1BE9A

The third pdz domain from the synaptic protein psd-95 in complex with a c-terminal peptide derived from cript.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PSD-95
publication title Crystal structures of a complexed and peptide-free membrane protein-binding domain: molecular basis of peptide recognition by PDZ.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Peptide recognition
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 1998-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1be9A00
2EEHA 1I16A 2Q9VA 2UZCA 5GNDA 4RI0A 3AXAA 1M5ZA 2H2BA 2GZVA 3QE1A 2RCZA 1OZIA 2DKRA 3L4FD 1YBOA 2D90A 2Z9IA 1BE9A 2F5YA 2I0LA 2YTWA 1KY9A 1Q3OA 2L4SA 2YUYA 3CBYA 2HGAA 2KJPA 3SOEA 5HFDA 2HE4A 1X8SA 2EV8A 2OGPA 3KZDA 2F0AA 3JXTA 4OAJA 5E1YA 2QG1A 5E22A 2R3YA 3E17A 2EAQA 1GM1A 2YUBA 2FNEA 1V6BA 1WHAA 2IWQA 3PV5A 2MX6A 2VSVA 4E35A 2Q3GA 3CYYA 3CBXA 3KZEA 2KRGA 1U37A 3QIKA 2L97A 2DLUA 3QJNA 3SUZA 3MH6A 1U38A 3SHWA 4JL7A 5G1EA 2I4SA 2I0IA 2VRFA 4Q2NA 5HFFA 4JOKA 1UFXA 3DJAA 2DJTA 1OBYA 3NFKA 3CH8A 2EGKA 1VA8A 4NMTA 1VB7A 3PV4A 4PQWA 3HVQC 4NXPA 2FN5A 1OBXA 4JOFA 1SOZA 2YT8A 1WF7A 1K32A 1WI2A 2KAWA 1W9OA 1UEZA 4Q2PA 2OQSA 3WKLA 2W4FA 2AWUA 4UU6A 2HE2A 2PZDA 3B76A 4NMRA 5HFEA 2OSGA 2PKTA 4NMQA 2V90A 2O2TA 1RY4A 1N7FA 2LA8A 3R0HA 2DM8A 1X45A 3VQFA 3MH7A 1I92A 1Y8TA 2KA9A 4LMMA 4P0CA 1WFGA 4NMVA 5H3JA 4K6YA 1X6DA 1G9OA 4K75A 4WYTA 5HJ1A 4O06A 1QAUA 3MH4A 1Q3PA 4GHNA 2LOBA 4E3BA 1N6EA 3GDVA 4JOJA 4Z33A 3QO6A 4JOGA 1Z86A 3RLEA 5HF4A 1UJUA 2DMZA 3TMHA 4KFVA 1UJVA 2CSSA 1V5QA 1R6JA 4JOEA 4REYA 2OS6A 1TP3A 4K76A 1OBZA 1N6DA 5A2PA 2REYA 2LC6A 2PKUA 2W7RA 3GDSA 2I6VA 3GSLA 2JREA 1UJDA 1V1TA 5HEBA 3I1EA 1TQ3A 5B6LA 2M0VA 2G5MB 1KWAA 2ZPMA 2FCFA 4F8KA 3GCOA 4IC6A 2L4TA 2LUIA 1MFGA 1IU0A 2KQFA 4EDJA 2MHOA 2KOHA 2AINA 3LNXA 5FB8C 2M0ZA 1TE0A 2JWEA 1X5QA 2AWXA 2M10A 4GVDA 1P1EA 4Q2OA 3DJ3A 5EZ0A 3ZRTA 2M0TA 3EGHC 2CS5A 1D5GA 2KJKA 3K82A 2ENOA 4GVCA 1UM7A 4Q6HA 2EDZA 3CBZA 2V1WA 4G69A 4WYUA 2JINA 3VQGA 1L6OA 2YT7A 2FE5A 1RZXA 5DTHA 1UEQA 2QKUA 3HPKA 4AMHA 2E7KA 2IWPA 2VPHA 2X7ZA 3KHFA 3RL7A 1WG6A 3PS4A 3OTPA 1GQ5A 4NMOA 5D13A 1MFLA 4K78A 3NFLA 1N6FA 2PNTA 2EGOA 4JOHA 2K1ZA 1TP5A 4HOPB 2IWOA 4NNLA 5EYZA 1NTEA 1QAVB 2WL7A 2PA1A 1WI4A 3FY5A 3LNYA 3SHUA 5HFCA 2K20A 2QKTA 4K72A 1W9QA 3QGLA 1N7TA 5E6PB 2EDVA 3PV2A 4OEPA 1V62A 3R68A 4H11A 2P3WA 1WFVA 3K50A 1WJLA 4Q3HA 4XHVA 2G2LA 4P2AB 5JXBA 5HEDA 3TSWA 3ID2A 1MC7A 2DAZA 4UU5A 2CSJA 1GQ4A 4L8NA 2OPGA 2KYLA 1V5LA 3QDOA 2ZPLA 3BPUA 3ID4A 3CS0A 4HOPA 5HETA 1WF8A 1QAVA 5HEYA 2RRMA 5GLJA 2R4HA 2OZFA 1VJ6A 2I04A 2KG2A 2EXGA 1N99A 4N6XA 5E21A 2DB5A 5F3XA 1UF1A 2M0UA 1IU2A 2H3LA 1VCWA 2Z17A 2KOJA 2JILA 4NXRA 1WHDA 4JOPA 2EGNA 3QJMA 3ID1A 3CC0A 1ZOKA 1XZ9A 4NNMA 3RL8A 1RGWA 1WH1A 4YYXA 3DIWA 1UM1A 4NMSA 3GJ9A 3STJA 4Z8JA 2PDZA 1W9EA 3ID3A 2KPLA 1BFEA 1FC7A 4Q6SA 2KL1A 3PDVA 3DJ1A 3GCNA 3O5NA 2D8IA 1N7EA 2IWNA 2EEGA 2JOAA 4R2ZA 3GDUA 1Z87A 1U3BA 