2EEHA

Solution structure of first pdz domain of pdz domain containing protein 7
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
100
structure length
100
Chain Sequence
GSSGSSGSDIIHSVRVEKSPAGRLGFSVRGGSEHGLGIFVSKVEEGSSAERAGLCVGDKITEVNGLSLESTTMGSAVKVLTSSSRLHMMVRRMGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PDZ domain-containing protein 7
publication title Solution Structure of First PDZ domain of PDZ Domain Containing Protein 7
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 10
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2eehA00
3HVQC 2GZVA 2VRFA 1WG6A 2AINA 2RCZA 3TSWA 1B8QA 1U3BA 5E1YA 5F3XA 4GVCA 4L8NA 3R68A 2H2BA 3ID1A 2V1WA 3BPUA 3KZDA 3HPKA 2R4HA 5I7ZA 3GSLA 4H11A 2DLSA 5A2PA 2YUBA 4JOHA 1X6DA 2CSJA 2HE2A 1R6JA 2X7ZA 1WF7A 4Q2QA 2EEHA 1V6BA 4K78A 4R2ZA 5E11A 4LMMA 1Q7XA 1XZ9A 5G1DA 2QKUA 3TSZA 2W7RA 2I6VA 3MH6A 2OMJA 2FE5A 1QAUA 2DB5A 2QBWA 4HOPB 2M0VA 1X8SA 2DM8A 3AXAA 4GVDA 5HF4A 2H2CA 4K72A 2QT5A 1FC9A 4E34A 1VJ6A 3O46A 1RGWA 1X5RA 5EYZA 2EDZA 3GDVA 2KPLA 1NF3C 2KA9A 3TMHA 5EZ0A 2KPKA 4WYTA 2RRMA 2KL1A 4NNLA 4JOJA 3DJ3A 1UEWA 3CBYA 4YDPA 1N7TA 2H3LA 2EGNA 4NMQA 1KY9A 1TQ3A 1X5QA 2Z9IA 1MC7A 4FGMA 1X5NA 3OTPA 1T2MA 1UHPA 2LC7A 3TSVA 2VSPA 4UU5A 2DJTA 4JOFA 4KFWA 1OZIA 2DKRA 1OBYA 2BYGA 1QAVB 2EHRA 1LCYA 2VSVA 3I18A 2E7KA 3SUZA 1SOZA 2LOBA 3LNXA 2AWWA 2F0AA 2KRGA 2EV8A 4YYXA 2JIKA 2IWQA 3ZRTA 3EGGC 2FN5A 1N6FA 3NFKA 3I1EA 1W9OA 4NXRA 1U39A 2M10A 3K50A 3ID3A 2VPHA 2VZ5A 2AWXA 4NMVA 1WIFA 4E3BA 5HEYA 1UM1A 3RL7A 5JXBA 4JL7A 2P3WA 2I04A 2OSGA 3PS4A 3R69A 1QLCA 3QJNA 5F67A 4P2AB 1FC7A 1N6EA 1Q3PA 2Z17A 5E6PB 1MFGA 3I4WA 2WL7A 3CC0A 1YBOA 2KQFA 2IWOA 2PKUA 1V5LA 2I4SA 3DJAA 3QE1A 3GCNA 2JWEA 4XHVA 1GQ5A 1OBXA 2V90A 1UF1A 3MH7A 3GDUA 1SOTA 5B6LA 2OS6A 3CBZA 5H3JA 1N6DA 1UJVA 3CS0A 1UEZA 3RLEA 2DC2A 1VB7A 2QG1A 4OEOA 2YUYA 1TP5A 3KHFA 4JOEA 2EDPA 1PDRA 2MX6A 3DIWA 3PDZA 4AMHA 1U38A 4KFVA 2I0LA 2KOMA 4NMSA 2PDZA 1MFLA 3DJ1A 1BFEA 2PKTA 4REYA 3LNYA 2JXOA 2OCSA 2W4FA 3CH8A 1N99A 2O2TA 3PV4A 3CBXA 3PV5A 2LA8A 4Q6SA 3QJMA 2KOJA 1KEFA 1K32A 2ZPLA 4GHNA 2L4TA 4Z8JA 1WF8A 4RI0A 2D8IA 2FNEA 4G69A 5FB8C 2ENOA 1WHAA 2G5MB 3VQFA 4Z33A 3R0HA 1G9OA 5E22A 2DAZA 1UFXA 1ZOKA 1IHJA 4NXPA 1N7EA 1P1EA 1ZUBA 5FHTA 1V1TA 3STJA 3WKLA 3QDOA 2D90A 2OQSA 4JOGA 2EAQA 2IWPA 2KG2A 4MPAA 1IU0A 4JORA 1TE0A 4OAJA 3VQGA 1RGRA 4IC6A 2EEGA 2K1ZA 1GM1A 2ZPMA 1W9QA 2YTWA 4JOKA 2KOHA 5D13A 1RY4A 2DLUA 2M0TA 1UEPA 1VAEA 2HGAA 2OGPA 2EDVA 4WYUA 3JXTA 1V62A 2YT7A 4NMTA 1IU2A 3QO6A 4NNMA 5HDYA 1WFGA 2I0IA 2EGOA 1TP3A 4Q2NA 5HEDA 1U37A 3L4FD 1UITA 2YT8A 4Q3HA 5HJ1A 4EDJA 4OEPA 3GDSA 1M5ZA 4NMPA 3PDVA 3KZEA 4NXQA 3SHWA 2JILA 1UJUA 5HFCA 4JOPA 4K6YA 2KJDA 1RZXA 2AWUA 3ID4A 1I16A 5HFDA 4K75A 1V5QA 2QKTA 1Z87A 2R3YA 3MH4A 5HFFA 1X45A 1UEQA 3WKMA 4Q2OA 1Y7NA 4NMRA 2REYA 3K1RA 1WJLA 1NTEA 1Q3OA 2PZDA 3SHUA 2Q3GA 5GLJA 3QGLA 5HETA 3EGHC 1OBZA 2H3MA 2KJPA 1P1DA 2K20A 3SFJA 4K76A 4Q2PA 5DTHA 