4E34A 1V5LA 2HE4A 3OU0A 2VWRA 4JOHA 1MFGA 3GJ9A 3DORA 3LNXA 4XHVA 1P1DA 3B76A 1TP5A 2KOMA 4K76A 3RL8A 3L4FD 2YTWA 3TSZA 3R0HA 4JOFA 3QJMA 1QLCA 3KZEA 1D5GA 3VQGA 3CBXA 1Y8TA 1X9ZA 5IL9A 1FC9A 3SUZA 2YT8A 2OSGA 1Z87A 3PV4A 1P1EA 3AXAA 5HEBA 3WKLA 2IWPA 1GQ5A 3CS0A 3EGGC 3GCNA 1WI2A 2D92A 4Q2NA 4LMMA 3LNYA 2H3MA 2AWXA 4REYA 3PV5A 3NFKA 4F8KA 2GEFA 1BE9A 3MH4A 4NXPA 5F67A 4NMPA 4HOPB 1IHJA 2LA8A 1X45A 2LC7A 4YDPA 2LOBA 1TQ3A 1UM7A 1G9OA 3ID1A 3K1RA 2BYGA 4NNMA 2FCFA 3DJAA 2QT5A 2CS5A 1T2MA 2L4SA 3EGHC 1X5QA 1KWAA 3RL7A 2Q9VA 4Q2QA 5G1DA 5HJ1A 2DMZA 4H11A 4N6XA 3ID4A 1UITA 1U38A 2O2TA 1U3BA 3ID2A 3DJ1A 1W9QA 2YUBA 3ID3A 2M3MA 4GVCA 1WG6A 3O5NA 2EGKA 4KFVA 2W4FA 2EV8A 2LC6A 1TP3A 5FHTA 4GVDA 1N6EA 1N99A 2Z9IA 1WFVA 4HOPA 1SOTA 3SFJA 3SHUA 3GDUA 2OS6A 4K75A 2JREA 3GDVA 2P3WA 2KV8A 1TE0A 1KY9A 3KHFA 5HF1A 4JOEA 1ZUBA 1UF1A 4NNLA 3R68A 4KFWA 2PKUA 2RCZA 3I1EA 2OZFA 1GQ4A 5B6LA 2EAQA 4G69A 2K1ZA 3NCVA 1K32A 2OMJA 2DKRA 2M0ZA 2I0IA 4OAJA 2MX6A 4WYUA 4E3BA 4JOGA 4WYTA 3ZRTA 1UEPA 2IWQA 1IU0A 2D8IA 2KJDA 2KJPA 2PA1A 5HFFA 4Q2PA 4P2AB 1V62A 1MC7A 4JJ0A 1WI4A 2AWUA 2QKUA 2KYLA 2X7ZA 1LCYA 4P0CA 1MFLA 2DB5A 2W7RA 3CH8A 1Q7XA 3K50A 2M0VA 2KOHA 4NMTA 5EZ0A 3NGHA 4L8NA 1W9OA 3CBZA 2GZVA 1IU2A 1V6BA 2WL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVQ C;  2I0L A;  1QAV B;  2L97 A;  3PV2 A;  2VPH A;  3WKM A;  2OGP A;  4UU6 A;  5GND A;  2JWE A;  1B8Q A;  3GGE A;  4JOJ A;  2KPL A;  2KJK A;  4K78 A;  2JIL A;  5HFB A;  5HED A;  2ZPM A;  1Q3P A;  3O46 A;  2KBS A;  4NMO A;  3RLE A;  4EDJ A;  1VJ6 A;  2H3L A;  4NXQ A;  2ENO A;  3QE1 A;  4NMQ A;  4FGM A;  4OEO A;  1WFG A;  5HDY A;  1NTE A;  2DLU A;  2KL1 A;  1UJV A;  3QGL A;  5JXB A;  2DC2 A;  3HPK A;  5D13 A;  2EEJ A;  2ZPL A;  2HGA A;  3MH7 A;  5HET A;  2KOJ A;  2CSS A;  3NFL A;  4JL7 A;  5E22 A;  1N6D A;  1QAV A;  4Q3H A;  2JIK A;  2QG1 A;  4MPA A;  2OCS A;  5FB8 C;  2M0U A;  1WIF A;  5EYZ A;  2H2C A;  1GM1 A;  3K82 A;  4Q6S A;  1VA8 A;  4JOR A;  1WJL A;  1SOZ A;  4O06 A;  3HPM A;  1FC7 A;  1WF7 A;  2QBW A;  1N7E A;  4YYX A;  3DJ3 A;  2KG2 A;  2DAZ A;  2KPK A;  3VQF A;  2YT7 A;  2REY A;  5HFE