1UEZA

Solution structure of the first pdz domain of human kiaa1526 protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
101
structure length
101
Chain Sequence
GSSGSSGEVRLVSLRRAKAHEGLGFSIRGGSEHGVGIYVSLVEPGSLAEKEGLRVGDQILRVNDKSLARVTHAEAVKALKGSKKLVLSVYSAGRISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1526 Protein
publication title Solution structure of the first PDZ domain of human KIAA1526 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 11
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2003-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1uezA00
1X8SA 4GVDA 4XHVA 4K72A 2ENOA 2I6VA 1V62A 5HF1A 4NMRA 2M0UA 1UJVA 2L4TA 4E3BA 4OAJA 3I18A 1XZ9A 4HOPB 1WH1A 3R0HA 4YYXA 1ZOKA 4LMMA 3KZEA 2I04A 3KHFA 4P2AB 1UHPA 2M0TA 2LC7A 2PZDA 3MH6A 2YUYA 3WKLA 4NMOA 2HE4A 2EXGA 2LUIA 2KG2A 2I4SA 1RGWA 1TE0A 5DTHA 1OBZA 1T2MA 2DAZA 4PQWA 2H2BA 3I1EA 1M5ZA 4P0CA 3DJ1A 3CYYA 3CBYA 5E22A 2FCFA 3CBXA 2E7KA 2DLUA 2ZPLA 4KFVA 2BYGA 2KYLA 4UU6A 2KA9A 4KFWA 3R69A 4FGMA 3EGHC 2X7ZA 1I92A 2KOHA 2PNTA 1RGRA 3RL7A 1WHAA 5FHTA 4NMQA 1OBXA 5HDYA 3TSWA 3NGHA 1NF3C 4MPAA 2DB5A 3STJA 3TMHA 4NMPA 3LNYA 4JOPA 4GHNA 2VPHA 2I0IA 3QJMA 5A2PA 1OZIA 3CH8A 1UJUA 4OEOA 2R4HA 3ZRTA 2DKRA 1UFXA 1WF7A 1I16A 5I7ZA 2KQFA 4R2ZA 1FCFA 1GQ5A 3ID3A 3EGGC 3DORA 4JL7A 2KV8A 1UEQA 3CS0A 3L4FD 4Q3HA 2KOMA 1L6OA 2HE2A 1IU2A 2KPKA 1VJ6A 3PV2A 1VAEA 1P1DA 3ID1A 1MFGA 4JOJA 2D8IA 4F8KA 2VRFA 1D5GA 1UF1A 2EGKA 2CSJA 4JOEA 5EZ0A 5HFCA 2HGAA 2FNEA 2F0AA 1MC7A 1KY9A 2QKUA 3DIWA 1FC9A 1QAVB 4RI0A 4Q6HA 2YT7A 4N6XA 4E35A 3I4WA 4UU5A 3ID2A 3ID4A 2PKTA 2K20A 3SOEA 3LNXA 2EGOA 1MFLA 1WHDA 1WI2A 3TSVA 4Z8JA 2D92A 5H3JA 2EHRA 2JILA 3O5NA 4JORA 4WYTA 2MHOA 2EV8A 1V6BA 2Z9IA 1TP5A 2KAWA 3SUZA 2JREA 2G2LA 1UEZA 3AXAA 3CBZA 2IWQA 5HFBA 2FN5A 4NMTA 1X5NA 1WI4A 1YBOA 5D13A 1WG6A 1SOZA 2DC2A 4WYUA 3VQGA 2UZCA 1R6JA 1RY4A 2IWNA 3PV4A 3HPKA 2F5YA 2JINA 1W9QA 1QAUA 1U39A 2M10A 2QG1A 3SHWA 5HJ1A 3GDVA 1UJDA 1KWAA 2AWXA 3HPMA 4HOPA 3DJAA 2I1NA 3MH7A 1UM1A 1PDRA 4NXPA 2AINA 4G69A 2H3LA 2JOAA 4EDJA 4Q2OA 1N99A 2QT5A 4AMHA 1UEWA 1WIFA 2EGNA 3GDUA 1UITA 1W9EA 2EDPA 4YDPA 5HEYA 2JIKA 1FC7A 2VWRA 3PDZA 1TP3A 2D90A 2OZFA 1N6EA 2V1WA 4H11A 2Q3GA 2QBWA 3RL8A 2LC6A 4JOHA 1X5RA 1UEPA 2EJYA 3WKMA 1W9OA 5GNDA 5JXBA 4K6YA 1LCYA 3QGLA 4L8NA 2DM8A 3NFLA 4Q2QA 2KOJA 2LOBA 5E1YA 2OSGA 2OQSA 2P3WA 3QO6A 1Z86A 2OS6A 1X6DA 2JWEA 4NMSA 3SHUA 4K76A 1KEFA 3PV5A 3FY5A 4JOGA 1Q3PA 2EAQA 2LA8A 2PDZA 3SFJA 1V1TA 2EEJA 3K1RA 4E34A 4Q2PA 5HEBA 2IWPA 2QKVA 3NFKA 2H2CA 1WF8A 2FE5A 1N7FA 2M3MA 2ZPMA 3CC0A 3RLEA 1VCWA 4Q2NA 5HETA 3KZDA 2EDZA 1BFEA 2V90A 4K78A 1Z87A 3QE1A 2RCZA 1V5QA 3BPUA 5GLJA 1Q7XA 2AWWA 1X5QA 1OBYA 3K50A 1BE9A 1RZXA 3JXTA 4NXQA 4NNMA 2EDVA 5B6LA 1WFVA 2OPGA 2O2TA 3QDOA 4OEPA 2L97A 2M0VA 2OMJA 1GQ4A 2Z17A 1QAVA 1WJLA 5FB8C 4Q6SA 5EYZA 2KJKA 2EEGA 2W7RA 1WFGA 3B76A 1IHJA 1Y7NA 1ZUBA 2YTWA 2K1ZA 2R3YA 2KPLA 3O46A 2I0LA 1N7TA 2PKUA 2OGPA 3GDSA 