4JORA 1VAEA 1FC9A 2EEJA 2JXOA 2LC7A 1P1DA 3OU0A 2VZ5A 1UEWA 1RGRA 1KEFA 3DORA 3EGGC 5HDYA 1QLCA 1FC6A 4MPAA 4NMPA 1UITA 2D92A 1Q7XA 4KFWA 1B8QA 2QT5A 2VSPA 2BYGA 1UHPA 3GGEA 5HFBA 2OMJA 2EJYA 3O46A 3NGHA 2KPKA 4YDPA 5HF1A 1PDRA 3K1RA 3WKMA 2EEIA 2KOMA 1NF3C 2DC2A 3PDZA 2OCSA 2KBSA 3TSVA 4FGMA 5E11A 1LCYA 4Q2QA 5F67A 1SOTA 2JIKA 3I18A 1FCFA 1X5RA 5I7ZA 1ZUBA 2KJDA 3SFJA 1U39A 3I4WA 2AWWA 4OEOA 2I1NA 1IHJA 3TSZA 5FHTA 3HPMA 1Y7NA 1UEPA 2DLSA 1T2MA 2KV8A 2QKVA 2M3MA 2VWRA 2H3MA 2QBWA 2EHRA 4NXQA 4E34A 3R69A 1WIFA 2EDPA 2H2CA 5G1DA 1X5NA
chains in the Genus database with same CATH superfamily
2EEHA 4FLNA 1I16A 2Q9VA 2UZCA 5GNDA 4RI0A 1X9ZA 3AXAA 1M5ZA 2H2BA 2GZVA 3QE1A 2RCZA 1OZIA 2DKRA 3L4FD 1YBOA 2D90A 2Z9IA 1BE9A 2F5YA 2I0LA 2YTWA 1KY9A 1Q3OA 2L4SA 2YUYA 3CBYA 2HGAA 2KJPA 3SOEA 5HFDA 2HE4A 1X8SA 2EV8A 2OGPA 3KZDA 2F0AA 3JXTA 4OAJA 5E1YA 2QG1A 5E22A 2R3YA 3E17A 2EAQA 1GM1A 2YUBA 2FNEA 1V6BA 1WHAA 2IWQA 3PV5A 2MX6A 2VSVA 4E35A 2Q3GA 3CYYA 3CBXA 3KZEA 4JJ3A 2KRGA 1U37A 3QIKA 2L97A 2DLUA 3QJNA 3SUZA 3MH6A 1U38A 3SHWA 4JL7A 5G1EA 2I4SA 2I0IA 2VRFA 4Q2NA 5HFFA 4JOKA 1UFXA 3DJAA 2DJTA 1OBYA 3NFKA 3CH8A 2EGKA 1VA8A 4NMTA 1VB7A 3PV4A 4PQWA 3HVQC 4NXPA 2FN5A 1OBXA 4JOFA 1SOZA 2YT8A 1WF7A 1K32A 1WI2A 2KAWA 1W9OA 1UEZA 4Q2PA 2OQSA 3WKLA 2W4FA 2JSNA 2AWUA 4UU6A 2HE2A 2PZDA 3B76A 4NMRA 5HFEA 2OSGA 2PKTA 4NMQA 2V90A 2O2TA 1RY4A 1N7FA 2LA8A 3R0HA 2DM8A 1X45A 3VQFA 3MH7A 1I92A 1Y8TA 2KA9A 4LMMA 4P0CA 1WFGA 5IL9A 4NMVA 5H3JA 4K6YA 1X6DA 1G9OA 4K75A 4WYTA 5HJ1A 4O06A 1QAUA 3MH4A 1Q3PA 4GHNA 2LOBA 4E3BA 1N6EA 3GDVA 4JOJA 4Z33A 3QO6A 4JOGA 1Z86A 3RLEA 5HF4A 1UJUA 2DMZA 3TMHA 4KFVA 1UJVA 2CSSA 1V5QA 1R6JA 4JOEA 4REYA 2OS6A 1TP3A 4K76A 1OBZA 1N6DA 5A2PA 2REYA 2LC6A 2PKUA 2W7RA 3GDSA 2I6VA 3GSLA 2JREA 1UJDA 1V1TA 5HEBA 3I1EA 1TQ3A 5B6LA 2M0VA 2G5MB 1KWAA 2ZPMA 2FCFA 4F8KA 3GCOA 4IC6A 2L4TA 2LUIA 1MFGA 1IU0A 2KQFA 4EDJA 2MHOA 2KOHA 2AINA 3LNXA 5FB8C 2M0ZA 1TE0A 2JWEA 1X5QA 2AWXA 2M10A 4GVDA 1P1EA 4Q2OA 3DJ3A 5EZ0A 3ZRTA 2M0TA 3EGHC 2CS5A 1D5GA 2KJKA 3K82A 2ENOA 4GVCA 1UM7A 4Q6HA 2EDZA 3CBZA 2V1WA 4G69A 4WYUA 2JINA 3VQGA 1L6OA 2YT7A 2FE5A 1RZXA 5DTHA 1UEQA 2QKUA 3HPKA 4AMHA 2E7KA 2IWPA 3GABA 2VPHA 2X7ZA 3KHFA 3RL7A 1WG6A 3KDGA 3PS4A 3OTPA 1GQ5A 4NMOA 5D13A 1MFLA 4K78A 3NFLA 1N6FA 2PNTA 2EGOA 4JOHA 2K1ZA 1TP5A 4HOPB 2IWOA 4NNLA 5EYZA 1NTEA 1QAVB 2WL7A 2PA1A 1WI4A 3FY5A 3LNYA 3SHUA 5HFCA 2K20A 2QKTA 4K72A 1W9QA 3QGLA 1N7TA 5E6PB 2EDVA 3PV2A 4OEPA 1V62A 3R68A 4H11A 2P3WA 5B42A 1WFVA 3K50A 1WJLA 4Q3HA 4XHVA 2G2LA 4P2AB 5JXBA 5HEDA 3TSWA 3ID2A 1MC7A 2DAZA 4UU5A 2CSJA 1GQ4A 4L8NA 2OPGA 2KYLA 1V5LA 3QDOA 2ZPLA 3BPUA 3ID4A 3CS0A 4HOPA 2GEFA 5HETA 1WF8A 1QAVA 5HEYA 2RRMA 5GLJA 2R4HA 2OZFA 1VJ6A 4JJ0A 2I04A 2KG2A 2EXGA 1N99A 4N6XA 5E21A 2DB5A 3NCVA 1UF1A 5F3XA 2M0UA 1IU2A 2H3LA 5ILBA 1VCWA 2Z17A 2KOJA 2JILA 4NXRA 1WHDA 4JOPA 2EGNA 3QJMA 3ID1A 3CC0A 1ZOKA 1XZ9A 4NNMA 3RL8A 1RGWA 1WH1A 4YYXA 3DIWA 