1WH1A 2MHOA 4N6XA 2M0ZA 1WHDA 1Y8TA 2F5YA 4UU6A 2IWNA 1GQ4A 2Q9VA 3B76A 1WFVA 4PQWA 5HFBA 1VA8A 4NMOA 3OU0A 1VCWA 1L6OA 4F8KA 1WI2A 2M3MA 2KV8A 1UM7A 2DMZA 5HFEA 5HEBA 5E21A 2PA1A 3GCOA 1I92A 1Z86A 3O5NA 5G1EA 5HF1A 2EEJA 3ID2A 4O06A 3FY5A 2HE4A 1FCFA 3NGHA 1UJDA 2OPGA 2LC6A 1BE9A 2I1NA 3HPMA 2M0UA 3SOEA 2L4SA 3DORA 1WI4A 3K82A 4HOPA 2VWRA 2KJKA 3NFLA 2EEIA 2PNTA 2KYLA 2JINA 3RL8A 2UZCA 3GJ9A 2OZFA 2CSSA 1FC6A 3E17A 4E35A 2EJYA 3QIKA 2KBSA 2D92A 2KAWA 1KWAA 4P0CA 2EGKA 3PV2A 1D5GA 2JREA 2G2LA 2EXGA 3CYYA 2QKVA 2LUIA 4Q6HA 1N7FA 2L97A 3GGEA 2FCFA 5GNDA 2JOAA 2CS5A 1QAVA 1W9EA
chains in the Genus database with same CATH superfamily
3HVQC 2GZVA 2VRFA 1WG6A 2AINA 2RCZA 3TSWA 1B8QA 1U3BA 5E1YA 5F3XA 4GVCA 4L8NA 3R68A 2H2BA 3ID1A 2V1WA 3BPUA 3KZDA 3HPKA 2R4HA 5I7ZA 3GSLA 4H11A 2DLSA 5A2PA 2YUBA 4JOHA 1X6DA 2CSJA 2HE2A 1R6JA 2X7ZA 1WF7A 3GABA 1X9ZA 4Q2QA 2EEHA 1V6BA 4K78A 4R2ZA 5E11A 4LMMA 1Q7XA 1XZ9A 5G1DA 2QKUA 3TSZA 2W7RA 2I6VA 3MH6A 2OMJA 2FE5A 1QAUA 2DB5A 2QBWA 4HOPB 2M0VA 1X8SA 2DM8A 3AXAA 4GVDA 5HF4A 2H2CA 4K72A 2QT5A 1FC9A 4E34A 1VJ6A 3O46A 1RGWA 1X5RA 5EYZA 2EDZA 3GDVA 2KPLA 5ILBA 1NF3C 2KA9A 3TMHA 5EZ0A 2KPKA 4WYTA 2RRMA 2KL1A 4NNLA 4JOJA 3DJ3A 1UEWA 3CBYA 4YDPA 3NCVA 4JJ3A 1N7TA 2H3LA 2EGNA 4NMQA 1KY9A 2Z9IA 1TQ3A 1X5QA 1MC7A 4FGMA 1X5NA 3OTPA 1T2MA 1UHPA 2LC7A 3TSVA 2VSPA 4UU5A 2DJTA 4JOFA 4KFWA 1OZIA 2DKRA 1OBYA 2BYGA 1QAVB 2EHRA 1LCYA 2VSVA 3I18A 2E7KA 3SUZA 1SOZA 2LOBA 3LNXA 2AWWA 2F0AA 2KRGA 2EV8A 4YYXA 2JIKA 2IWQA 3ZRTA 3EGGC 2FN5A 1N6FA 3NFKA 3I1EA 1W9OA 4NXRA 1U39A 2M10A 3K50A 3ID3A 2VPHA 2VZ5A 2AWXA 4NMVA 1WIFA 4E3BA 5HEYA 1UM1A 3RL7A 5JXBA 4JL7A 2P3WA 2I04A 2OSGA 3PS4A 3R69A 1QLCA 3QJNA 5F67A 4P2AB 1FC7A 1N6EA 1Q3PA 2Z17A 5E6PB 1MFGA 3I4WA 2WL7A 3CC0A 1YBOA 2KQFA 4FLNA 2IWOA 2PKUA 1V5LA 2I4SA 3DJAA 3QE1A 3GCNA 2JWEA 4XHVA 1GQ5A 1OBXA 2V90A 1UF1A 3MH7A 3GDUA 1SOTA 5B6LA 2OS6A 3CBZA 5H3JA 1N6DA 1UJVA 3CS0A 1UEZA 3RLEA 2DC2A 1VB7A 2QG1A 4OEOA 2YUYA 1TP5A 3KHFA 4JOEA 2EDPA 1PDRA 2MX6A 3DIWA 3PDZA 4AMHA 1U38A 4KFVA 2I0LA 2KOMA 4NMSA 2PDZA 1MFLA 3DJ1A 1BFEA 2PKTA 4REYA 3LNYA 2JXOA 2OCSA 2W4FA 3CH8A 1N99A 2O2TA 3PV4A 3CBXA 3PV5A 2LA8A 4Q6SA 3QJMA 2KOJA 1KEFA 1K32A 2ZPLA 4GHNA 2L4TA 3KDKA 4Z8JA 1WF8A 4RI0A 2D8IA 2FNEA 4G69A 5FB8C 2ENOA 1WHAA 2G5MB 3VQFA 4Z33A 3R0HA 1G9OA 5E22A 2DAZA 1UFXA 1ZOKA 1IHJA 4NXPA 1N7EA 1P1EA 1ZUBA 5FHTA 1V1TA 3STJA 3WKLA 3QDOA 2D90A 2OQSA 4JOGA 2EAQA 2IWPA 2KG2A 4MPAA 1IU0A 4JORA 1TE0A 4OAJA 3VQGA 1RGRA 4IC6A 2EEGA 2K1ZA 1GM1A 2ZPMA 1W9QA 2YTWA 4JOKA 2KOHA 5D13A 3KDGA 1RY4A 2DLUA 2M0TA 1UEPA 1VAEA 2HGAA 2OGPA 2EDVA 4WYUA 3JXTA 1V62A 2YT7A 4NMTA 1IU2A 3QO6A 4NNMA 5HDYA 1WFGA 2I0IA 2EGOA 1TP3A 4Q2NA 5HEDA 1U37A 3L4FD 1UITA 2YT8A 4Q3HA 5HJ1A 4EDJA 4OEPA 3GDSA 1M5ZA 4NMPA 3PDVA 3KZEA 4NXQA 3SHWA 2JILA 1UJUA 5HFCA 4JOPA 4K6YA 2JSNA 2KJDA 1RZXA 2AWUA 3ID4A 1I16A 5HFDA 4K75A 1V5QA 2QKTA 1Z87A 2R3YA 3MH4A 5HFFA 1X45A 1UEQA 3WKMA 4Q2OA 1Y7NA 4NMRA 