1N6FA 2KBSA 5F67A 5G1DA 2KJPA 2JXOA 2VSVA 1G9OA 2REYA 2W4FA 2VZ5A 3PDVA 3DJ3A 3QIKA 3GCNA 2AWUA 5HF4A 2VSPA 3OU0A 2Q9VA 2YT8A 2KL1A 2OCSA 4JOKA 4NMVA 2EEHA 1NTEA 1B8QA 4NXRA 5HFFA 3GJ9A 4NNLA 1SOTA 3TSZA 2DJTA 5HFEA 3PS4A 1TQ3A 5E6PB 5F3XA 3GCOA 1QLCA 2DMZA 2WL7A 4JOFA 1U38A 2G5MB 1N7EA 2MX6A 2GZVA 1U37A 2CSSA 2QKTA 2H3MA 3R68A 1Q3OA 2KJDA 1X45A 3VQFA 3HVQC 1FC6A 5HEDA 4REYA 2IWOA 2M0ZA 4GVCA 3QJNA 1Y8TA 1K32A 2CS5A 2KRGA 3GSLA 2YUBA 1VA8A 2EEIA 1U3BA 4IC6A 3E17A 4O06A 1GM1A 1P1EA 5G1EA 1N6DA 2L4SA 4Z33A 3OTPA 2RRMA 5E21A 1V5LA 3MH4A 2DLSA 1VB7A 2PA1A 4K75A 5E11A 3GGEA 3K82A 1IU0A 1UM7A 5HFDA
chains in the Genus database with same CATH superfamily
1X8SA 4GVDA 4XHVA 4K72A 2ENOA 2I6VA 1V62A 5HF1A 4NMRA 2M0UA 1UJVA 2L4TA 4E3BA 4OAJA 3I18A 1XZ9A 4HOPB 1WH1A 3R0HA 4YYXA 1ZOKA 4LMMA 3KZEA 2I04A 3KHFA 4P2AB 1UHPA 2M0TA 2LC7A 2PZDA 3MH6A 2YUYA 3WKLA 4NMOA 2HE4A 2EXGA 2LUIA 2KG2A 2I4SA 1RGWA 1TE0A 5DTHA 1OBZA 1T2MA 2DAZA 4PQWA 2H2BA 3I1EA 1M5ZA 4P0CA 3DJ1A 3CYYA 3CBYA 5E22A 2FCFA 3CBXA 2E7KA 2DLUA 2ZPLA 4KFVA 2BYGA 2KYLA 4UU6A 2KA9A 4KFWA 4JJ0A 3R69A 4FGMA 3EGHC 2X7ZA 4FLNA 1I92A 2KOHA 2PNTA 1RGRA 3RL7A 1WHAA 5FHTA 4NMQA 1OBXA 5HDYA 3TSWA 3NGHA 1NF3C 4MPAA 2DB5A 3STJA 3TMHA 4NMPA 3LNYA 4JOPA 4GHNA 2VPHA 2I0IA 3QJMA 5A2PA 1OZIA 3CH8A 1UJUA 4OEOA 2R4HA 3ZRTA 2DKRA 1UFXA 1WF7A 1I16A 5I7ZA 2KQFA 4R2ZA 1FCFA 1GQ5A 3ID3A 3EGGC 3DORA 4JL7A 2KV8A 1UEQA 3CS0A 3L4FD 4Q3HA 2KOMA 1L6OA 2HE2A 1IU2A 2KPKA 1VJ6A 3PV2A 1VAEA 1P1DA 3ID1A 1MFGA 4JOJA 2D8IA 4F8KA 2VRFA 1D5GA 1UF1A 2EGKA 2CSJA 4JOEA 5EZ0A 5HFCA 2HGAA 2FNEA 2F0AA 1MC7A 1KY9A 2QKUA 3DIWA 1FC9A 1QAVB 4RI0A 4Q6HA 2YT7A 4N6XA 4E35A 3I4WA 4UU5A 3ID2A 3ID4A 2PKTA 2K20A 4JJ3A 3SOEA 3LNXA 2EGOA 1MFLA 1WHDA 1WI2A 3TSVA 4Z8JA 2D92A 5H3JA 2EHRA 2JILA 3O5NA 4JORA 4WYTA 5IL9A 2MHOA 2EV8A 1V6BA 2Z9IA 1TP5A 2KAWA 3SUZA 2JSNA 2JREA 2G2LA 1X9ZA 1UEZA 3AXAA 3CBZA 2IWQA 5HFBA 2FN5A 4NMTA 1X5NA 1WI4A 1YBOA 5D13A 1WG6A 1SOZA 2DC2A 4WYUA 3VQGA 2UZCA 1R6JA 1RY4A 2IWNA 3PV4A 3HPKA 2F5YA 2JINA 1W9QA 1QAUA 1U39A 2M10A 2QG1A 3SHWA 5HJ1A 3GDVA 1UJDA 1KWAA 2AWXA 3HPMA 4HOPA 3DJAA 2I1NA 3MH7A 1UM1A 1PDRA 4NXPA 2AINA 4G69A 2H3LA 2JOAA 4EDJA 4Q2OA 1N99A 2QT5A 4AMHA 1UEWA 1WIFA 2GEFA 2EGNA 3GDUA 1UITA 1W9EA 2EDPA 4YDPA 5HEYA 2JIKA 1FC7A 2VWRA 3PDZA 1TP3A 2D90A 2OZFA 1N6EA 2V1WA 4H11A 2Q3GA 3NCVA 2QBWA 3RL8A 2LC6A 4JOHA 1X5RA 1UEPA 2EJYA 3WKMA 1W9OA 5GNDA 5JXBA 4K6YA 1LCYA 3QGLA 4L8NA 2DM8A 3NFLA 4Q2QA 2KOJA 2LOBA 5E1YA 2OSGA 2OQSA 2P3WA 3QO6A 1Z86A 2OS6A 1X6DA 2JWEA 4NMSA 3SHUA 4K76A 1KEFA 3PV5A 3FY5A 4JOGA 1Q3PA 2EAQA 2LA8A 2PDZA 3SFJA 1V1TA 3KDKA 2EEJA 3K1RA 4E34A 4Q2PA 5HEBA 2IWPA 2QKVA 3NFKA 2H2CA 1WF8A 2FE5A 1N7FA 2M3MA 2ZPMA 3CC0A 3RLEA 1VCWA 4Q2NA 5HETA 3KZDA 2EDZA 1BFEA 2V90A 4K78A 1Z87A 3QE1A 2RCZA 1V5QA 3BPUA 5GLJA 1Q7XA 2AWWA 1X5QA 1OBYA 3K50A 1BE9A 1RZXA 3JXTA 4NXQA 4NNMA 2EDVA 5B6LA 1WFVA 2OPGA 2O2TA 3QDOA 4OEPA 2L97A 2M0VA 2OMJA 1GQ4A 2Z17A 1QAVA 1WJLA 