1UM1A 4NMSA 3GJ9A 3STJA 4Z8JA 2PDZA 1W9EA 3ID3A 2KPLA 1BFEA 1FC7A 4Q6SA 2KL1A 3PDVA 3DJ1A 3GCNA 3O5NA 2D8IA 1N7EA 2IWNA 2EEGA 2JOAA 4R2ZA 3GDUA 1Z87A 1U3BA 4JORA 1VAEA 3KDKA 1FC9A 2EEJA 2JXOA 2LC7A 1P1DA 3OU0A 2VZ5A 1UEWA 1RGRA 1KEFA 3DORA 3EGGC 5HDYA 1QLCA 1FC6A 4MPAA 4NMPA 1UITA 2D92A 1Q7XA 4KFWA 1B8QA 2QT5A 2VSPA 2BYGA 1UHPA 3GGEA 5HFBA 2OMJA 2EJYA 3O46A 3NGHA 2KPKA 4YDPA 5HF1A 1PDRA 3K1RA 3WKMA 2EEIA 2KOMA 1NF3C 2DC2A 3PDZA 2OCSA 2KBSA 3TSVA 4FGMA 5E11A 1LCYA 4Q2QA 5F67A 1SOTA 2JIKA 3I18A 1FCFA 1X5RA 5I7ZA 1ZUBA 2KJDA 3SFJA 1U39A 3I4WA 2AWWA 4OEOA 2I1NA 1IHJA 3TSZA 5FHTA 3HPMA 1Y7NA 1UEPA 2DLSA 1T2MA 2KV8A 2QKVA 2M3MA 2VWRA 2H3MA 2QBWA 2EHRA 4NXQA 4E34A 3R69A 1WIFA 2EDPA 2H2CA 5G1DA 1X5NA
chains in the Genus database with same CATH topology
2EEHA 4FLNA 1I16A 2Q9VA 2UZCA 5GNDA 4RI0A 1X9ZA 3AXAA 1M5ZA 2H2BA 2GZVA 3QE1A 2RCZA 1OZIA 2DKRA 3L4FD 1YBOA 2D90A 2Z9IA 1BE9A 2F5YA 2I0LA 2YTWA 1KY9A 1Q3OA 2L4SA 2YUYA 3CBYA 2HGAA 2KJPA 3SOEA 5HFDA 2HE4A 1X8SA 2EV8A 2OGPA 3KZDA 2F0AA 3JXTA 4OAJA 5E1YA 2QG1A 5E22A 2R3YA 3E17A 2EAQA 1GM1A 2YUBA 2FNEA 1V6BA 1WHAA 2IWQA 3PV5A 2MX6A 2VSVA 4E35A 2Q3GA 3CYYA 3CBXA 3KZEA 4JJ3A 2KRGA 1U37A 3QIKA 2L97A 2DLUA 3QJNA 3SUZA 3MH6A 1U38A 3SHWA 4JL7A 5G1EA 2I4SA 2I0IA 2VRFA 4Q2NA 5HFFA 4JOKA 1UFXA 3DJAA 2DJTA 1OBYA 3NFKA 3CH8A 2EGKA 1VA8A 4NMTA 1VB7A 3PV4A 4PQWA 3HVQC 4NXPA 2FN5A 1OBXA 4JOFA 1SOZA 2YT8A 1WF7A 1K32A 1WI2A 2KAWA 1W9OA 1UEZA 4Q2PA 2OQSA 3WKLA 2W4FA 2JSNA 2AWUA 4UU6A 2HE2A 2PZDA 3B76A 4NMRA 5HFEA 2OSGA 2PKTA 4NMQA 2V90A 2O2TA 1RY4A 1N7FA 2LA8A 3R0HA 2DM8A 1X45A 3VQFA 3MH7A 1I92A 1Y8TA 2KA9A 4LMMA 4P0CA 1WFGA 5IL9A 4NMVA 5H3JA 4K6YA 1X6DA 1G9OA 4K75A 4WYTA 5HJ1A 4O06A 1QAUA 3MH4A 1Q3PA 4GHNA 2LOBA 4E3BA 1N6EA 3GDVA 4JOJA 4Z33A 3QO6A 4JOGA 1Z86A 3RLEA 5HF4A 1UJUA 2DMZA 3TMHA 4KFVA 1UJVA 2CSSA 1V5QA 1R6JA 4JOEA 4REYA 2OS6A 1TP3A 4K76A 1OBZA 1N6DA 5A2PA 2REYA 2LC6A 2PKUA 2W7RA 3GDSA 2I6VA 3GSLA 2JREA 1UJDA 1V1TA 5HEBA 3I1EA 1TQ3A 5B6LA 2M0VA 2G5MB 1KWAA 2ZPMA 2FCFA 4F8KA 3GCOA 4IC6A 2L4TA 2LUIA 1MFGA 1IU0A 2KQFA 4EDJA 2MHOA 2KOHA 2AINA 3LNXA 5FB8C 2M0ZA 1TE0A 2JWEA 1X5QA 2AWXA 2M10A 4GVDA 1P1EA 4Q2OA 3DJ3A 5EZ0A 3ZRTA 2M0TA 3EGHC 2CS5A 1D5GA 2KJKA 3K82A 2ENOA 4GVCA 1UM7A 4Q6HA 2EDZA 3CBZA 2V1WA 4G69A 4WYUA 2JINA 3VQGA 1L6OA 2YT7A 2FE5A 1RZXA 5DTHA 1UEQA 2QKUA 3HPKA 4AMHA 2E7KA 2IWPA 3GABA 2VPHA 2X7ZA 3KHFA 3RL7A 1WG6A 3KDGA 3PS4A 3OTPA 1GQ5A 4NMOA 5D13A 1MFLA 4K78A 3NFLA 1N6FA 2PNTA 2EGOA 4JOHA 2K1ZA 1TP5A 4HOPB 2IWOA 4NNLA 5EYZA 1NTEA 1QAVB 2WL7A 2PA1A 1WI4A 3FY5A 3LNYA 3SHUA 5HFCA 2K20A 2QKTA 4K72A 1W9QA 3QGLA 1N7TA 5E6PB 2EDVA 3PV2A 4OEPA 1V62A 3R68A 4H11A 2P3WA 5B42A 1WFVA 3K50A 1WJLA 4Q3HA 4XHVA 2G2LA 4P2AB 5JXBA 5HEDA 3TSWA 3ID2A 1MC7A 2DAZA 4UU5A 2CSJA 1GQ4A 4L8NA 2OPGA 2KYLA 1V5LA 3QDOA 2ZPLA 3BPUA 3ID4A 3CS0A 4HOPA 2GEFA 5HETA 1WF8A 1QAVA 5HEYA 2RRMA 5GLJA 2R4HA 2OZFA 1VJ6A 4JJ0A 2I04A 2KG2A 2EXGA 1N99A 4N6XA 5E21A 2DB5A 