5IL9A 2REYA 3K1RA 1WJLA 1NTEA 1Q3OA 2PZDA 3SHUA 2Q3GA 5GLJA 3QGLA 5HETA 4JJ0A 3EGHC 1OBZA 2H3MA 2KJPA 1P1DA 2K20A 3SFJA 4K76A 4Q2PA 5DTHA 1WH1A 2MHOA 4N6XA 2M0ZA 1WHDA 1Y8TA 2F5YA 4UU6A 2IWNA 1GQ4A 2Q9VA 3B76A 1WFVA 4PQWA 5HFBA 1VA8A 4NMOA 2GEFA 3OU0A 1VCWA 1L6OA 4F8KA 1WI2A 2M3MA 2KV8A 1UM7A 2DMZA 5HFEA 5HEBA 5E21A 2PA1A 3GCOA 1I92A 1Z86A 3O5NA 5G1EA 5HF1A 2EEJA 3ID2A 4O06A 3FY5A 2HE4A 1FCFA 3NGHA 1UJDA 2OPGA 2LC6A 1BE9A 2I1NA 3HPMA 2M0UA 3SOEA 2L4SA 3DORA 1WI4A 3K82A 4HOPA 2VWRA 2KJKA 3NFLA 2EEIA 2PNTA 2KYLA 2JINA 3RL8A 2UZCA 3GJ9A 5B42A 2OZFA 2CSSA 1FC6A 3E17A 4E35A 2EJYA 3QIKA 2KBSA 2D92A 2KAWA 1KWAA 4P0CA 2EGKA 3PV2A 1D5GA 2JREA 2G2LA 2EXGA 3CYYA 2QKVA 2LUIA 4Q6HA 1N7FA 2L97A 3GGEA 2FCFA 5GNDA 2JOAA 2CS5A 1QAVA 1W9EA
chains in the Genus database with same CATH topology
3HVQC 2GZVA 2VRFA 1WG6A 2AINA 2RCZA 3TSWA 1B8QA 1U3BA 5E1YA 5F3XA 4GVCA 4L8NA 3R68A 2H2BA 3ID1A 2V1WA 3BPUA 3KZDA 3HPKA 2R4HA 5I7ZA 3GSLA 4H11A 2DLSA 5A2PA 2YUBA 4JOHA 1X6DA 2CSJA 2HE2A 1R6JA 2X7ZA 1WF7A 3GABA 1X9ZA 4Q2QA 2EEHA 1V6BA 4K78A 4R2ZA 5E11A 4LMMA 1Q7XA 1XZ9A 5G1DA 2QKUA 3TSZA 2W7RA 2I6VA 3MH6A 2OMJA 2FE5A 1QAUA 2DB5A 2QBWA 4HOPB 2M0VA 1X8SA 2DM8A 3AXAA 4GVDA 5HF4A 2H2CA 4K72A 2QT5A 1FC9A 4E34A 1VJ6A 3O46A 1RGWA 1X5RA 5EYZA 2EDZA 3GDVA 2KPLA 5ILBA 1NF3C 2KA9A 3TMHA 5EZ0A 2KPKA 4WYTA 2RRMA 2KL1A 4NNLA 4JOJA 3DJ3A 1UEWA 3CBYA 4YDPA 3NCVA 4JJ3A 1N7TA 2H3LA 2EGNA 4NMQA 1KY9A 2Z9IA 1TQ3A 1X5QA 1MC7A 4FGMA 1X5NA 3OTPA 1T2MA 1UHPA 2LC7A 3TSVA 2VSPA 4UU5A 2DJTA 4JOFA 4KFWA 1OZIA 2DKRA 1OBYA 2BYGA 1QAVB 2EHRA 1LCYA 2VSVA 3I18A 2E7KA 3SUZA 1SOZA 2LOBA 3LNXA 2AWWA 2F0AA 2KRGA 2EV8A 4YYXA 2JIKA 2IWQA 3ZRTA 3EGGC 2FN5A 1N6FA 3NFKA 3I1EA 1W9OA 4NXRA 1U39A 2M10A 3K50A 3ID3A 2VPHA 2VZ5A 2AWXA 4NMVA 1WIFA 4E3BA 5HEYA 1UM1A 3RL7A 5JXBA 4JL7A 2P3WA 2I04A 2OSGA 3PS4A 3R69A 1QLCA 3QJNA 5F67A 4P2AB 1FC7A 1N6EA 1Q3PA 2Z17A 5E6PB 1MFGA 3I4WA 2WL7A 3CC0A 1YBOA 2KQFA 4FLNA 2IWOA 2PKUA 1V5LA 2I4SA 3DJAA 3QE1A 3GCNA 2JWEA 4XHVA 1GQ5A 1OBXA 2V90A 1UF1A 3MH7A 3GDUA 1SOTA 5B6LA 2OS6A 3CBZA 5H3JA 1N6DA 1UJVA 3CS0A 1UEZA 3RLEA 2DC2A 1VB7A 2QG1A 4OEOA 2YUYA 1TP5A 3KHFA 4JOEA 2EDPA 1PDRA 2MX6A 3DIWA 3PDZA 4AMHA 1U38A 4KFVA 2I0LA 2KOMA 4NMSA 2PDZA 1MFLA 3DJ1A 1BFEA 2PKTA 4REYA 3LNYA 2JXOA 2OCSA 2W4FA 3CH8A 1N99A 2O2TA 3PV4A 3CBXA 3PV5A 2LA8A 4Q6SA 3QJMA 2KOJA 1KEFA 1K32A 2ZPLA 4GHNA 2L4TA 3KDKA 4Z8JA 1WF8A 4RI0A 2D8IA 2FNEA 4G69A 5FB8C 2ENOA 1WHAA 2G5MB 3VQFA 4Z33A 3R0HA 1G9OA 5E22A 2DAZA 1UFXA 1ZOKA 1IHJA 4NXPA 1N7EA 1P1EA 1ZUBA 5FHTA 1V1TA 3STJA 3WKLA 3QDOA 2D90A 2OQSA 4JOGA 2EAQA 2IWPA 2KG2A 4MPAA 1IU0A 4JORA 1TE0A 4OAJA 3VQGA 1RGRA 4IC6A 2EEGA 2K1ZA 1GM1A 2ZPMA 1W9QA 2YTWA 4JOKA 2KOHA 5D13A 3KDGA 1RY4A 2DLUA 2M0TA 1UEPA 1VAEA 2HGAA 2OGPA 2EDVA 4WYUA 3JXTA 1V62A 2YT7A 4NMTA 1IU2A 3QO6A 4NNMA 5HDYA 1WFGA 2I0IA 2EGOA 1TP3A 4Q2NA 5HEDA 1U37A 3L4FD 1UITA 2YT8A 4Q3HA 5HJ1A 4EDJA 4OEPA 3GDSA 1M5ZA 4NMPA 3PDVA 3KZEA 4NXQA 3SHWA 