5FB8C 4Q6SA 5EYZA 2KJKA 2EEGA 2W7RA 1WFGA 3B76A 1IHJA 1Y7NA 1ZUBA 2YTWA 2K1ZA 2R3YA 2KPLA 3O46A 2I0LA 1N7TA 2PKUA 2OGPA 3GDSA 1N6FA 2KBSA 5F67A 5G1DA 2KJPA 2JXOA 2VSVA 1G9OA 2REYA 2W4FA 2VZ5A 3PDVA 3DJ3A 3GABA 3QIKA 3GCNA 5ILBA 2AWUA 5HF4A 2VSPA 3OU0A 2Q9VA 2YT8A 2KL1A 2OCSA 4JOKA 4NMVA 2EEHA 1NTEA 1B8QA 4NXRA 5HFFA 3GJ9A 4NNLA 1SOTA 3TSZA 2DJTA 5HFEA 3PS4A 1TQ3A 5E6PB 5F3XA 3GCOA 1QLCA 2DMZA 2WL7A 4JOFA 1U38A 2G5MB 1N7EA 2MX6A 2GZVA 1U37A 2CSSA 2QKTA 2H3MA 3R68A 1Q3OA 2KJDA 1X45A 3VQFA 3HVQC 1FC6A 5HEDA 4REYA 2IWOA 2M0ZA 4GVCA 3QJNA 1Y8TA 1K32A 2CS5A 2KRGA 3GSLA 2YUBA 1VA8A 2EEIA 1U3BA 4IC6A 3E17A 4O06A 1GM1A 1P1EA 5G1EA 1N6DA 2L4SA 4Z33A 3OTPA 2RRMA 5E21A 1V5LA 3MH4A 2DLSA 1VB7A 2PA1A 4K75A 5E11A 3KDGA 3GGEA 3K82A 1IU0A 1UM7A 5HFDA 5B42A
chains in the Genus database with same CATH topology
1X8SA 4GVDA 4XHVA 4K72A 2ENOA 2I6VA 1V62A 5HF1A 4NMRA 2M0UA 1UJVA 2L4TA 4E3BA 4OAJA 3I18A 1XZ9A 4HOPB 1WH1A 3R0HA 4YYXA 1ZOKA 4LMMA 3KZEA 2I04A 3KHFA 4P2AB 1UHPA 2M0TA 2LC7A 2PZDA 3MH6A 2YUYA 3WKLA 4NMOA 2HE4A 2EXGA 2LUIA 2KG2A 2I4SA 1RGWA 1TE0A 5DTHA 1OBZA 1T2MA 2DAZA 4PQWA 2H2BA 3I1EA 1M5ZA 4P0CA 3DJ1A 3CYYA 3CBYA 5E22A 2FCFA 3CBXA 2E7KA 2DLUA 2ZPLA 4KFVA 2BYGA 2KYLA 4UU6A 2KA9A 4KFWA 4JJ0A 3R69A 4FGMA 3EGHC 2X7ZA 4FLNA 1I92A 2KOHA 2PNTA 1RGRA 3RL7A 1WHAA 5FHTA 4NMQA 1OBXA 5HDYA 3TSWA 3NGHA 1NF3C 4MPAA 2DB5A 3STJA 3TMHA 4NMPA 3LNYA 4JOPA 4GHNA 2VPHA 2I0IA 3QJMA 5A2PA 1OZIA 3CH8A 1UJUA 4OEOA 2R4HA 3ZRTA 2DKRA 1UFXA 1WF7A 1I16A 5I7ZA 2KQFA 4R2ZA 1FCFA 1GQ5A 3ID3A 3EGGC 3DORA 4JL7A 2KV8A 1UEQA 3CS0A 3L4FD 4Q3HA 2KOMA 1L6OA 2HE2A 1IU2A 2KPKA 1VJ6A 3PV2A 1VAEA 1P1DA 3ID1A 1MFGA 4JOJA 2D8IA 4F8KA 2VRFA 1D5GA 1UF1A 2EGKA 2CSJA 4JOEA 5EZ0A 5HFCA 2HGAA 2FNEA 2F0AA 1MC7A 1KY9A 2QKUA 3DIWA 1FC9A 1QAVB 4RI0A 4Q6HA 2YT7A 4N6XA 4E35A 3I4WA 4UU5A 3ID2A 3ID4A 2PKTA 2K20A 4JJ3A 3SOEA 3LNXA 2EGOA 1MFLA 1WHDA 1WI2A 3TSVA 4Z8JA 2D92A 5H3JA 2EHRA 2JILA 3O5NA 4JORA 4WYTA 5IL9A 2MHOA 2EV8A 1V6BA 2Z9IA 1TP5A 2KAWA 3SUZA 2JSNA 2JREA 2G2LA 1X9ZA 1UEZA 3AXAA 3CBZA 2IWQA 5HFBA 2FN5A 4NMTA 1X5NA 1WI4A 1YBOA 5D13A 1WG6A 1SOZA 2DC2A 4WYUA 3VQGA 2UZCA 1R6JA 1RY4A 2IWNA 3PV4A 3HPKA 2F5YA 2JINA 1W9QA 1QAUA 1U39A 2M10A 2QG1A 3SHWA 5HJ1A 3GDVA 1UJDA 1KWAA 2AWXA 3HPMA 4HOPA 3DJAA 2I1NA 3MH7A 1UM1A 1PDRA 4NXPA 2AINA 4G69A 2H3LA 2JOAA 4EDJA 4Q2OA 1N99A 2QT5A 4AMHA 1UEWA 1WIFA 2GEFA 2EGNA 3GDUA 1UITA 1W9EA 2EDPA 4YDPA 5HEYA 2JIKA 1FC7A 2VWRA 3PDZA 1TP3A 2D90A 2OZFA 1N6EA 2V1WA 4H11A 2Q3GA 3NCVA 2QBWA 3RL8A 2LC6A 4JOHA 1X5RA 1UEPA 2EJYA 3WKMA 1W9OA 5GNDA 5JXBA 4K6YA 1LCYA 3QGLA 4L8NA 2DM8A 3NFLA 4Q2QA 2KOJA 2LOBA 5E1YA 2OSGA 2OQSA 2P3WA 3QO6A 1Z86A 2OS6A 1X6DA 2JWEA 4NMSA 3SHUA 4K76A 1KEFA 3PV5A 3FY5A 4JOGA 1Q3PA 2EAQA 2LA8A 2PDZA 3SFJA 1V1TA 3KDKA 2EEJA 3K1RA 4E34A 4Q2PA 5HEBA 2IWPA 2QKVA 3NFKA 2H2CA 1WF8A 2FE5A 1N7FA 2M3MA 2ZPMA 3CC0A 3RLEA 1VCWA 4Q2NA 5HETA 3KZDA 2EDZA 1BFEA 2V90A 4K78A 1Z87A 3QE1A 2RCZA 1V5QA 3BPUA 5GLJA 