3NCVA 1UF1A 5F3XA 2M0UA 1IU2A 2H3LA 5ILBA 1VCWA 2Z17A 2KOJA 2JILA 4NXRA 1WHDA 4JOPA 2EGNA 3QJMA 3ID1A 3CC0A 1ZOKA 1XZ9A 4NNMA 3RL8A 1RGWA 1WH1A 4YYXA 3DIWA 1UM1A 4NMSA 3GJ9A 3STJA 4Z8JA 2PDZA 1W9EA 3ID3A 2KPLA 1BFEA 1FC7A 4Q6SA 2KL1A 3PDVA 3DJ1A 3GCNA 3O5NA 2D8IA 1N7EA 2IWNA 2EEGA 2JOAA 4R2ZA 3GDUA 1Z87A 1U3BA 4JORA 1VAEA 3KDKA 1FC9A 2EEJA 2JXOA 2LC7A 1P1DA 3OU0A 2VZ5A 1UEWA 1RGRA 1KEFA 3DORA 3EGGC 5HDYA 1QLCA 1FC6A 4MPAA 4NMPA 1UITA 2D92A 1Q7XA 4KFWA 1B8QA 2QT5A 2VSPA 2BYGA 1UHPA 3GGEA 5HFBA 2OMJA 2EJYA 3O46A 3NGHA 2KPKA 4YDPA 5HF1A 1PDRA 3K1RA 3WKMA 2EEIA 2KOMA 1NF3C 2DC2A 3PDZA 2OCSA 2KBSA 3TSVA 4FGMA 5E11A 1LCYA 4Q2QA 5F67A 1SOTA 2JIKA 3I18A 1FCFA 1X5RA 5I7ZA 1ZUBA 2KJDA 3SFJA 1U39A 3I4WA 2AWWA 4OEOA 2I1NA 1IHJA 3TSZA 5FHTA 3HPMA 1Y7NA 1UEPA 2DLSA 1T2MA 2KV8A 2QKVA 2M3MA 2VWRA 2H3MA 2QBWA 2EHRA 4NXQA 4E34A 3R69A 1WIFA 2EDPA 2H2CA 5G1DA 1X5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EEH A;  1I16 A;  2Q9V A;  2UZC A;  5GND A;  4RI0 A;  3AXA A;  1M5Z A;  2H2B A;  2GZV A;  3QE1 A;  2RCZ A;  1OZI A;  2DKR A;  3L4F D;  1YBO A;  2D90 A;  2Z9I A;  1BE9 A;  2F5Y A;  2I0L A;  2YTW A;  1KY9 A;  1Q3O A;  2L4S A;  2YUY A;  3CBY A;  2HGA A;  2KJP A;  3SOE A;  5HFD A;  2HE4 A;  1X8S A;  2EV8 A;  2OGP A;  3KZD A;  2F0A A;  3JXT A;  4OAJ A;  5E1Y A;  2QG1 A;  5E22 A;  2R3Y A;  3E17 A;  2EAQ A;  1GM1 A;  2YUB A;  2FNE A;  1V6B A;  1WHA A;  2IWQ A;  3PV5 A;  2MX6 A;  2VSV A;  4E35 A;  2Q3G A;  3CYY A;  3CBX A;  3KZE A;  2KRG A;  1U37 A;  3QIK A;  2L97 A;  2DLU A;  3QJN A;  3SUZ A;  3MH6 A;  1U38 A;  3SHW A;  4JL7 A;  5G1E A;  2I4S A;  2I0I A;  2VRF A;  4Q2N A;  5HFF A;  4JOK A;  1UFX A;  3DJA A;  2DJT A;  1OBY A;  3NFK A;  3CH8 A;  2EGK A;  1VA8 A;  4NMT A;  1VB7 A;  3PV4 A;  4PQW A;  3HVQ C;  4NXP A;  2FN5 A;  1OBX A;  4JOF A;  1SOZ A;  2YT8 A;  1WF7 A;  1K32 A;  1WI2 A;  2KAW A;  1W9O A;  1UEZ A;  4Q2P A;  2OQS A;  3WKL A;  2W4F A;  2AWU A;  4UU6 A;  2HE2 A;  2PZD A;  3B76 A;  4NMR A;  5HFE A;  2OSG A;  2PKT A;  4NMQ A;  2V90 A;  2O2T A;  1RY4 A;  1N7F A;  2LA8 A;  3R0H A;  2DM8 A;  1X45 A;  3VQF A;  3MH7 A;  1I92 A;  1Y8T A;  2KA9 A;  4LMM A;  4P0C A;  1WFG A;  4NMV A;  5H3J A;  4K6Y A;  1X6D A;  1G9O A;  4K75 A;  4WYT A;  5HJ1 A;  4O06 A;  1QAU A;  3MH4 A;  1Q3P A;  4GHN A;  2LOB A;  4E3B A;  1N6E A;  3GDV A;  4JOJ A;  4Z33 A;  3QO6 A;  4JOG A;  1Z86 A;  3RLE A;  5HF4 A;  1UJU A;  2DMZ A;  3TMH A;  4KFV A;  1UJV A;  2CSS A;  1V5Q A;  1R6J A;  4JOE A;  4REY A;  2OS6 A;  1TP3 A;  4K76 A;  1OBZ A;  1N6D A;  5A2P A;  2REY A;  2LC6 A;  2PKU A;  2W7R A;  3GDS A;  2I6V A;  3GSL A;  2JRE A;  1UJD A;  1V1T A;  5HEB A;  3I1E A;  1TQ3 A;  5B6L A;  2M0V A;  2G5M B;  1KWA A;  2ZPM A;  2FCF A;  4F8K A;  3GCO A;  4IC6 A;  2L4T A;  2LUI A;  1MFG A;  1IU0 A;  2KQF A;  4EDJ A;  2MHO A;  2KOH A;  2AIN A;  3LNX A;  5FB8 C;  2M0Z A;  1TE0 A;  2JWE A;  1X5Q A;  2AWX A;  2M10 A;  4GVD A;  