2JILA 1UJUA 5HFCA 4JOPA 4K6YA 2JSNA 2KJDA 1RZXA 2AWUA 3ID4A 1I16A 5HFDA 4K75A 1V5QA 2QKTA 1Z87A 2R3YA 3MH4A 5HFFA 1X45A 1UEQA 3WKMA 4Q2OA 1Y7NA 4NMRA 5IL9A 2REYA 3K1RA 1WJLA 1NTEA 1Q3OA 2PZDA 3SHUA 2Q3GA 5GLJA 3QGLA 5HETA 4JJ0A 3EGHC 1OBZA 2H3MA 2KJPA 1P1DA 2K20A 3SFJA 4K76A 4Q2PA 5DTHA 1WH1A 2MHOA 4N6XA 2M0ZA 1WHDA 1Y8TA 2F5YA 4UU6A 2IWNA 1GQ4A 2Q9VA 3B76A 1WFVA 4PQWA 5HFBA 1VA8A 4NMOA 2GEFA 3OU0A 1VCWA 1L6OA 4F8KA 1WI2A 2M3MA 2KV8A 1UM7A 2DMZA 5HFEA 5HEBA 5E21A 2PA1A 3GCOA 1I92A 1Z86A 3O5NA 5G1EA 5HF1A 2EEJA 3ID2A 4O06A 3FY5A 2HE4A 1FCFA 3NGHA 1UJDA 2OPGA 2LC6A 1BE9A 2I1NA 3HPMA 2M0UA 3SOEA 2L4SA 3DORA 1WI4A 3K82A 4HOPA 2VWRA 2KJKA 3NFLA 2EEIA 2PNTA 2KYLA 2JINA 3RL8A 2UZCA 3GJ9A 5B42A 2OZFA 2CSSA 1FC6A 3E17A 4E35A 2EJYA 3QIKA 2KBSA 2D92A 2KAWA 1KWAA 4P0CA 2EGKA 3PV2A 1D5GA 2JREA 2G2LA 2EXGA 3CYYA 2QKVA 2LUIA 4Q6HA 1N7FA 2L97A 3GGEA 2FCFA 5GNDA 2JOAA 2CS5A 1QAVA 1W9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HVQ C;  2GZV A;  2VRF A;  1WG6 A;  2AIN A;  2RCZ A;  3TSW A;  1B8Q A;  1U3B A;  5E1Y A;  5F3X A;  4GVC A;  4L8N A;  3R68 A;  2H2B A;  3ID1 A;  2V1W A;  3BPU A;  3KZD A;  3HPK A;  2R4H A;  5I7Z A;  3GSL A;  4H11 A;  2DLS A;  5A2P A;  2YUB A;  4JOH A;  1X6D A;  2CSJ A;  2HE2 A;  1R6J A;  2X7Z A;  1WF7 A;  4Q2Q A;  2EEH A;  1V6B A;  4K78 A;  4R2Z A;  5E11 A;  4LMM A;  1Q7X A;  1XZ9 A;  5G1D A;  2QKU A;  3TSZ A;  2W7R A;  2I6V A;  3MH6 A;  2OMJ A;  2FE5 A;  1QAU A;  2DB5 A;  2QBW A;  4HOP B;  2M0V A;  1X8S A;  2DM8 A;  3AXA A;  4GVD A;  5HF4 A;  2H2C A;  4K72 A;  2QT5 A;  1FC9 A;  4E34 A;  1VJ6 A;  3O46 A;  1RGW A;  1X5R A;  5EYZ A;  2EDZ A;  3GDV A;  2KPL A;  1NF3 C;  2KA9 A;  3TMH A;  5EZ0 A;  2KPK A;  4WYT A;  2RRM A;  2KL1 A;  4NNL A;  4JOJ A;  3DJ3 A;  1UEW A;  3CBY A;  4YDP A;  1N7T A;  2H3L A;  2EGN A;  4NMQ A;  1KY9 A;  1TQ3 A;  1X5Q A;  2Z9I A;  1MC7 A;  4FGM A;  1X5N A;  3OTP A;  1T2M A;  1UHP A;  2LC7 A;  3TSV A;  2VSP A;  4UU5 A;  2DJT A;  4JOF A;  4KFW A;  1OZI A;  2DKR A;  1OBY A;  2BYG A;  1QAV B;  2EHR A;  1LCY A;  2VSV A;  3I18 A;  2E7K A;  3SUZ A;  1SOZ A;  2LOB A;  3LNX A;  2AWW A;  2F0A A;  2KRG A;  2EV8 A;  4YYX A;  2JIK A;  2IWQ A;  3ZRT A;  3EGG C;  2FN5 A;  1N6F A;  3NFK A;  3I1E A;  1W9O A;  4NXR A;  1U39 A;  2M10 A;  3K50 A;  3ID3 A;  2VPH A;  2VZ5 A;  2AWX A;  4NMV A;  1WIF A;  4E3B A;  5HEY A;  1UM1 A;  3RL7 A;  5JXB A;  4JL7 A;  2P3W A;  2I04 A;  2OSG A;  3PS4 A;  3R69 A;  1QLC A;  3QJN A;  5F67 A;  4P2A B;  1FC7 A;  1N6E A;  1Q3P A;  2Z17 A;  5E6P B;  1MFG A;  3I4W A;  2WL7 A;  3CC0 A;  1YBO A;  2KQF A;  2IWO A;  2PKU A;  1V5L A;  2I4S A;  3DJA A;  3QE1 A;  3GCN A;  2JWE A;  4XHV A;  1GQ5 A;  1OBX A;  2V90 A;  1UF1 A;  3MH7 A;  3GDU A;  1SOT A;  5B6L A;  2OS6 A;  3CBZ A;  5H3J A;  1N6D A;  1UJV A;  3CS0 A;  1UEZ A;  3RLE A;  2DC2 A;  1VB7 A;  2QG1 A;  4OEO A;  2YUY A;  1TP5 A;  3KHF A;  4JOE A;  2EDP A;  1PDR A;  2MX6 A;  3DIW A;  3PDZ A;  4AMH A;  1U38 A;  4KFV A;  2I0L A;  2KOM A;  4NMS A;  2PDZ A;  1MFL A;  3DJ1 A;  1BFE A;  2PKT A;  4REY A;  3LNY A;  2JXO A;  2OCS A;  2W4F A;  3CH8 A;  1N99 A;  2O2T A;  3PV4 A;  3CBX A;  3PV5 A;  2LA8 A;  4Q6S A;  3QJM A;  2KOJ A;  1KEF A;  1K32 A;  2ZPL A;  4GHN A;  2L4T A;  4Z8J A;  1WF8 A;  4RI0 A;  2D8I A;  2FNE A;  4G69 A;  5FB8 C;  2ENO A;  1WHA A;  2G5M B;  3VQF A;  4Z33 A;  3R0H A;  1G9O A;  5E22 A;  2DAZ A;  1UFX A;  1ZOK A;  1IHJ A;  4NXP A;  1N7E A;  1P1E A;  1ZUB A;  5FHT A;  1V1T A;  3STJ A;  3WKL A;  3QDO A;  2D90 A;  2OQS A;  4JOG A;  2EAQ A;  2IWP A;  2KG2 A;  4MPA A;  1IU0 A;  4JOR A;  1TE0 A;  4OAJ A;  3VQG A;  1RGR A;  4IC6 A;  2EEG A;  2K1Z A;  1GM1 A;  2ZPM A;  1W9Q A;  2YTW A;  4JOK A;  2KOH A;  5D13 A;  1RY4 A;  2DLU A;  2M0T A;  1UEP A;  1VAE A;  2HGA A;  2OGP A;  2EDV A;  4WYU A;  3JXT A;  1V62 A;  2YT7 A;  4NMT A;  1IU2 A;  3QO6 A;  4NNM A;  5HDY A;  1WFG A;  2I0I A;  2EGO A;  1TP3 A;  4Q2N A;  5HED A;  1U37 A;  3L4F D;  1UIT A;  2YT8 A;  4Q3H A;  5HJ1 A;  4EDJ A;  4OEP A;  3GDS A;  1M5Z A;  4NMP A;  3PDV A;  3KZE A;  4NXQ A;  3SHW A;  2JIL A;  1UJU A;  5HFC A;  4JOP A;  4K6Y A;  2KJD A;  1RZX A;  2AWU A;  3ID4 A;  1I16 A;  5HFD A;  4K75 A;  1V5Q A;  2QKT A;  1Z87 A;  2R3Y A;  3MH4 A;  5HFF A;  1X45 A;  1UEQ A;  3WKM A;  4Q2O A;  1Y7N A;  4NMR A;  2REY A;  3K1R A;  1WJL A;  1NTE A;  1Q3O A;  2PZD A;  3SHU A;  2Q3G A;  5GLJ A;  3QGL A;  5HET A;  3EGH C;  1OBZ A;  2H3M A;  2KJP A;  1P1D A;  2K20 A;  3SFJ A;  4K76 A;  4Q2P A;  5DTH A;  1WH1 A;  2MHO A;  4N6X A;  2M0Z A;  1WHD A;  1Y8T A;  2F5Y A;  4UU6 A;  2IWN A;  1GQ4 A;  2Q9V A;  3B76 A;  1WFV A;  4PQW A;  5HFB A;  1VA8 A;  4NMO A;  3OU0 A;  1VCW A;  1L6O A;  4F8K A;  1WI2 A;  2M3M A;  2KV8 A;  1UM7 A;  2DMZ A;  5HFE A;  5HEB A;  5E21 A;  2PA1 A;  3GCO A;  1I92 A;  1Z86 A;  3O5N A;  5G1E A;  5HF1 A;  2EEJ A;  3ID2 A;  4O06 A;  3FY5 A;  2HE4 A;  1FCF A;  3NGH A;  1UJD A;  2OPG A;  2LC6 A;  1BE9 A;  2I1N A;  3HPM A;  2M0U A;  3SOE A;  2L4S A;  3DOR A;  1WI4 A;  3K82 A;  4HOP A;  2VWR A;  2KJK A;  3NFL A;  2EEI A;  2PNT A;  2KYL A;  2JIN A;  3RL8 A;  2UZC A;  3GJ9 A;  2OZF A;  2CSS A;  1FC6 A;  3E17 A;  4E35 A;  2EJY A;  3QIK A;  2KBS A;  2D92 A;  2KAW A;  1KWA A;  4P0C A;  2EGK A;  3PV2 A;  1D5G A;  2JRE A;  2G2L A;  2EXG A;  3CYY A;  2QKV A;  2LUI A;  4Q6H A;  1N7F A;  2L97 A;  3GGE A;  2FCF A;  5GND A;  2JOA A;  2CS5 A;  1QAV A;  1W9E A; 
#chains in the Genus database with same CATH topology