1Q7XA 2AWWA 1X5QA 1OBYA 3K50A 1BE9A 1RZXA 3JXTA 4NXQA 4NNMA 2EDVA 5B6LA 1WFVA 2OPGA 2O2TA 3QDOA 4OEPA 2L97A 2M0VA 2OMJA 1GQ4A 2Z17A 1QAVA 1WJLA 5FB8C 4Q6SA 5EYZA 2KJKA 2EEGA 2W7RA 1WFGA 3B76A 1IHJA 1Y7NA 1ZUBA 2YTWA 2K1ZA 2R3YA 2KPLA 3O46A 2I0LA 1N7TA 2PKUA 2OGPA 3GDSA 1N6FA 2KBSA 5F67A 5G1DA 2KJPA 2JXOA 2VSVA 1G9OA 2REYA 2W4FA 2VZ5A 3PDVA 3DJ3A 3GABA 3QIKA 3GCNA 5ILBA 2AWUA 5HF4A 2VSPA 3OU0A 2Q9VA 2YT8A 2KL1A 2OCSA 4JOKA 4NMVA 2EEHA 1NTEA 1B8QA 4NXRA 5HFFA 3GJ9A 4NNLA 1SOTA 3TSZA 2DJTA 5HFEA 3PS4A 1TQ3A 5E6PB 5F3XA 3GCOA 1QLCA 2DMZA 2WL7A 4JOFA 1U38A 2G5MB 1N7EA 2MX6A 2GZVA 1U37A 2CSSA 2QKTA 2H3MA 3R68A 1Q3OA 2KJDA 1X45A 3VQFA 3HVQC 1FC6A 5HEDA 4REYA 2IWOA 2M0ZA 4GVCA 3QJNA 1Y8TA 1K32A 2CS5A 2KRGA 3GSLA 2YUBA 1VA8A 2EEIA 1U3BA 4IC6A 3E17A 4O06A 1GM1A 1P1EA 5G1EA 1N6DA 2L4SA 4Z33A 3OTPA 2RRMA 5E21A 1V5LA 3MH4A 2DLSA 1VB7A 2PA1A 4K75A 5E11A 3KDGA 3GGEA 3K82A 1IU0A 1UM7A 5HFDA 5B42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8S A;  4GVD A;  4XHV A;  4K72 A;  2ENO A;  2I6V A;  1V62 A;  5HF1 A;  4NMR A;  2M0U A;  1UJV A;  2L4T A;  4E3B A;  4OAJ A;  3I18 A;  1XZ9 A;  4HOP B;  1WH1 A;  3R0H A;  4YYX A;  1ZOK A;  4LMM A;  3KZE A;  2I04 A;  3KHF A;  4P2A B;  1UHP A;  2M0T A;  2LC7 A;  2PZD A;  3MH6 A;  2YUY A;  3WKL A;  4NMO A;  2HE4 A;  2EXG A;  2LUI A;  2KG2 A;  2I4S A;  1RGW A;  1TE0 A;  5DTH A;  1OBZ A;  1T2M A;  2DAZ A;  4PQW A;  2H2B A;  3I1E A;  1M5Z A;  4P0C A;  3DJ1 A;  3CYY A;  3CBY A;  5E22 A;  2FCF A;  3CBX A;  2E7K A;  2DLU A;  2ZPL A;  4KFV A;  2BYG A;  2KYL A;  4UU6 A;  2KA9 A;  4KFW A;  3R69 A;  4FGM A;  3EGH C;  2X7Z A;  1I92 A;  2KOH A;  2PNT A;  1RGR A;  3RL7 A;  1WHA A;  5FHT A;  4NMQ A;  1OBX A;  5HDY A;  3TSW A;  3NGH A;  1NF3 C;  4MPA A;  2DB5 A;  3STJ A;  3TMH A;  4NMP A;  3LNY A;  4JOP A;  4GHN A;  2VPH A;  2I0I A;  3QJM A;  5A2P A;  1OZI A;  3CH8 A;  1UJU A;  4OEO A;  2R4H A;  3ZRT A;  2DKR A;  1UFX A;  1WF7 A;  1I16 A;  5I7Z A;  2KQF A;  4R2Z A;  1FCF A;  1GQ5 A;  3ID3 A;  3EGG C;  3DOR A;  4JL7 A;  2KV8 A;  1UEQ A;  3CS0 A;  3L4F D;  4Q3H A;  2KOM A;  1L6O A;  2HE2 A;  1IU2 A;  2KPK A;  1VJ6 A;  3PV2 A;  1VAE A;  1P1D A;  3ID1 A;  1MFG A;  4JOJ A;  2D8I A;  4F8K A;  2VRF A;  1D5G A;  1UF1 A;  2EGK A;  2CSJ A;  4JOE A;  5EZ0 A;  5HFC A;  2HGA A;  2FNE A;  2F0A A;  1MC7 A;  1KY9 A;  2QKU A;  3DIW A;  1FC9 A;  1QAV B;  4RI0 A;  4Q6H A;  2YT7 A;  4N6X A;  4E35 A;  3I4W A;  4UU5 A;  3ID2 A;  3ID4 A;  2PKT A;  2K20 A;  3SOE A;  3LNX A;  2EGO A;  1MFL A;  1WHD A;  1WI2 A;  3TSV A;  4Z8J A;  2D92 A;  5H3J A;  2EHR A;  2JIL A;  3O5N A;  4JOR A;  4WYT A;  2MHO A;  2EV8 A;  1V6B A;  2Z9I A;  1TP5 A;  2KAW A;  3SUZ A;  2JRE A;  2G2L A;  1UEZ A;  3AXA A;  3CBZ A;  2IWQ A;  5HFB A;  2FN5 A;  4NMT A;  1X5N A;  1WI4 A;  1YBO A;  5D13 A;  1WG6 A;  1SOZ A;  2DC2 A;  4WYU A;  3VQG A;  2UZC A;  1R6J A;  1RY4 A;  2IWN A;  3PV4 A;  3HPK A;  2F5Y A;  2JIN A;  1W9Q