1P1E A;  4Q2O A;  3DJ3 A;  5EZ0 A;  3ZRT A;  2M0T A;  3EGH C;  2CS5 A;  1D5G A;  2KJK A;  3K82 A;  2ENO A;  4GVC A;  1UM7 A;  4Q6H A;  2EDZ A;  3CBZ A;  2V1W A;  4G69 A;  4WYU A;  2JIN A;  3VQG A;  1L6O A;  2YT7 A;  2FE5 A;  1RZX A;  5DTH A;  1UEQ A;  2QKU A;  3HPK A;  4AMH A;  2E7K A;  2IWP A;  2VPH A;  2X7Z A;  3KHF A;  3RL7 A;  1WG6 A;  3PS4 A;  3OTP A;  1GQ5 A;  4NMO A;  5D13 A;  1MFL A;  4K78 A;  3NFL A;  1N6F A;  2PNT A;  2EGO A;  4JOH A;  2K1Z A;  1TP5 A;  4HOP B;  2IWO A;  4NNL A;  5EYZ A;  1NTE A;  1QAV B;  2WL7 A;  2PA1 A;  1WI4 A;  3FY5 A;  3LNY A;  3SHU A;  5HFC A;  2K20 A;  2QKT A;  4K72 A;  1W9Q A;  3QGL A;  1N7T A;  5E6P B;  2EDV A;  3PV2 A;  4OEP A;  1V62 A;  3R68 A;  4H11 A;  2P3W A;  1WFV A;  3K50 A;  1WJL A;  4Q3H A;  4XHV A;  2G2L A;  4P2A B;  5JXB A;  5HED A;  3TSW A;  3ID2 A;  1MC7 A;  2DAZ A;  4UU5 A;  2CSJ A;  1GQ4 A;  4L8N A;  2OPG A;  2KYL A;  1V5L A;  3QDO A;  2ZPL A;  3BPU A;  3ID4 A;  3CS0 A;  4HOP A;  5HET A;  1WF8 A;  1QAV A;  5HEY A;  2RRM A;  5GLJ A;  2R4H A;  2OZF A;  1VJ6 A;  2I04 A;  2KG2 A;  2EXG A;  1N99 A;  4N6X A;  5E21 A;  2DB5 A;  5F3X A;  1UF1 A;  2M0U A;  1IU2 A;  2H3L A;  1VCW A;  2Z17 A;  2KOJ A;  2JIL A;  4NXR A;  1WHD A;  4JOP A;  2EGN A;  3QJM A;  3ID1 A;  3CC0 A;  1ZOK A;  1XZ9 A;  4NNM A;  3RL8 A;  1RGW A;  1WH1 A;  4YYX A;  3DIW A;  1UM1 A;  4NMS A;  3GJ9 A;  3STJ A;  4Z8J A;  2PDZ A;  1W9E A;  3ID3 A;  2KPL A;  1BFE A;  1FC7 A;  4Q6S A;  2KL1 A;  3PDV A;  3DJ1 A;  3GCN A;  3O5N A;  2D8I A;  1N7E A;  2IWN A;  2EEG A;  2JOA A;  4R2Z A;  3GDU A;  1Z87 A;  1U3B A;  4JOR A;  1VAE A;  1FC9 A;  2EEJ A;  2JXO A;  2LC7 A;  1P1D A;  3OU0 A;  2VZ5 A;  1UEW A;  1RGR A;  1KEF A;  3DOR A;  3EGG C;  5HDY A;  1QLC A;  1FC6 A;  4MPA A;  4NMP A;  1UIT A;  2D92 A;  1Q7X A;  4KFW A;  1B8Q A;  2QT5 A;  2VSP A;  2BYG A;  1UHP A;  3GGE A;  5HFB A;  2OMJ A;  2EJY A;  3O46 A;  3NGH A;  2KPK A;  4YDP A;  5HF1 A;  1PDR A;  3K1R A;  3WKM A;  2EEI A;  2KOM A;  1NF3 C;  2DC2 A;  3PDZ A;  2OCS A;  2KBS A;  3TSV A;  4FGM A;  5E11 A;  1LCY A;  4Q2Q A;  5F67 A;  1SOT A;  2JIK A;  3I18 A;  1FCF A;  1X5R A;  5I7Z A;  1ZUB A;  2KJD A;  3SFJ A;  1U39 A;  3I4W A;  2AWW A;  4OEO A;  2I1N A;  1IHJ A;  3TSZ A;  5FHT A;  3HPM A;  1Y7N A;  1UEP A;  2DLS A;  1T2M A;  2KV8 A;  2QKV A;  2M3M A;  2VWR A;  2H3M A;  2QBW A;  2EHR A;  4NXQ A;  4E34 A;  3R69 A;  1WIF A;  2EDP A;  2H2C A;  5G1D A;  1X5N A; 
#chains in the Genus database with same CATH topology