A;  3SHW A;  2VZ5 A;  3CBY A;  1WH1 A;  3CC0 A;  4JOP A;  1RGR A;  3OTP A;  3QIK A;  3BPU A;  2DM8 A;  2MHO A;  1I92 A;  2DLS A;  2EXG A;  3R69 A;  4Z8J A;  1Q3O A;  4Z33 A;  2VRF A;  2G2L A;  2EDV A;  1VCW A;  2CSJ A;  1VB7 A;  1N6F A;  1N7F A;  1RZX A;  3GCO A;  2I1N A;  4AMH A;  3QJN A;  5F3X A;  2KAW A;  1UJD A;  5HFD A;  2JIN A;  1V5Q A;  5H3J A;  2EDZ A;  2OQS A;  2I4S A;  2JXO A;  3PDZ A;  3PDV A;  1I16 A;  3SOE A;  2I04 A;  1UM1 A;  3STJ A;  1V1T A;  2V1W A;  1R6J A;  1OBX A;  1UEZ A;  1Y7N A;  2JOA A;  4UU5 A;  3JXT A;  1UEQ A;  2F5Y A;  3PS4 A;  3QDO A;  1X5N A;  5DTH A;  2FNE A;  2EDP A;  1FCF A;  2I6V A;  2DJT A;  5E11 A;  2M0T A;  4NMS A;  2R4H A;  2EEH A;  1W9E A;  3MH6 A;  2M10 A;  4R2Z A;  4K72 A;  2H2B A;  3GSL A;  2AIN A;  5G1E A;  4K6Y A;  2PZD A;  2PKT A;  3KZD A;  2F0A A;  1XZ9 A;  2K20 A;  1BFE A;  1PDR A;  5HF4 A;  2G5M B;  4Q6H A;  1L6O A;  1UFX A;  2KA9 A;  2Q3G A;  2PDZ A;  1OBZ A;  4NMR A;  1WHD A;  2EJY A;  4E35 A;  1X5R A;  2RRM A;  1OZI A;  2EGN A;  1X6D A;  3TMH A;  1U37 A;  2VSV A;  2PNT A;  4PQW A;  2LUI A;  3QO6 A;  1WHA A;  2IWN A;  1X8S A;  2KQF A;  5HEY A;  4NMV A;  3FY5 A;  1RGW A;  4OEP A;  4IC6 A;  3I4W A;  2EHR A;  2L4T A;  1UHP A;  1KEF A;  3I18 A;  1N7T A;  4JOK A;  3TSW A;  2EEG A;  1ZOK A;  1NF3 C;  1Z86 A;  2EEI A;  1OBY A;  2E7K A;  2EGO A;  3TSV A;  2AWW A;  2UZC A;  2QKT A;  2D90 A;  3GDS A;  1FC6 A;  1YBO A;  2FN5 A;  5GLJ A;  2V90 A;  5A2P A;  2HE2 A;  5HFC A;  2R3Y A;  1RY4 A;  2VSP A;  5I7Z A;  5E21 A;  3DIW A;  2Z17 A;  2OPG A;  2YUY A;  1U39 A;  3E17 A;  1UJU A;  4NXR A;  4Q2O A;  1M5Z A;  2FE5 A;  1WF8 A;  2QKV A;  1UEW A;  3CYY A;  5E6P B;  4GHN A;  2IWO A;  2KRG A;  1QAU A;  4RI0 A;  1VAE A;  5E1Y A;  4E34 A;  1V5L A;  2HE4 A;  3OU0 A;  2VWR A;  4JOH A;  1MFG A;  3GJ9 A;  3DOR A;  3LNX A;  4XHV A;  1P1D A;  3B76 A;  1TP5 A;  2KOM A;  4K76 A;  3RL8 A;  3L4F D;  2YTW A;  3TSZ A;  3R0H A;  4JOF A;  3QJM A;  1QLC A;  3KZE A;  1D5G A;  3VQG A;  3CBX A;  1Y8T A;  1FC9 A;  3SUZ A;  2YT8 A;  2OSG A;  1Z87 A;  3PV4 A;  1P1E A;  3AXA A;  5HEB A;  3WKL A;  2IWP A;  1GQ5 A;  3CS0 