 3HVQ C;  2GZV A;  2VRF A;  1WG6 A;  2AIN A;  2RCZ A;  3TSW A;  1B8Q A;  1U3B A;  5E1Y A;  5F3X A;  4GVC A;  4L8N A;  3R68 A;  2H2B A;  3ID1 A;  2V1W A;  3BPU A;  3KZD A;  3HPK A;  2R4H A;  5I7Z A;  3GSL A;  4H11 A;  2DLS A;  5A2P A;  2YUB A;  4JOH A;  1X6D A;  2CSJ A;  2HE2 A;  1R6J A;  2X7Z A;  1WF7 A;  3GAB A;  1X9Z A;  4Q2Q A;  2EEH A;  1V6B A;  4K78 A;  4R2Z A;  5E11 A;  4LMM A;  1Q7X A;  1XZ9 A;  5G1D A;  2QKU A;  3TSZ A;  2W7R A;  2I6V A;  3MH6 A;  2OMJ A;  2FE5 A;  1QAU A;  2DB5 A;  2QBW A;  4HOP B;  2M0V A;  1X8S A;  2DM8 A;  3AXA A;  4GVD A;  5HF4 A;  2H2C A;  4K72 A;  2QT5 A;  1FC9 A;  4E34 A;  1VJ6 A;  3O46 A;  1RGW A;  1X5R A;  5EYZ A;  2EDZ A;  3GDV A;  2KPL A;  5ILB A;  1NF3 C;  2KA9 A;  3TMH A;  5EZ0 A;  2KPK A;  4WYT A;  2RRM A;  2KL1 A;  4NNL A;  4JOJ A;  3DJ3 A;  1UEW A;  3CBY A;  4YDP A;  3NCV A;  4JJ3 A;  1N7T A;  2H3L A;  2EGN A;  4NMQ A;  1KY9 A;  2Z9I A;  1TQ3 A;  1X5Q A;  1MC7 A;  4FGM A;  1X5N A;  3OTP A;  1T2M A;  1UHP A;  2LC7 A;  3TSV A;  2VSP A;  4UU5 A;  2DJT A;  4JOF A;  4KFW A;  1OZI A;  2DKR A;  1OBY A;  2BYG A;  1QAV B;  2EHR A;  1LCY A;  2VSV A;  3I18 A;  2E7K A;  3SUZ A;  1SOZ A;  2LOB A;  3LNX A;  2AWW A;  2F0A A;  2KRG A;  2EV8 A;  4YYX A;  2JIK A;  2IWQ A;  3ZRT A;  3EGG C;  2FN5 A;  1N6F A;  3NFK A;  3I1E A;  1W9O A;  4NXR A;  1U39 A;  2M10 A;  3K50 A;  3ID3 A;  2VPH A;  2VZ5 A;  2AWX A;  4NMV A;  1WIF A;  4E3B A;  5HEY A;  1UM1 A;  3RL7 A;  5JXB A;  4JL7 A;  2P3W A;  2I04 A;  2OSG A;  3PS4 A;  3R69 A;  1QLC A;  3QJN A;  5F67 A;  4P2A B;  1FC7 A;  1N6E A;  1Q3P A;  2Z17 A;  5E6P B;  1MFG A;  3I4W A;  2WL7 A;  3CC0 A;  1YBO A;  2KQF A;  4FLN A;  2IWO A;  2PKU A;  1V5L A;  2I4S A;  3DJA A;  3QE1 A;  3GCN A;  2JWE A;  4XHV A;  1GQ5 A;  1OBX A;  2V90 A;  1UF1 A;  3MH7 A;  3GDU A;  1SOT A;  5B6L A;  2OS6 A;  3CBZ A;  5H3J A;  1N6D A;  1UJV A;  3CS0 A;  1UEZ A;  3RLE A;  2DC2 A;  1VB7 A;  2QG1 A;  4OEO A;  2YUY A;  1TP5 A;  3KHF A;  4JOE A;  2EDP A;  1PDR A;  2MX6 A;  3DIW A;  3PDZ A;  4AMH A;  1U38 A;  4KFV A;  2I0L A;  2KOM A;  4NMS A;  2PDZ A;  1MFL A;  3DJ1 A;  1BFE A;  2PKT A;  4REY A;  3LNY A;  2JXO A;  2OCS A;  2W4F A;  3CH8 A;  1N99 A;  2O2T A;  3PV4 A;  3CBX A;  3PV5 A;  2LA8 A;  4Q6S A;  3QJM A;  2KOJ A;  1KEF A;  1K32 A;  2ZPL A;  4GHN A;  2L4T A;  3KDK A;  4Z8J A;  1WF8 A;  4RI0 A;  2D8I A;  2FNE A;  4G69 A;  5FB8 C;  2ENO A;  1WHA A;  2G5M B;  3VQF A;  4Z33 A;  3R0H A;  1G9O A;  5E22 A;  2DAZ A;  1UFX A;  1ZOK A;  1IHJ A;  4NXP A;  1N7E A;  1P1E A;  1ZUB A;  5FHT A;  1V1T A;  3STJ A;  3WKL A;  3QDO A;  2D90 A;  2OQS A;  4JOG A;  2EAQ A;  2IWP A;  2KG2 A;  4MPA A;  1IU0 A;  4JOR A;  1TE0 A;  4OAJ A;  3VQG A;  1RGR A;  4IC6 A;  2EEG A;  2K1Z A;  1GM1 A;  2ZPM A;  1W9Q A;  2YTW A;  4JOK A;  2KOH A;  5D13 A;  3KDG A;  1RY4 A;  2DLU A;  2M0T A;  1UEP A;  1VAE A;  2HGA A;  2OGP A;  2EDV A;  4WYU A;  3JXT A;  1V62 A;  2YT7 A;  4NMT A;  1IU2 A;  3QO6 A;  4NNM A;  5HDY A;  1WFG A;  2I0I A;  2EGO A;  1TP3 A;  4Q2N A;  5HED A;  1U37 A;  3L4F D;  1UIT A;  2YT8 A;  4Q3H A;  5HJ1 A;  4EDJ A;  4OEP A;  3GDS A;  1M5Z A;  4NMP A;  3PDV A;  3KZE A;  4NXQ A;  3SHW A;  2JIL A;  1UJU A;  5HFC A;  4JOP A;  4K6Y A;  2JSN A;  2KJD A;  1RZX A;  2AWU A;  3ID4 A;  1I16 A;  5HFD A;  4K75 A;  1V5Q A;  2QKT A;  1Z87 A;  2R3Y A;  3MH4 A;  