 2EEH A;  4FLN A;  1I16 A;  2Q9V A;  2UZC A;  5GND A;  4RI0 A;  1X9Z A;  3AXA A;  1M5Z A;  2H2B A;  2GZV A;  3QE1 A;  2RCZ A;  1OZI A;  2DKR A;  3L4F D;  1YBO A;  2D90 A;  2Z9I A;  1BE9 A;  2F5Y A;  2I0L A;  2YTW A;  1KY9 A;  1Q3O A;  2L4S A;  2YUY A;  3CBY A;  2HGA A;  2KJP A;  3SOE A;  5HFD A;  2HE4 A;  1X8S A;  2EV8 A;  2OGP A;  3KZD A;  2F0A A;  3JXT A;  4OAJ A;  5E1Y A;  2QG1 A;  5E22 A;  2R3Y A;  3E17 A;  2EAQ A;  1GM1 A;  2YUB A;  2FNE A;  1V6B A;  1WHA A;  2IWQ A;  3PV5 A;  2MX6 A;  2VSV A;  4E35 A;  2Q3G A;  3CYY A;  3CBX A;  3KZE A;  4JJ3 A;  2KRG A;  1U37 A;  3QIK A;  2L97 A;  2DLU A;  3QJN A;  3SUZ A;  3MH6 A;  1U38 A;  3SHW A;  4JL7 A;  5G1E A;  2I4S A;  2I0I A;  2VRF A;  4Q2N A;  5HFF A;  4JOK A;  1UFX A;  3DJA A;  2DJT A;  1OBY A;  3NFK A;  3CH8 A;  2EGK A;  1VA8 A;  4NMT A;  1VB7 A;  3PV4 A;  4PQW A;  3HVQ C;  4NXP A;  2FN5 A;  1OBX A;  4JOF A;  1SOZ A;  2YT8 A;  1WF7 A;  1K32 A;  1WI2 A;  2KAW A;  1W9O A;  1UEZ A;  4Q2P A;  2OQS A;  3WKL A;  2W4F A;  2JSN A;  2AWU A;  4UU6 A;  2HE2 A;  2PZD A;  3B76 A;  4NMR A;  5HFE A;  2OSG A;  2PKT A;  4NMQ A;  2V90 A;  2O2T A;  1RY4 A;  1N7F A;  2LA8 A;  3R0H A;  2DM8 A;  1X45 A;  3VQF A;  3MH7 A;  1I92 A;  1Y8T A;  2KA9 A;  4LMM A;  4P0C A;  1WFG A;  5IL9 A;  4NMV A;  5H3J A;  4K6Y A;  1X6D A;  1G9O A;  4K75 A;  4WYT A;  5HJ1 A;  4O06 A;  1QAU A;  3MH4 A;  1Q3P A;  4GHN A;  2LOB A;  4E3B A;  1N6E A;  3GDV A;  4JOJ A;  4Z33 A;  3QO6 A;  4JOG A;  1Z86 A;  3RLE A;  5HF4 A;  1UJU A;  2DMZ A;  3TMH A;  4KFV A;  1UJV A;  2CSS A;  1V5Q A;  1R6J A;  4JOE A;  4REY A;  2OS6 A;  1TP3 A;  4K76 A;  1OBZ A;  1N6D A;  5A2P A;  2REY A;  2LC6 A;  2PKU A;  2W7R A;  3GDS A;  2I6V A;  3GSL A;  2JRE A;  1UJD A;  1V1T A;  5HEB A;  3I1E A;  1TQ3 A;  5B6L A;  2M0V A;  2G5M B;  1KWA A;  2ZPM A;  2FCF A;  4F8K A;  3GCO A;  4IC6 A;  2L4T A;  2LUI A;  1MFG A;  1IU0 A;  2KQF A;  4EDJ A;  2MHO A;  2KOH A;  2AIN A;  3LNX A;  5FB8 C;  2M0Z A;  1TE0 A;  2JWE A;  1X5Q A;  2AWX A;  2M10 A;  4GVD A;  1P1E A;  4Q2O A;  3DJ3 A;  5EZ0 A;  3ZRT A;  2M0T A;  3EGH C;  2CS5 A;  1D5G A;  2KJK A;  3K82 A;  2ENO A;  4GVC A;  1UM7 A;  4Q6H A;  2EDZ A;  3CBZ A;  2V1W A;  4G69 A;  4WYU A;  2JIN A;  3VQG A;  1L6O A;  2YT7 A;  2FE5 A;  1RZX A;  5DTH A;  1UEQ A;  2QKU A;  3HPK A;  4AMH A;  2E7K A;  2IWP A;  3GAB A;  2VPH A;  2X7Z A;  3KHF A;  3RL7 A;  1WG6 A;  3KDG A;  3PS4 A;  3OTP A;  1GQ5 A;  4NMO A;  5D13 A;  1MFL A;  4K78 A;  3NFL A;  1N6F A;  2PNT A;  2EGO A;  4JOH A;  2K1Z A;  1TP5 A;  4HOP B;  2IWO A;  4NNL A;  5EYZ A;  1NTE A;  1QAV B;  2WL7 A;  2PA1 A;  1WI4 A;  3FY5 A;  3LNY A;  3SHU A;  5HFC A;  2K20 A;  2QKT A;  4K72 A;  1W9Q A;  3QGL A;  1N7T A;  5E6P B;  2EDV A;  3PV2 A;  4OEP A;  1V62 A;  3R68 A;  4H11 A;  2P3W A;  5B42 A;  1WFV A;  3K50 A;  1WJL A;  4Q3H A;  4XHV A;  2G2L A;  4P2A B;  5JXB A;  5HED A;  3TSW A;  3ID2 A;  1MC7 A;  2DAZ A;  4UU5 A;  2CSJ A;  1GQ4 A;  4L8N A;  2OPG A;  2KYL A;  1V5L A;  3QDO A;  2ZPL A;  3BPU A;  3ID4 A;  3CS0 A;  4HOP A;  2GEF A;  5HET A;  1WF8 A;  1QAV A;  5HEY A;  2RRM A;  5GLJ A;  2R4H A;  2OZF A;  1VJ6 A;  4JJ0 A;  2I04 A;  2KG2 A;  2EXG A;  1N99 A;  4N6X A;  5E21 A;  2DB5 A;  3NCV A;  1UF1 A;  5F3X A;  2M0U A;  1IU2 A;  2H3L A;  5ILB A;  1VCW A;  2Z17 A;  2KOJ A;  2JIL A;  4NXR A;  1WHD A;  4JOP A;  2EGN A;  3QJM