A;  3EGG C;  3GCN A;  1WI2 A;  2D92 A;  4Q2N A;  4LMM A;  3LNY A;  2H3M A;  2AWX A;  4REY A;  3PV5 A;  3NFK A;  4F8K A;  1BE9 A;  3MH4 A;  4NXP A;  5F67 A;  4NMP A;  4HOP B;  1IHJ A;  2LA8 A;  1X45 A;  2LC7 A;  4YDP A;  2LOB A;  1TQ3 A;  1UM7 A;  1G9O A;  3ID1 A;  3K1R A;  2BYG A;  4NNM A;  2FCF A;  3DJA A;  2QT5 A;  2CS5 A;  1T2M A;  2L4S A;  3EGH C;  1X5Q A;  1KWA A;  3RL7 A;  2Q9V A;  4Q2Q A;  5G1D A;  5HJ1 A;  2DMZ A;  4H11 A;  4N6X A;  3ID4 A;  1UIT A;  1U38 A;  2O2T A;  1U3B A;  3ID2 A;  3DJ1 A;  1W9Q A;  2YUB A;  3ID3 A;  2M3M A;  4GVC A;  1WG6 A;  3O5N A;  2EGK A;  4KFV A;  2W4F A;  2EV8 A;  2LC6 A;  1TP3 A;  5FHT A;  4GVD A;  1N6E A;  1N99 A;  2Z9I A;  1WFV A;  4HOP A;  1SOT A;  3SFJ A;  3SHU A;  3GDU A;  2OS6 A;  4K75 A;  2JRE A;  3GDV A;  2P3W A;  2KV8 A;  1TE0 A;  1KY9 A;  3KHF A;  5HF1 A;  4JOE A;  1ZUB A;  1UF1 A;  4NNL A;  3R68 A;  4KFW A;  2PKU A;  2RCZ A;  3I1E A;  2OZF A;  1GQ4 A;  5B6L A;  2EAQ A;  4G69 A;  2K1Z A;  1K32 A;  2OMJ A;  2DKR A;  2M0Z A;  2I0I A;  4OAJ A;  2MX6 A;  4WYU A;  4E3B A;  4JOG A;  4WYT A;  3ZRT A;  1UEP A;  2IWQ A;  1IU0 A;  2D8I A;  2KJD A;  2KJP A;  2PA1 A;  5HFF A;  4Q2P A;  4P2A B;  1V62 A;  1MC7 A;  1WI4 A;  2AWU A;  2QKU A;  2KYL A;  2X7Z A;  1LCY A;  4P0C A;  1MFL A;  2DB5 A;  2W7R A;  3CH8 A;  1Q7X A;  3K50 A;  2M0V A;  2KOH A;  4NMT A;  5EZ0 A;  3NGH A;  4L8N A;  1W9O A;  3CBZ A;  2GZV A;  1IU2 A;  1V6B A;  2WL7 A; 
#chains in the Genus database with same CATH topology
 3HVQ C;  2I0L A;  1QAV B;  2L97 A;  3PV2 A;  2VPH A;  3WKM A;  2OGP A;  4UU6 A;  5GND A;  2JWE A;  1B8Q A;  3GGE A;  4JOJ A;  2KPL A;  2KJK A;  4K78 A;  2JIL A;  5HFB A;  5HED A;  2ZPM A;  1Q3P A;  3O46 A;  2KBS A;  4NMO A;  3RLE A;  4EDJ A;  1VJ6 A;  2H3L A;  4NXQ A;  2ENO A;  3QE1 A;  4NMQ A;  4FGM A;  4OEO A;  1WFG A;  5HDY A;  1NTE A;  2DLU A;  2KL1 A;  1UJV A;  3QGL A;  5JXB A;  2DC2 A;  3HPK A;  5D13 A;  2EEJ A;  2ZPL A;  2HGA A;  3MH7 A;  5HET A;  2KOJ A;  2CSS A;  3NFL A;  4JL7 A;  5E22 A;  1N6D A;  1QAV A;  4Q3H A;  2JIK A;  2QG1 A;  4MPA A;  2OCS A;  5FB8 C;  2M0U A;  1WIF A;  5EYZ A;  2H2C A;  