A;  1QAU A;  1U39 A;  2M10 A;  2QG1 A;  3SHW A;  5HJ1 A;  3GDV A;  1UJD A;  1KWA A;  2AWX A;  3HPM A;  4HOP A;  3DJA A;  2I1N A;  3MH7 A;  1UM1 A;  1PDR A;  4NXP A;  2AIN A;  4G69 A;  2H3L A;  2JOA A;  4EDJ A;  4Q2O A;  1N99 A;  2QT5 A;  4AMH A;  1UEW A;  1WIF A;  2EGN A;  3GDU A;  1UIT A;  1W9E A;  2EDP A;  4YDP A;  5HEY A;  2JIK A;  1FC7 A;  2VWR A;  3PDZ A;  1TP3 A;  2D90 A;  2OZF A;  1N6E A;  2V1W A;  4H11 A;  2Q3G A;  2QBW A;  3RL8 A;  2LC6 A;  4JOH A;  1X5R A;  1UEP A;  2EJY A;  3WKM A;  1W9O A;  5GND A;  5JXB A;  4K6Y A;  1LCY A;  3QGL A;  4L8N A;  2DM8 A;  3NFL A;  4Q2Q A;  2KOJ A;  2LOB A;  5E1Y A;  2OSG A;  2OQS A;  2P3W A;  3QO6 A;  1Z86 A;  2OS6 A;  1X6D A;  2JWE A;  4NMS A;  3SHU A;  4K76 A;  1KEF A;  3PV5 A;  3FY5 A;  4JOG A;  1Q3P A;  2EAQ A;  2LA8 A;  2PDZ A;  3SFJ A;  1V1T A;  2EEJ A;  3K1R A;  4E34 A;  4Q2P A;  5HEB A;  2IWP A;  2QKV A;  3NFK A;  2H2C A;  1WF8 A;  2FE5 A;  1N7F A;  2M3M A;  2ZPM A;  3CC0 A;  3RLE A;  1VCW A;  4Q2N A;  5HET A;  3KZD A;  2EDZ A;  1BFE A;  2V90 A;  4K78 A;  1Z87 A;  3QE1 A;  2RCZ A;  1V5Q A;  3BPU A;  5GLJ A;  1Q7X A;  2AWW A;  1X5Q A;  1OBY A;  3K50 A;  1BE9 A;  1RZX A;  3JXT A;  4NXQ A;  4NNM A;  2EDV A;  5B6L A;  1WFV A;  2OPG A;  2O2T A;  3QDO A;  4OEP A;  2L97 A;  2M0V A;  2OMJ A;  1GQ4 A;  2Z17 A;  1QAV A;  1WJL A;  5FB8 C;  4Q6S A;  5EYZ A;  2KJK A;  2EEG A;  2W7R A;  1WFG A;  3B76 A;  1IHJ A;  1Y7N A;  1ZUB A;  2YTW A;  2K1Z A;  2R3Y A;  2KPL A;  3O46 A;  2I0L A;  1N7T A;  2PKU A;  2OGP A;  3GDS A;  1N6F A;  2KBS A;  5F67 A;  5G1D A;  2KJP A;  2JXO A;  2VSV A;  1G9O A;  2REY A;  2W4F A;  2VZ5 A;  3PDV A;  3DJ3 A;  3QIK A;  3GCN A;  2AWU A;  5HF4 A;  2VSP A;  3OU0 A;  2Q9V A;  2YT8 A;  2KL1 A;  2OCS A;  4JOK A;  4NMV A;  2EEH A;  1NTE A;  1B8Q A;  4NXR A;  5HFF A;  3GJ9 A;  4NNL A;  1SOT A;  3TSZ A;  2DJT A;  5HFE A;  3PS4 A;  1TQ3 A;  5E6P B;  5F3X A;  3GCO A;  1QLC A;  2DMZ A;  2WL7 A;  4JOF A;  1U38 A;  2G5M B;  1N7E A;  2MX6 A;  2GZV A;  1U37 A;  2CSS A;  2QKT A;  2H3M A;  3R68 A;  1Q3O A;  2KJD A;  1X45 A;  3VQF A;  3HVQ C;  1FC6 A;  5HED A;  4REY A;  2IWO A;  2M0Z A;  4GVC A;  3QJN A;  1Y8T A;  1K32 A;  2CS5 A;  2KRG A;  3GSL A;  2YUB A;  1VA8 A;  2EEI A;  1U3B A;  4IC6 A;  3E17 A;  4O06 A;  1GM1 A;  1P1E A;  5G1E A;  1N6D A;  2L4S A;  4Z33 A;  3OTP A;  2RRM A;  5E21 A;  1V5L A;  3MH4 A;  2DLS A;  1VB7 A;  2PA1 A;  4K75 A;  5E11 A;  3GGE A;  3K82 A;  1IU0 A;  1UM7 A;  5HFD A; 
#chains in the Genus database with same CATH topology