A;  3ID1 A;  3CC0 A;  1ZOK A;  1XZ9 A;  4NNM A;  3RL8 A;  1RGW A;  1WH1 A;  4YYX A;  3DIW A;  1UM1 A;  4NMS A;  3GJ9 A;  3STJ A;  4Z8J A;  2PDZ A;  1W9E A;  3ID3 A;  2KPL A;  1BFE A;  1FC7 A;  4Q6S A;  2KL1 A;  3PDV A;  3DJ1 A;  3GCN A;  3O5N A;  2D8I A;  1N7E A;  2IWN A;  2EEG A;  2JOA A;  4R2Z A;  3GDU A;  1Z87 A;  1U3B A;  4JOR A;  1VAE A;  3KDK A;  1FC9 A;  2EEJ A;  2JXO A;  2LC7 A;  1P1D A;  3OU0 A;  2VZ5 A;  1UEW A;  1RGR A;  1KEF A;  3DOR A;  3EGG C;  5HDY A;  1QLC A;  1FC6 A;  4MPA A;  4NMP A;  1UIT A;  2D92 A;  1Q7X A;  4KFW A;  1B8Q A;  2QT5 A;  2VSP A;  2BYG A;  1UHP A;  3GGE A;  5HFB A;  2OMJ A;  2EJY A;  3O46 A;  3NGH A;  2KPK A;  4YDP A;  5HF1 A;  1PDR A;  3K1R A;  3WKM A;  2EEI A;  2KOM A;  1NF3 C;  2DC2 A;  3PDZ A;  2OCS A;  2KBS A;  3TSV A;  4FGM A;  5E11 A;  1LCY A;  4Q2Q A;  5F67 A;  1SOT A;  2JIK A;  3I18 A;  1FCF A;  1X5R A;  5I7Z A;  1ZUB A;  2KJD A;  3SFJ A;  1U39 A;  3I4W A;  2AWW A;  4OEO A;  2I1N A;  1IHJ A;  3TSZ A;  5FHT A;  3HPM A;  1Y7N A;  1UEP A;  2DLS A;  1T2M A;  2KV8 A;  2QKV A;  2M3M A;  2VWR A;  2H3M A;  2QBW A;  2EHR A;  4NXQ A;  4E34 A;  3R69 A;  1WIF A;  2EDP A;  2H2C A;  5G1D A;  1X5N A; 
#chains in the Genus database with same CATH homology
 2EEH A;  4FLN A;  1I16 A;  2Q9V A;  2UZC A;  5GND A;  4RI0 A;  1X9Z A;  3AXA A;  1M5Z A;  2H2B A;  2GZV A;  3QE1 A;  2RCZ A;  1OZI A;  2DKR A;  3L4F D;  1YBO A;  2D90 A;  2Z9I A;  1BE9 A;  2F5Y A;  2I0L A;  2YTW A;  1KY9 A;  1Q3O A;  2L4S A;  2YUY A;  3CBY A;  2HGA A;  2KJP A;  3SOE A;  5HFD A;  2HE4 A;  1X8S A;  2EV8 A;  2OGP A;  3KZD A;  2F0A A;  3JXT A;  4OAJ A;  5E1Y A;  2QG1 A;  5E22 A;  2R3Y A;  3E17 A;  2EAQ A;  1GM1 A;  2YUB A;  2FNE A;  1V6B A;  1WHA A;  2IWQ A;  3PV5 A;  2MX6 A;  2VSV A;  4E35 A;  2Q3G A;  3CYY A;  3CBX A;  3KZE A;  4JJ3 A;  2KRG A;  1U37 A;  3QIK A;  2L97 A;  2DLU A;  3QJN A;  3SUZ A;  3MH6 A;  1U38 A;  3SHW A;  4JL7 A;  5G1E A;  2I4S A;  2I0I A;  2VRF A;  4Q2N A;  5HFF A;  4JOK A;  1UFX A;  3DJA A;  2DJT A;  1OBY A;  3NFK A;  3CH8 A;  2EGK A;  1VA8 A;  4NMT A;  1VB7 A;  3PV4 A;  4PQW A;  3HVQ C;  4NXP A;  2FN5 A;  1OBX A;  4JOF A;  1SOZ A;  2YT8 A;  1WF7 A;  1K32 A;  1WI2 A;  2KAW A;  1W9O A;  1UEZ A;  4Q2P A;  2OQS A;  3WKL A;  2W4F A;  2JSN A;  2AWU A;  4UU6 A;  2HE2 A;  2PZD A;  3B76 A;  4NMR A;  5HFE A;  2OSG A;  2PKT A;  4NMQ A;  2V90 A;  2O2T A;  1RY4 A;  1N7F A;  2LA8 A;  3R0H A;  2DM8 A;  1X45 A;  3VQF A;  3MH7 A;  1I92 A;  1Y8T A;  2KA9 A;  4LMM A;  4P0C A;  1WFG A;  5IL9 A;  4NMV A;  5H3J A;  4K6Y A;  1X6D A;  1G9O A;  4K75 A;  4WYT A;  5HJ1 A;  4O06 A;  1QAU A;  3MH4 A;  1Q3P A;  4GHN A;  2LOB A;  4E3B A;  1N6E A;  3GDV A;  4JOJ A;  4Z33 A;  3QO6 A;  4JOG A;  1Z86 A;  3RLE A;  5HF4 A;  1UJU A;  2DMZ A;  3TMH A;  4KFV A;  1UJV A;  2CSS A;  1V5Q A;  1R6J A;  4JOE A;  4REY A;  2OS6 A;  1TP3 A;  4K76 A;  1OBZ A;  1N6D A;  5A2P A;  2REY A;  2LC6 A;  