1GM1 A;  3K82 A;  4Q6S A;  1VA8 A;  4JOR A;  1WJL A;  1SOZ A;  4O06 A;  3HPM A;  1FC7 A;  1WF7 A;  2QBW A;  1N7E A;  4YYX A;  3DJ3 A;  2KG2 A;  2DAZ A;  2KPK A;  3VQF A;  2YT7 A;  2REY A;  5HFE A;  3SHW A;  2VZ5 A;  3CBY A;  1WH1 A;  3CC0 A;  4JOP A;  1RGR A;  3OTP A;  3QIK A;  3BPU A;  2DM8 A;  2MHO A;  1I92 A;  2DLS A;  2EXG A;  3R69 A;  4Z8J A;  1Q3O A;  4Z33 A;  2VRF A;  2G2L A;  2EDV A;  1VCW A;  2CSJ A;  1VB7 A;  1N6F A;  1N7F A;  1RZX A;  3GCO A;  2I1N A;  4AMH A;  3QJN A;  5F3X A;  2KAW A;  1UJD A;  5HFD A;  2JIN A;  1V5Q A;  5H3J A;  2EDZ A;  2OQS A;  2I4S A;  2JXO A;  3PDZ A;  3PDV A;  1I16 A;  3SOE A;  2I04 A;  1UM1 A;  3STJ A;  1V1T A;  2V1W A;  5B42 A;  1R6J A;  1OBX A;  1UEZ A;  1Y7N A;  2JOA A;  4UU5 A;  3JXT A;  1UEQ A;  2F5Y A;  3PS4 A;  3QDO A;  1X5N A;  5DTH A;  2FNE A;  2EDP A;  1FCF A;  2I6V A;  4FLN A;  2DJT A;  5E11 A;  2M0T A;  4NMS A;  2R4H A;  2EEH A;  3KDG A;  1W9E A;  3MH6 A;  2M10 A;  4R2Z A;  4K72 A;  2H2B A;  3GSL A;  2AIN A;  3KDK A;  5G1E A;  4K6Y A;  2PZD A;  2PKT A;  3KZD A;  2F0A A;  1XZ9 A;  2JSN A;  2K20 A;  1BFE A;  1PDR A;  5HF4 A;  2G5M B;  4Q6H A;  1L6O A;  1UFX A;  2KA9 A;  2Q3G A;  2PDZ A;  1OBZ A;  4NMR A;  1WHD A;  2EJY A;  4E35 A;  1X5R A;  2RRM A;  1OZI A;  2EGN A;  1X6D A;  3TMH A;  1U37 A;  2VSV A;  2PNT A;  5ILB A;  4PQW A;  2LUI A;  3QO6 A;  1WHA A;  2IWN A;  1X8S A;  2KQF A;  5HEY A;  4NMV A;  3FY5 A;  1RGW A;  4OEP A;  4IC6 A;  3I4W A;  2EHR A;  2L4T A;  1UHP A;  1KEF A;  3I18 A;  1N7T A;  4JOK A;  3TSW A;  2EEG A;  1ZOK A;  1NF3 C;  1Z86 A;  2EEI A;  1OBY A;  2E7K A;  2EGO A;  3TSV A;  2AWW A;  2UZC A;  2QKT A;  2D90 A;  3GDS A;  1FC6 A;  1YBO A;  2FN5 A;  5GLJ A;  4JJ3 A;  2V90 A;  5A2P A;  2HE2 A;  5HFC A;  2R3Y A;  1RY4 A;  2VSP A;  5I7Z A;  5E21 A;  3DIW A;  2Z17 A;  2OPG A;  2YUY A;  1U39 A;  3E17 A;  1UJU A;  4NXR A;  4Q2O A;  1M5Z A;  2FE5 A;  3GAB A;  1WF8 A;  2QKV A;  1UEW A;  3CYY A;  5E6P B;  4GHN A;  2IWO A;  2KRG A;  1QAU A;  4RI0 A;  1VAE A;  5E1Y A;  4E34 A;  1V5L A;  2HE4 A;  3OU0 A;  2VWR A;  4JOH A;  1MFG A;  3GJ9 A;  3DOR A;  3LNX A;  4XHV A;  1P1D A;  