5HFF A;  1X45 A;  1UEQ A;  3WKM A;  4Q2O A;  1Y7N A;  4NMR A;  5IL9 A;  2REY A;  3K1R A;  1WJL A;  1NTE A;  1Q3O A;  2PZD A;  3SHU A;  2Q3G A;  5GLJ A;  3QGL A;  5HET A;  4JJ0 A;  3EGH C;  1OBZ A;  2H3M A;  2KJP A;  1P1D A;  2K20 A;  3SFJ A;  4K76 A;  4Q2P A;  5DTH A;  1WH1 A;  2MHO A;  4N6X A;  2M0Z A;  1WHD A;  1Y8T A;  2F5Y A;  4UU6 A;  2IWN A;  1GQ4 A;  2Q9V A;  3B76 A;  1WFV A;  4PQW A;  5HFB A;  1VA8 A;  4NMO A;  2GEF A;  3OU0 A;  1VCW A;  1L6O A;  4F8K A;  1WI2 A;  2M3M A;  2KV8 A;  1UM7 A;  2DMZ A;  5HFE A;  5HEB A;  5E21 A;  2PA1 A;  3GCO A;  1I92 A;  1Z86 A;  3O5N A;  5G1E A;  5HF1 A;  2EEJ A;  3ID2 A;  4O06 A;  3FY5 A;  2HE4 A;  1FCF A;  3NGH A;  1UJD A;  2OPG A;  2LC6 A;  1BE9 A;  2I1N A;  3HPM A;  2M0U A;  3SOE A;  2L4S A;  3DOR A;  1WI4 A;  3K82 A;  4HOP A;  2VWR A;  2KJK A;  3NFL A;  2EEI A;  2PNT A;  2KYL A;  2JIN A;  3RL8 A;  2UZC A;  3GJ9 A;  5B42 A;  2OZF A;  2CSS A;  1FC6 A;  3E17 A;  4E35 A;  2EJY A;  3QIK A;  2KBS A;  2D92 A;  2KAW A;  1KWA A;  4P0C A;  2EGK A;  3PV2 A;  1D5G A;  2JRE A;  2G2L A;  2EXG A;  3CYY A;  2QKV A;  2LUI A;  4Q6H A;  1N7F A;  2L97 A;  3GGE A;  2FCF A;  5GND A;  2JOA A;  2CS5 A;  1QAV A;  1W9E A; 
#chains in the Genus database with same CATH homology
 3HVQ C;  2GZV A;  2VRF A;  1WG6 A;  2AIN A;  2RCZ A;  3TSW A;  1B8Q A;  1U3B A;  5E1Y A;  5F3X A;  4GVC A;  4L8N A;  3R68 A;  2H2B A;  3ID1 A;  2V1W A;  3BPU A;  3KZD A;  3HPK A;  2R4H A;  5I7Z A;  3GSL A;  4H11 A;  2DLS A;  5A2P A;  2YUB A;  4JOH A;  1X6D A;  2CSJ A;  2HE2 A;  1R6J A;  2X7Z A;  1WF7 A;  3GAB A;  1X9Z A;  4Q2Q A;  2EEH A;  1V6B A;  4K78 A;  4R2Z A;  5E11 A;  4LMM A;  1Q7X A;  1XZ9 A;  5G1D A;  2QKU A;  3TSZ A;  2W7R A;  2I6V A;  3MH6 A;  2OMJ A;  2FE5 A;  1QAU A;  2DB5 A;  2QBW A;  4HOP B;  2M0V A;  1X8S A;  2DM8 A;  3AXA A;  4GVD A;  5HF4 A;  2H2C A;  4K72 A;  2QT5 A;  1FC9 A;  4E34 A;  1VJ6 A;  3O46 A;  1RGW A;  1X5R A;  5EYZ A;  2EDZ A;  3GDV A;  2KPL A;  5ILB A;  1NF3 C;  2KA9 A;  3TMH A;  5EZ0 A;  2KPK A;  4WYT A;  2RRM A;  2KL1 A;  4NNL A;  4JOJ A;  3DJ3 A;  1UEW A;  3CBY A;  4YDP A;  3NCV A;  4JJ3 A;  1N7T A;  2H3L A;  2EGN A;  4NMQ A;  1KY9 A;  2Z9I A;  1TQ3 A;  1X5Q A;  1MC7 A;  4FGM A;  1X5N A;  3OTP A;  1T2M A;  1UHP A;  2LC7 A;  3TSV A;  2VSP A;  4UU5 A;  2DJT A;  4JOF A;  4KFW A;  1OZI A;  2DKR A;  1OBY A;  2BYG A;  1QAV B;  2EHR A;  1LCY A;  2VSV A;  3I18 A;  2E7K A;  3SUZ A;  1SOZ A;  2LOB A;  3LNX A;  2AWW A;  2F0A A;  2KRG A;  2EV8 A;  4YYX A;  2JIK A;  2IWQ A;  3ZRT A;  3EGG C;  2FN5 A;  1N6F A;  3NFK A;  3I1E A;  1W9O A;  4NXR A;  1U39 A;  2M10 A;  3K50 A;  3ID3 A;  2VPH A;  2VZ5 A;  2AWX A;  4NMV A;  1WIF A;  4E3B A;  5HEY A;  1UM1 A;  3RL7 A;  5JXB A;  4JL7 A;  2P3W A;  2I04 A;  2OSG A;  3PS4 A;  3R69 A;  1QLC A;  3QJN A;  5F67 A;  4P2A B;  1FC7 A;  1N6E A;  1Q3P A;  2Z17 A;  5E6P B;  1MFG A;  3I4W A;  2WL7 A;  3CC0 A;  1YBO A;  2KQF A;  