2PKU A;  2W7R A;  3GDS A;  2I6V A;  3GSL A;  2JRE A;  1UJD A;  1V1T A;  5HEB A;  3I1E A;  1TQ3 A;  5B6L A;  2M0V A;  2G5M B;  1KWA A;  2ZPM A;  2FCF A;  4F8K A;  3GCO A;  4IC6 A;  2L4T A;  2LUI A;  1MFG A;  1IU0 A;  2KQF A;  4EDJ A;  2MHO A;  2KOH A;  2AIN A;  3LNX A;  5FB8 C;  2M0Z A;  1TE0 A;  2JWE A;  1X5Q A;  2AWX A;  2M10 A;  4GVD A;  1P1E A;  4Q2O A;  3DJ3 A;  5EZ0 A;  3ZRT A;  2M0T A;  3EGH C;  2CS5 A;  1D5G A;  2KJK A;  3K82 A;  2ENO A;  4GVC A;  1UM7 A;  4Q6H A;  2EDZ A;  3CBZ A;  2V1W A;  4G69 A;  4WYU A;  2JIN A;  3VQG A;  1L6O A;  2YT7 A;  2FE5 A;  1RZX A;  5DTH A;  1UEQ A;  2QKU A;  3HPK A;  4AMH A;  2E7K A;  2IWP A;  3GAB A;  2VPH A;  2X7Z A;  3KHF A;  3RL7 A;  1WG6 A;  3KDG A;  3PS4 A;  3OTP A;  1GQ5 A;  4NMO A;  5D13 A;  1MFL A;  4K78 A;  3NFL A;  1N6F A;  2PNT A;  2EGO A;  4JOH A;  2K1Z A;  1TP5 A;  4HOP B;  2IWO A;  4NNL A;  5EYZ A;  1NTE A;  1QAV B;  2WL7 A;  2PA1 A;  1WI4 A;  3FY5 A;  3LNY A;  3SHU A;  5HFC A;  2K20 A;  2QKT A;  4K72 A;  1W9Q A;  3QGL A;  1N7T A;  5E6P B;  2EDV A;  3PV2 A;  4OEP A;  1V62 A;  3R68 A;  4H11 A;  2P3W A;  5B42 A;  1WFV A;  3K50 A;  1WJL A;  4Q3H A;  4XHV A;  2G2L A;  4P2A B;  5JXB A;  5HED A;  3TSW A;  3ID2 A;  1MC7 A;  2DAZ A;  4UU5 A;  2CSJ A;  1GQ4 A;  4L8N A;  2OPG A;  2KYL A;  1V5L A;  3QDO A;  2ZPL A;  3BPU A;  3ID4 A;  3CS0 A;  4HOP A;  2GEF A;  5HET A;  1WF8 A;  1QAV A;  5HEY A;  2RRM A;  5GLJ A;  2R4H A;  2OZF A;  1VJ6 A;  4JJ0 A;  2I04 A;  2KG2 A;  2EXG A;  1N99 A;  4N6X A;  5E21 A;  2DB5 A;  3NCV A;  1UF1 A;  5F3X A;  2M0U A;  1IU2 A;  2H3L A;  5ILB A;  1VCW A;  2Z17 A;  2KOJ A;  2JIL A;  4NXR A;  1WHD A;  4JOP A;  2EGN A;  3QJM A;  3ID1 A;  3CC0 A;  1ZOK A;  1XZ9 A;  4NNM A;  3RL8 A;  1RGW A;  1WH1 A;  4YYX A;  3DIW A;  1UM1 A;  4NMS A;  3GJ9 A;  3STJ A;  4Z8J A;  2PDZ A;  1W9E A;  3ID3 A;  2KPL A;  1BFE A;  1FC7 A;  4Q6S A;  2KL1 A;  3PDV A;  3DJ1 A;  3GCN A;  3O5N A;  2D8I A;  1N7E A;  2IWN A;  2EEG A;  2JOA A;  4R2Z A;  3GDU A;  1Z87 A;  1U3B A;  4JOR A;  1VAE A;  3KDK A;  1FC9 A;  2EEJ A;  2JXO A;  2LC7 A;  1P1D A;  3OU0 A;  2VZ5 A;  1UEW A;  1RGR A;  1KEF A;  3DOR A;  3EGG C;  5HDY A;  1QLC A;  1FC6 A;  4MPA A;  4NMP A;  1UIT A;  2D92 A;  1Q7X A;  4KFW A;  1B8Q A;  2QT5 A;  2VSP A;  2BYG A;  1UHP A;  3GGE A;  5HFB A;  2OMJ A;  2EJY A;  3O46 A;  3NGH A;  2KPK A;  4YDP A;  5HF1 A;  1PDR A;  3K1R A;  3WKM A;  2EEI A;  2KOM A;  1NF3 C;  2DC2 A;  3PDZ A;  2OCS A;  2KBS A;  3TSV A;  4FGM A;  5E11 A;  1LCY A;  4Q2Q A;  5F67 A;  1SOT A;  2JIK A;  3I18 A;  1FCF A;  1X5R A;  5I7Z A;  1ZUB A;  2KJD A;  3SFJ A;  1U39 A;  3I4W A;  2AWW A;  4OEO A;  2I1N A;  1IHJ A;  3TSZ A;  5FHT A;  3HPM A;  1Y7N A;  1UEP A;  2DLS A;  1T2M A;  2KV8 A;  2QKV A;  2M3M A;  2VWR A;  2H3M A;  2QBW A;  2EHR A;  4NXQ A;  4E34 A;  3R69 A;  1WIF A;  2EDP A;  2H2C A;  5G1D A;  1X5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...