3B76 A;  1TP5 A;  2KOM A;  4K76 A;  3RL8 A;  3L4F D;  2YTW A;  3TSZ A;  3R0H A;  4JOF A;  3QJM A;  1QLC A;  3KZE A;  1D5G A;  3VQG A;  3CBX A;  1Y8T A;  1X9Z A;  5IL9 A;  1FC9 A;  3SUZ A;  2YT8 A;  2OSG A;  1Z87 A;  3PV4 A;  1P1E A;  3AXA A;  5HEB A;  3WKL A;  2IWP A;  1GQ5 A;  3CS0 A;  3EGG C;  3GCN A;  1WI2 A;  2D92 A;  4Q2N A;  4LMM A;  3LNY A;  2H3M A;  2AWX A;  4REY A;  3PV5 A;  3NFK A;  4F8K A;  2GEF A;  1BE9 A;  3MH4 A;  4NXP A;  5F67 A;  4NMP A;  4HOP B;  1IHJ A;  2LA8 A;  1X45 A;  2LC7 A;  4YDP A;  2LOB A;  1TQ3 A;  1UM7 A;  1G9O A;  3ID1 A;  3K1R A;  2BYG A;  4NNM A;  2FCF A;  3DJA A;  2QT5 A;  2CS5 A;  1T2M A;  2L4S A;  3EGH C;  1X5Q A;  1KWA A;  3RL7 A;  2Q9V A;  4Q2Q A;  5G1D A;  5HJ1 A;  2DMZ A;  4H11 A;  4N6X A;  3ID4 A;  1UIT A;  1U38 A;  2O2T A;  1U3B A;  3ID2 A;  3DJ1 A;  1W9Q A;  2YUB A;  3ID3 A;  2M3M A;  4GVC A;  1WG6 A;  3O5N A;  2EGK A;  4KFV A;  2W4F A;  2EV8 A;  2LC6 A;  1TP3 A;  5FHT A;  4GVD A;  1N6E A;  1N99 A;  2Z9I A;  1WFV A;  4HOP A;  1SOT A;  3SFJ A;  3SHU A;  3GDU A;  2OS6 A;  4K75 A;  2JRE A;  3GDV A;  2P3W A;  2KV8 A;  1TE0 A;  1KY9 A;  3KHF A;  5HF1 A;  4JOE A;  1ZUB A;  1UF1 A;  4NNL A;  3R68 A;  4KFW A;  2PKU A;  2RCZ A;  3I1E A;  2OZF A;  1GQ4 A;  5B6L A;  2EAQ A;  4G69 A;  2K1Z A;  3NCV A;  1K32 A;  2OMJ A;  2DKR A;  2M0Z A;  2I0I A;  4OAJ A;  2MX6 A;  4WYU A;  4E3B A;  4JOG A;  4WYT A;  3ZRT A;  1UEP A;  2IWQ A;  1IU0 A;  2D8I A;  2KJD A;  2KJP A;  2PA1 A;  5HFF A;  4Q2P A;  4P2A B;  1V62 A;  1MC7 A;  4JJ0 A;  1WI4 A;  2AWU A;  2QKU A;  2KYL A;  2X7Z A;  1LCY A;  4P0C A;  1MFL A;  2DB5 A;  2W7R A;  3CH8 A;  1Q7X A;  3K50 A;  2M0V A;  2KOH A;  4NMT A;  5EZ0 A;  3NGH A;  4L8N A;  1W9O A;  3CBZ A;  2GZV A;  1IU2 A;  1V6B A;  2WL7 A; 
#chains in the Genus database with same CATH homology