4FLN A;  2IWO A;  2PKU A;  1V5L A;  2I4S A;  3DJA A;  3QE1 A;  3GCN A;  2JWE A;  4XHV A;  1GQ5 A;  1OBX A;  2V90 A;  1UF1 A;  3MH7 A;  3GDU A;  1SOT A;  5B6L A;  2OS6 A;  3CBZ A;  5H3J A;  1N6D A;  1UJV A;  3CS0 A;  1UEZ A;  3RLE A;  2DC2 A;  1VB7 A;  2QG1 A;  4OEO A;  2YUY A;  1TP5 A;  3KHF A;  4JOE A;  2EDP A;  1PDR A;  2MX6 A;  3DIW A;  3PDZ A;  4AMH A;  1U38 A;  4KFV A;  2I0L A;  2KOM A;  4NMS A;  2PDZ A;  1MFL A;  3DJ1 A;  1BFE A;  2PKT A;  4REY A;  3LNY A;  2JXO A;  2OCS A;  2W4F A;  3CH8 A;  1N99 A;  2O2T A;  3PV4 A;  3CBX A;  3PV5 A;  2LA8 A;  4Q6S A;  3QJM A;  2KOJ A;  1KEF A;  1K32 A;  2ZPL A;  4GHN A;  2L4T A;  3KDK A;  4Z8J A;  1WF8 A;  4RI0 A;  2D8I A;  2FNE A;  4G69 A;  5FB8 C;  2ENO A;  1WHA A;  2G5M B;  3VQF A;  4Z33 A;  3R0H A;  1G9O A;  5E22 A;  2DAZ A;  1UFX A;  1ZOK A;  1IHJ A;  4NXP A;  1N7E A;  1P1E A;  1ZUB A;  5FHT A;  1V1T A;  3STJ A;  3WKL A;  3QDO A;  2D90 A;  2OQS A;  4JOG A;  2EAQ A;  2IWP A;  2KG2 A;  4MPA A;  1IU0 A;  4JOR A;  1TE0 A;  4OAJ A;  3VQG A;  1RGR A;  4IC6 A;  2EEG A;  2K1Z A;  1GM1 A;  2ZPM A;  1W9Q A;  2YTW A;  4JOK A;  2KOH A;  5D13 A;  3KDG A;  1RY4 A;  2DLU A;  2M0T A;  1UEP A;  1VAE A;  2HGA A;  2OGP A;  2EDV A;  4WYU A;  3JXT A;  1V62 A;  2YT7 A;  4NMT A;  1IU2 A;  3QO6 A;  4NNM A;  5HDY A;  1WFG A;  2I0I A;  2EGO A;  1TP3 A;  4Q2N A;  5HED A;  1U37 A;  3L4F D;  1UIT A;  2YT8 A;  4Q3H A;  5HJ1 A;  4EDJ A;  4OEP A;  3GDS A;  1M5Z A;  4NMP A;  3PDV A;  3KZE A;  4NXQ A;  3SHW A;  2JIL A;  1UJU A;  5HFC A;  4JOP A;  4K6Y A;  2JSN A;  2KJD A;  1RZX A;  2AWU A;  3ID4 A;  1I16 A;  5HFD A;  4K75 A;  1V5Q A;  2QKT A;  1Z87 A;  2R3Y A;  3MH4 A;  5HFF A;  1X45 A;  1UEQ A;  3WKM A;  4Q2O A;  1Y7N A;  4NMR A;  5IL9 A;  2REY A;  3K1R A;  1WJL A;  1NTE A;  1Q3O A;  2PZD A;  3SHU A;  2Q3G A;  5GLJ A;  3QGL A;  5HET A;  4JJ0 A;  3EGH C;  1OBZ A;  2H3M A;  2KJP A;  1P1D A;  2K20 A;  3SFJ A;  4K76 A;  4Q2P A;  5DTH A;  1WH1 A;  2MHO A;  4N6X A;  2M0Z A;  1WHD A;  1Y8T A;  2F5Y A;  4UU6 A;  2IWN A;  1GQ4 A;  2Q9V A;  3B76 A;  1WFV A;  4PQW A;  5HFB A;  1VA8 A;  4NMO A;  2GEF A;  3OU0 A;  1VCW A;  1L6O A;  4F8K A;  1WI2 A;  2M3M A;  2KV8 A;  1UM7 A;  2DMZ A;  5HFE A;  5HEB A;  5E21 A;  2PA1 A;  3GCO A;  1I92 A;  1Z86 A;  3O5N A;  5G1E A;  5HF1 A;  2EEJ A;  3ID2 A;  4O06 A;  3FY5 A;  2HE4 A;  1FCF A;  3NGH A;  1UJD A;  2OPG A;  2LC6 A;  1BE9 A;  2I1N A;  3HPM A;  2M0U A;  3SOE A;  2L4S A;  3DOR A;  1WI4 A;  3K82 A;  4HOP A;  2VWR A;  2KJK A;  3NFL A;  2EEI A;  2PNT A;  2KYL A;  2JIN A;  3RL8 A;  2UZC A;  3GJ9 A;  5B42 A;  2OZF A;  2CSS A;  1FC6 A;  3E17 A;  4E35 A;  2EJY A;  3QIK A;  2KBS A;  2D92 A;  2KAW A;  1KWA A;  4P0C A;  2EGK A;  3PV2 A;  1D5G A;  2JRE A;  2G2L A;  2EXG A;  3CYY A;  2QKV A;  2LUI A;  4Q6H A;  1N7F A;  2L97 A;  3GGE A;  2FCF A;  5GND A;  2JOA A;  2CS5 A;  1QAV A;  1W9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...