 1X8S A;  4GVD A;  4XHV A;  4K72 A;  2ENO A;  2I6V A;  1V62 A;  5HF1 A;  4NMR A;  2M0U A;  1UJV A;  2L4T A;  4E3B A;  4OAJ A;  3I18 A;  1XZ9 A;  4HOP B;  1WH1 A;  3R0H A;  4YYX A;  1ZOK A;  4LMM A;  3KZE A;  2I04 A;  3KHF A;  4P2A B;  1UHP A;  2M0T A;  2LC7 A;  2PZD A;  3MH6 A;  2YUY A;  3WKL A;  4NMO A;  2HE4 A;  2EXG A;  2LUI A;  2KG2 A;  2I4S A;  1RGW A;  1TE0 A;  5DTH A;  1OBZ A;  1T2M A;  2DAZ A;  4PQW A;  2H2B A;  3I1E A;  1M5Z A;  4P0C A;  3DJ1 A;  3CYY A;  3CBY A;  5E22 A;  2FCF A;  3CBX A;  2E7K A;  2DLU A;  2ZPL A;  4KFV A;  2BYG A;  2KYL A;  4UU6 A;  2KA9 A;  4KFW A;  4JJ0 A;  3R69 A;  4FGM A;  3EGH C;  2X7Z A;  4FLN A;  1I92 A;  2KOH A;  2PNT A;  1RGR A;  3RL7 A;  1WHA A;  5FHT A;  4NMQ A;  1OBX A;  5HDY A;  3TSW A;  3NGH A;  1NF3 C;  4MPA A;  2DB5 A;  3STJ A;  3TMH A;  4NMP A;  3LNY A;  4JOP A;  4GHN A;  2VPH A;  2I0I A;  3QJM A;  5A2P A;  1OZI A;  3CH8 A;  1UJU A;  4OEO A;  2R4H A;  3ZRT A;  2DKR A;  1UFX A;  1WF7 A;  1I16 A;  5I7Z A;  2KQF A;  4R2Z A;  1FCF A;  1GQ5 A;  3ID3 A;  3EGG C;  3DOR A;  4JL7 A;  2KV8 A;  1UEQ A;  3CS0 A;  3L4F D;  4Q3H A;  2KOM A;  1L6O A;  2HE2 A;  1IU2 A;  2KPK A;  1VJ6 A;  3PV2 A;  1VAE A;  1P1D A;  3ID1 A;  1MFG A;  4JOJ A;  2D8I A;  4F8K A;  2VRF A;  1D5G A;  1UF1 A;  2EGK A;  2CSJ A;  4JOE A;  5EZ0 A;  5HFC A;  2HGA A;  2FNE A;  2F0A A;  1MC7 A;  1KY9 A;  2QKU A;  3DIW A;  1FC9 A;  1QAV B;  4RI0 A;  4Q6H A;  2YT7 A;  4N6X A;  4E35 A;  3I4W A;  4UU5 A;  3ID2 A;  3ID4 A;  2PKT A;  2K20 A;  4JJ3 A;  3SOE A;  3LNX A;  2EGO A;  1MFL A;  1WHD A;  1WI2 A;  3TSV A;  4Z8J A;  2D92 A;  5H3J A;  2EHR A;  2JIL A;  3O5N A;  4JOR A;  4WYT A;  5IL9 A;  2MHO A;  2EV8 A;  1V6B A;  2Z9I A;  1TP5 A;  2KAW A;  3SUZ A;  2JSN A;  2JRE A;  2G2L A;  1X9Z A;  1UEZ A;  3AXA A;  3CBZ A;  2IWQ A;  5HFB A;  2FN5 A;  4NMT A;  1X5N A;  1WI4 A;  1YBO A;  5D13 A;  1WG6 A;  1SOZ A;  2DC2 A;  4WYU A;  3VQG A;  2UZC A;  1R6J A;  1RY4 A;  2IWN A;  3PV4 A;  3HPK A;  2F5Y A;  2JIN A;  1W9Q A;  1QAU A;  1U39 A;  2M10 A;  2QG1 A;  3SHW A;  5HJ1 A;  3GDV A;  1UJD A;  1KWA A;  2AWX A;  3HPM A;  4HOP A;  3DJA A;  2I1N A;  3MH7 A;  1UM1 A;  1PDR A;  4NXP A;  2AIN A;  4G69 A;  2H3L A;  2JOA A;  4EDJ A;  4Q2O A;  1N99 A;  2QT5 A;  4AMH A;  1UEW A;  1WIF A;  2GEF A;  2EGN A;  3GDU A;  1UIT A;  1W9E A;  2EDP A;  4YDP A;  5HEY A;  2JIK A;  1FC7 A;  2VWR A;  3PDZ A;  1TP3 A;  2D90 A;  2OZF A;  1N6E A;  2V1W A;  4H11 A;  2Q3G A;  3NCV A;  2QBW A;  3RL8 A;  2LC6 A;  4JOH A;  1X5R A;  1UEP A;  2EJY A;  3WKM A;  1W9O A;  5GND A;  5JXB A;  4K6Y A;  1LCY A;  3QGL A;  4L8N A;  2DM8 A;  3NFL A;  4Q2Q A;  2KOJ A;  2LOB A;  5E1Y A;  2OSG A;  2OQS A;  2P3W A;  3QO6 A;  1Z86 A;  2OS6 A;  1X6D A;  2JWE A;  4NMS A;  3SHU A;  4K76 A;  1KEF A;  3PV5 A;  3FY5 A;  4JOG A;  1Q3P A;  2EAQ A;  2LA8 A;  2PDZ A;  3SFJ A;  1V1T A;  3KDK A;  2EEJ A;  3K1R A;  4E34 A;  4Q2P A;  5HEB A;  2IWP A;  2QKV A;  3NFK A;  2H2C A;  1WF8 A;  2FE5 A;  1N7F A;  2M3M A;  2ZPM A;  3CC0 A;  3RLE A;  1VCW A;  4Q2N A;  5HET A;  3KZD A;  2EDZ A;  1BFE A;  2V90 A;  4K78 A;  1Z87 A;  3QE1 A;  2RCZ A;  1V5Q A;  3BPU A;  5GLJ A;  1Q7X A;  2AWW A;  1X5Q A;  1OBY A;  3K50 A;  1BE9 A;  1RZX A;  3JXT A;  4NXQ A;  4NNM A;  2EDV A;  5B6L A;  1WFV A;  2OPG A;  2O2T A;  3QDO A;  4OEP A;  2L97 A;  2M0V A;  2OMJ A;  1GQ4 A;  2Z17 A;  1QAV A;  1WJL A;  5FB8 C;  4Q6S A;  5EYZ A;  2KJK A;  2EEG A;  2W7R A;  1WFG A;  3B76 A;  1IHJ A;  1Y7N A;  1ZUB A;  2YTW A;  2K1Z A;  2R3Y A;  2KPL A;  3O46 A;  2I0L A;  1N7T A;  2PKU A;  2OGP A;  3GDS A;  1N6F A;  2KBS A;  5F67 A;  5G1D A;  2KJP A;  2JXO A;  2VSV A;  1G9O A;  2REY A;  2W4F A;  2VZ5 A;  3PDV A;  3DJ3 A;  3GAB A;  3QIK A;  3GCN A;  5ILB A;  2AWU A;  5HF4 A;  2VSP A;  3OU0 A;  2Q9V A;  2YT8 A;  2KL1 A;  2OCS A;  4JOK A;  4NMV A;  2EEH A;  1NTE A;  1B8Q A;  4NXR A;  5HFF A;  3GJ9 A;  4NNL A;  1SOT A;  3TSZ A;  2DJT A;  5HFE A;  3PS4 A;  1TQ3 A;  5E6P B;  5F3X A;  3GCO A;  1QLC A;  2DMZ A;  2WL7 A;  4JOF A;  1U38 A;  2G5M B;  1N7E A;  2MX6 A;  2GZV A;  1U37 A;  2CSS A;  2QKT A;  2H3M A;  3R68 A;  1Q3O A;  2KJD A;  1X45 A;  3VQF A;  3HVQ C;  1FC6 A;  5HED A;  4REY A;  2IWO A;  2M0Z A;  4GVC A;  3QJN A;  1Y8T A;  1K32 A;  2CS5 A;  2KRG A;  3GSL A;  2YUB A;  1VA8 A;  2EEI A;  1U3B A;  4IC6 A;  3E17 A;  4O06 A;  1GM1 A;  1P1E A;  5G1E A;  1N6D A;  2L4S A;  4Z33 A;  3OTP A;  2RRM A;  5E21 A;  1V5L A;  3MH4 A;  2DLS A;  1VB7 A;  2PA1 A;  4K75 A;  5E11 A;  3KDG A;  3GGE A;  3K82 A;  1IU0 A;  1UM7 A;  5HFD A;  5B42 A; 
#chains in the Genus database with same CATH homology
 1X8S A;  4GVD A;  4XHV A;  4K72 A;  2ENO A;  2I6V A;  1V62 A;  5HF1 A;  4NMR A;  2M0U A;  1UJV A;  2L4T A;  4E3B A;  4OAJ A;  3I18 A;  1XZ9 A;  4HOP B;  1WH1 A;  3R0H A;  4YYX A;  1ZOK A;  4LMM A;  3KZE A;  2I04 A;  3KHF A;  4P2A B;  1UHP A;  2M0T A;  2LC7 A;  2PZD A;  3MH6 A;  2YUY A;  3WKL A;  4NMO A;  2HE4 A;  2EXG A;  2LUI A;  2KG2 A;  2I4S A;  1RGW A;  1TE0 A;  5DTH A;  1OBZ A;  1T2M A;  2DAZ A;  4PQW A;  2H2B A;  3I1E A;  1M5Z A;  4P0C A;  3DJ1 A;  3CYY A;  3CBY A;  5E22 A;  2FCF A;  3CBX A;  2E7K A;  2DLU A;  2ZPL A;  4KFV A;  2BYG A;  2KYL A;  4UU6 A;  2KA9 A;  4KFW A;  4JJ0 A;  3R69 A;  4FGM A;  3EGH C;  2X7Z A;  4FLN A;  1I92 A;  2KOH A;  2PNT A;  1RGR A;  3RL7 A;  1WHA A;  5FHT A;  4NMQ A;  1OBX A;  5HDY A;  3TSW A;  3NGH A;  1NF3 C;  4MPA A;  2DB5 A;  3STJ A;  3TMH A;  4NMP A;  3LNY A;  4JOP A;  4GHN A;  2VPH A;  2I0I A;  3QJM A;  5A2P A;  1OZI A;  3CH8 A;  1UJU A;  4OEO A;  2R4H A;  3ZRT A;  2DKR A;  1UFX A;  1WF7 A;  1I16 A;  5I7Z A;  2KQF A;  4R2Z A;  1FCF A;  1GQ5 A;  3ID3 A;  3EGG C;  3DOR A;  4JL7 A;  2KV8 A;  1UEQ A;  3CS0 A;  3L4F D;  4Q3H A;  2KOM A;  1L6O A;  2HE2 A;  1IU2 A;  2KPK A;  1VJ6 A;  3PV2 A;  1VAE A;  1P1D A;  3ID1 A;  1MFG A;  4JOJ A;  2D8I A;  4F8K A;  2VRF A;  1D5G A;  1UF1 A;  2EGK A;  2CSJ A;  4JOE A;  5EZ0 A;  5HFC A;  2HGA A;  2FNE A;  2F0A A;  1MC7 A;  1KY9 A;  2QKU A;  3DIW A;  1FC9 A;  1QAV B;  4RI0 A;  4Q6H A;  2YT7 A;  4N6X A;  4E35 A;  3I4W A;  4UU5 A;  3ID2 A;  3ID4 A;  2PKT A;  2K20 A;  4JJ3 A;  3SOE A;  3LNX A;  2EGO A;  1MFL A;  1WHD A;  1WI2 A;  3TSV A;  4Z8J A;  2D92 A;  5H3J A;  2EHR A;  2JIL A;  3O5N A;  4JOR A;  4WYT A;  