 3HVQ C;  2I0L A;  1QAV B;  2L97 A;  3PV2 A;  2VPH A;  3WKM A;  2OGP A;  4UU6 A;  5GND A;  2JWE A;  1B8Q A;  3GGE A;  4JOJ A;  2KPL A;  2KJK A;  4K78 A;  2JIL A;  5HFB A;  5HED A;  2ZPM A;  1Q3P A;  3O46 A;  2KBS A;  4NMO A;  3RLE A;  4EDJ A;  1VJ6 A;  2H3L A;  4NXQ A;  2ENO A;  3QE1 A;  4NMQ A;  4FGM A;  4OEO A;  1WFG A;  5HDY A;  1NTE A;  2DLU A;  2KL1 A;  1UJV A;  3QGL A;  5JXB A;  2DC2 A;  3HPK A;  5D13 A;  2EEJ A;  2ZPL A;  2HGA A;  3MH7 A;  5HET A;  2KOJ A;  2CSS A;  3NFL A;  4JL7 A;  5E22 A;  1N6D A;  1QAV A;  4Q3H A;  2JIK A;  2QG1 A;  4MPA A;  2OCS A;  5FB8 C;  2M0U A;  1WIF A;  5EYZ A;  2H2C A;  1GM1 A;  3K82 A;  4Q6S A;  1VA8 A;  4JOR A;  1WJL A;  1SOZ A;  4O06 A;  3HPM A;  1FC7 A;  1WF7 A;  2QBW A;  1N7E A;  4YYX A;  3DJ3 A;  2KG2 A;  2DAZ A;  2KPK A;  3VQF A;  2YT7 A;  2REY A;  5HFE A;  3SHW A;  2VZ5 A;  3CBY A;  1WH1 A;  3CC0 A;  4JOP A;  1RGR A;  3OTP A;  3QIK A;  3BPU A;  2DM8 A;  2MHO A;  1I92 A;  2DLS A;  2EXG A;  3R69 A;  4Z8J A;  1Q3O A;  4Z33 A;  2VRF A;  2G2L A;  2EDV A;  1VCW A;  2CSJ A;  1VB7 A;  1N6F A;  1N7F A;  1RZX A;  3GCO A;  2I1N A;  4AMH A;  3QJN A;  5F3X A;  2KAW A;  1UJD A;  5HFD A;  2JIN A;  1V5Q A;  5H3J A;  2EDZ A;  2OQS A;  2I4S A;  2JXO A;  3PDZ A;  3PDV A;  1I16 A;  3SOE A;  2I04 A;  1UM1 A;  3STJ A;  1V1T A;  2V1W A;  5B42 A;  1R6J A;  1OBX A;  1UEZ A;  1Y7N A;  2JOA A;  4UU5 A;  3JXT A;  1UEQ A;  2F5Y A;  3PS4 A;  3QDO A;  1X5N A;  5DTH A;  2FNE A;  2EDP A;  1FCF A;  2I6V A;  4FLN A;  2DJT A;  5E11 A;  2M0T A;  4NMS A;  2R4H A;  2EEH A;  3KDG A;  1W9E A;  3MH6 A;  2M10 A;  4R2Z A;  4K72 A;  2H2B A;  3GSL A;  2AIN A;  3KDK A;  5G1E A;  4K6Y A;  2PZD A;  2PKT A;  3KZD A;  2F0A A;  1XZ9 A;  2JSN A;  2K20 A;  1BFE A;  1PDR A;  5HF4 A;  2G5M B;  4Q6H A;  1L6O A;  1UFX A;  2KA9 A;  2Q3G A;  2PDZ A;  1OBZ A;  4NMR A;  1WHD A;  2EJY A;  4E35 A;  1X5R A;  2RRM A;  1OZI A;  2EGN A;  1X6D A;  3TMH A;  1U37 A;  2VSV A;  2PNT A;  5ILB A;  4PQW A;  2LUI A;  3QO6 A;  1WHA A;  2IWN A;  1X8S A;  2KQF A;  5HEY A;  4NMV A;  3FY5 A;  1RGW A;  4OEP A;  4IC6 A;  3I4W A;  2EHR A;  2L4T A;  1UHP A;  1KEF A;  3I18 A;  1N7T A;  4JOK A;  3TSW A;  2EEG A;  1ZOK A;  1NF3 C;  1Z86 A;  2EEI A;  1OBY A;  2E7K A;  2EGO A;  3TSV A;  2AWW A;  2UZC A;  2QKT A;  2D90 A;  3GDS A;  1FC6 A;  1YBO A;  2FN5 A;  5GLJ A;  4JJ3 A;  2V90 A;  5A2P A;  2HE2 A;  5HFC A;  2R3Y A;  1RY4 A;  2VSP A;  5I7Z A;  5E21 A;  3DIW A;  2Z17 A;  2OPG A;  2YUY A;  1U39 A;  3E17 A;  1UJU A;  4NXR A;  4Q2O A;  1M5Z A;  2FE5 A;  3GAB A;  1WF8 A;  2QKV A;  1UEW A;  3CYY A;  5E6P B;  4GHN A;  2IWO A;  2KRG A;  1QAU A;  4RI0 A;  1VAE A;  5E1Y A;  4E34 A;  1V5L A;  2HE4 A;  3OU0 A;  2VWR A;  4JOH A;  1MFG A;  3GJ9 A;  3DOR A;  3LNX A;  4XHV A;  1P1D A;  3B76 A;  1TP5 A;  2KOM A;  4K76 A;  3RL8 A;  3L4F D;  2YTW A;  3TSZ A;  3R0H A;  4JOF A;  3QJM A;  1QLC A;  3KZE A;  1D5G A;  3VQG A;  3CBX A;  1Y8T A;  1X9Z A;  5IL9 A;  1FC9 A;  3SUZ A;  2YT8 A;  2OSG A;  1Z87 A;  3PV4 A;  1P1E A;  3AXA A;  5HEB A;  3WKL A;  2IWP A;  1GQ5 A;  3CS0 A;  3EGG C;  3GCN A;  1WI2 A;  2D92 A;  4Q2N A;  4LMM A;  3LNY A;  2H3M A;  2AWX A;  4REY A;  3PV5 A;  3NFK A;  4F8K A;  2GEF A;  1BE9 A;  3MH4 A;  4NXP A;  5F67 A;  4NMP A;  4HOP B;  1IHJ A;  2LA8 A;  1X45 A;  2LC7 A;  4YDP A;  2LOB A;  1TQ3 A;  1UM7 A;  1G9O A;  3ID1 A;  3K1R A;  2BYG A;  4NNM A;  2FCF A;  3DJA A;  2QT5 A;  2CS5 A;  1T2M A;  2L4S A;  3EGH C;  1X5Q A;  1KWA A;  3RL7 A;  2Q9V A;  4Q2Q A;  5G1D A;  5HJ1 A;  2DMZ A;  4H11 A;  4N6X A;  3ID4 A;  1UIT A;  1U38 A;  2O2T A;  1U3B A;  3ID2 A;  3DJ1 A;  1W9Q A;  2YUB A;  3ID3 A;  2M3M A;  4GVC A;  1WG6 A;  3O5N A;  2EGK A;  4KFV A;  2W4F A;  2EV8 A;  2LC6 A;  1TP3 A;  5FHT A;  4GVD A;  1N6E A;  1N99 A;  2Z9I A;  1WFV A;  4HOP A;  1SOT A;  3SFJ A;  3SHU A;  3GDU A;  2OS6 A;  4K75 A;  2JRE A;  3GDV A;  2P3W A;  2KV8 A;  1TE0 A;  1KY9 A;  3KHF A;  5HF1 A;  4JOE A;  1ZUB A;  1UF1 A;  4NNL A;  3R68 A;  4KFW A;  2PKU A;  2RCZ A;  3I1E A;  2OZF A;  1GQ4 A;  5B6L A;  2EAQ A;  4G69 A;  2K1Z A;  3NCV A;  1K32 A;  2OMJ A;  2DKR A;  2M0Z A;  2I0I A;  4OAJ A;  2MX6 A;  4WYU A;  4E3B A;  4JOG A;  4WYT A;  3ZRT A;  1UEP A;  2IWQ A;  1IU0 A;  2D8I A;  2KJD A;  2KJP A;  2PA1 A;  5HFF A;  4Q2P A;  4P2A B;  1V62 A;  1MC7 A;  4JJ0 A;  1WI4 A;  2AWU A;  2QKU A;  2KYL A;  2X7Z A;  1LCY A;  4P0C A;  1MFL A;  2DB5 A;  2W7R A;  3CH8 A;  1Q7X A;  3K50 A;  2M0V A;  2KOH A;  4NMT A;  5EZ0 A;  3NGH A;  4L8N A;  1W9O A;  3CBZ A;  2GZV A;  1IU2 A;  1V6B A;  2WL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...