5IL9 A;  2MHO A;  2EV8 A;  1V6B A;  2Z9I A;  1TP5 A;  2KAW A;  3SUZ A;  2JSN A;  2JRE A;  2G2L A;  1X9Z A;  1UEZ A;  3AXA A;  3CBZ A;  2IWQ A;  5HFB A;  2FN5 A;  4NMT A;  1X5N A;  1WI4 A;  1YBO A;  5D13 A;  1WG6 A;  1SOZ A;  2DC2 A;  4WYU A;  3VQG A;  2UZC A;  1R6J A;  1RY4 A;  2IWN A;  3PV4 A;  3HPK A;  2F5Y A;  2JIN A;  1W9Q A;  1QAU A;  1U39 A;  2M10 A;  2QG1 A;  3SHW A;  5HJ1 A;  3GDV A;  1UJD A;  1KWA A;  2AWX A;  3HPM A;  4HOP A;  3DJA A;  2I1N A;  3MH7 A;  1UM1 A;  1PDR A;  4NXP A;  2AIN A;  4G69 A;  2H3L A;  2JOA A;  4EDJ A;  4Q2O A;  1N99 A;  2QT5 A;  4AMH A;  1UEW A;  1WIF A;  2GEF A;  2EGN A;  3GDU A;  1UIT A;  1W9E A;  2EDP A;  4YDP A;  5HEY A;  2JIK A;  1FC7 A;  2VWR A;  3PDZ A;  1TP3 A;  2D90 A;  2OZF A;  1N6E A;  2V1W A;  4H11 A;  2Q3G A;  3NCV A;  2QBW A;  3RL8 A;  2LC6 A;  4JOH A;  1X5R A;  1UEP A;  2EJY A;  3WKM A;  1W9O A;  5GND A;  5JXB A;  4K6Y A;  1LCY A;  3QGL A;  4L8N A;  2DM8 A;  3NFL A;  4Q2Q A;  2KOJ A;  2LOB A;  5E1Y A;  2OSG A;  2OQS A;  2P3W A;  3QO6 A;  1Z86 A;  2OS6 A;  1X6D A;  2JWE A;  4NMS A;  3SHU A;  4K76 A;  1KEF A;  3PV5 A;  3FY5 A;  4JOG A;  1Q3P A;  2EAQ A;  2LA8 A;  2PDZ A;  3SFJ A;  1V1T A;  3KDK A;  2EEJ A;  3K1R A;  4E34 A;  4Q2P A;  5HEB A;  2IWP A;  2QKV A;  3NFK A;  2H2C A;  1WF8 A;  2FE5 A;  1N7F A;  2M3M A;  2ZPM A;  3CC0 A;  3RLE A;  1VCW A;  4Q2N A;  5HET A;  3KZD A;  2EDZ A;  1BFE A;  2V90 A;  4K78 A;  1Z87 A;  3QE1 A;  2RCZ A;  1V5Q A;  3BPU A;  5GLJ A;  1Q7X A;  2AWW A;  1X5Q A;  1OBY A;  3K50 A;  1BE9 A;  1RZX A;  3JXT A;  4NXQ A;  4NNM A;  2EDV A;  5B6L A;  1WFV A;  2OPG A;  2O2T A;  3QDO A;  4OEP A;  2L97 A;  2M0V A;  2OMJ A;  1GQ4 A;  2Z17 A;  1QAV A;  1WJL A;  5FB8 C;  4Q6S A;  5EYZ A;  2KJK A;  2EEG A;  2W7R A;  1WFG A;  3B76 A;  1IHJ A;  1Y7N A;  1ZUB A;  2YTW A;  2K1Z A;  2R3Y A;  2KPL A;  3O46 A;  2I0L A;  1N7T A;  2PKU A;  2OGP A;  3GDS A;  1N6F A;  2KBS A;  5F67 A;  5G1D A;  2KJP A;  2JXO A;  2VSV A;  1G9O A;  2REY A;  2W4F A;  2VZ5 A;  3PDV A;  3DJ3 A;  3GAB A;  3QIK A;  3GCN A;  5ILB A;  2AWU A;  5HF4 A;  2VSP A;  3OU0 A;  2Q9V A;  2YT8 A;  2KL1 A;  2OCS A;  4JOK A;  4NMV A;  2EEH A;  1NTE A;  1B8Q A;  4NXR A;  5HFF A;  3GJ9 A;  4NNL A;  1SOT A;  3TSZ A;  2DJT A;  5HFE A;  3PS4 A;  1TQ3 A;  5E6P B;  5F3X A;  3GCO A;  1QLC A;  2DMZ A;  2WL7 A;  4JOF A;  1U38 A;  2G5M B;  1N7E A;  2MX6 A;  2GZV A;  1U37 A;  2CSS A;  2QKT A;  2H3M A;  3R68 A;  1Q3O A;  2KJD A;  1X45 A;  3VQF A;  3HVQ C;  1FC6 A;  5HED A;  4REY A;  2IWO A;  2M0Z A;  4GVC A;  3QJN A;  1Y8T A;  1K32 A;  2CS5 A;  2KRG A;  3GSL A;  2YUB A;  1VA8 A;  2EEI A;  1U3B A;  4IC6 A;  3E17 A;  4O06 A;  1GM1 A;  1P1E A;  5G1E A;  1N6D A;  2L4S A;  4Z33 A;  3OTP A;  2RRM A;  5E21 A;  1V5L A;  3MH4 A;  2DLS A;  1VB7 A;  2PA1 A;  4K75 A;  5E11 A;  3KDG A;  3GGE A;  3K82 A;  1IU0 A;  1UM7 A;  5HFD A;  5B42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...