1UEQA

Solution structure of the first pdz domain of human atrophin-1 interacting protein 1 (kiaa0705 protein)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
123
structure length
123
Chain Sequence
GSSGSSGLFTRDASQLKGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVCVLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MEMBRANE ASSOCIATED GUANYLATE KINASE INVERTED-2 (MAGI-2)
publication title Solution Structure of The First PDZ domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 protein)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1ueqA00
4Q2OA 3PDZA 1W9OA 2M0ZA 1Q3PA 2OQSA 3HPKA 1WF8A 2EJYA 4XHVA 5E21A 5E6PB 3L4FD 1GM1A 2V90A 2K20A 4K75A 1GQ4A 3GCNA 1VA8A 1WH1A 5D13A 1GQ5A 1VB7A 2JILA 2L4SA 4NXRA 2MX6A 2EXGA 1NTEA 2QKTA 2EEGA 2KJPA 2M0TA 2ZPMA 1UITA 4JOPA 3FY5A 3CBYA 2QKVA 5E11A 3NGHA 3QJNA 2FCFA 2YUYA 3WKLA 2KL1A 1OBZA 2V1WA 2EGNA 2DM8A 2LA8A 2R3YA 5DTHA 2OS6A 1D5GA 2KV8A 3I1EA 1TP3A 1R6JA 3HVQC 4E3BA 1MC7A 3CC0A 3PV4A 4KFVA 1V6BA 4JOFA 3DJAA 5HFDA 3SHUA 2KJKA 1FC7A 3BPUA 1UM7A 5HJ1A 2AWXA 3JXTA 4R2ZA 2AWUA 4N6XA 1N6DA 4HOPA 1TQ3A 2I4SA 1KWAA 2DLSA 3GGEA 4JL7A 2VSPA 1UF1A 3CBZA 4NMQA 4O06A 2MHOA 1X45A 3I18A 4Q6SA 1WFGA 2F5YA 2PNTA 4GHNA 1RGWA 2DMZA 4Q2NA 2VRFA 1KEFA 2KQFA 1WG6A 2DLUA 1UEWA 4F8KA 2H2CA 1UJUA 1WI4A 4PQWA 2X7ZA 3QE1A 2D8IA 1WI2A 2PDZA 2RCZA 1U3BA 4NMTA 5G1DA 5HF4A 3ID1A 2O2TA 3K1RA 5HF1A 3MH6A 3RLEA 2G2LA 3ZRTA 2EDZA 3TSVA 4WYTA 3LNXA 1SOTA 2VSVA 4K6YA 1N7TA 5HETA 3NFKA 4H11A 4Z8JA 3K82A 2JIKA 2I0LA 1BE9A 1QAUA 4UU6A 2EGKA 1U37A 3PDVA 2DAZA 3WKMA 2REYA 2KOHA 3SFJA 1VCWA 3I4WA 1L6OA 2EAQA 1UM1A 3QDOA 1UJVA 2Q3GA 2KOJA 5H3JA 1UJDA 2EGOA 4JOEA 3CS0A 2G5MB 1N6FA 4IC6A 2F0AA 2KOMA 1N99A 2Z9IA 1X5QA 2ZPLA 1Q7XA 2EHRA 4E35A 2IWQA 2KBSA 2H3MA 4NMOA 1IHJA 2FN5A 5HFCA 1XZ9A 4JOKA 1K32A 1VJ6A 3SUZA 2KYLA 1FC9A 5HEBA 1WF7A 5HFFA 5F67A 4RI0A 3KHFA 2K1ZA 5EYZA 3E17A 2KA9A 4GVDA 2VZ5A 2LC7A 3R69A 2OCSA 2I1NA 1QLCA 3DIWA 1OZIA 4NNMA 4MPAA 1VAEA 5HDYA 3ID2A 1NF3C 1B8QA 1YBOA 1FCFA 1V62A 1V5LA 1TP5A 2HE2A 2UZCA 1WFVA 5GNDA 2KPKA 3MH4A 4HOPB 4REYA 2OPGA 3CH8A 4K76A 2Q9VA 5JXBA 2W4FA 1G9OA 2LOBA 3OU0A 4NXQA 1Z87A 3DJ1A 1M5ZA 1V1TA 5E1YA 3TSWA 1ZUBA 2DJTA 2JXOA 3GCOA 4LMMA 3O46A 2M0VA 1W9EA 1Q3OA 1UEZA 2M3MA 3GDVA 5FB8C 2AINA 3ID4A 2OGPA 1W9QA 1ZOKA 2AWWA 1N7EA 1N7FA 3QIKA 5I7ZA 4NMSA 4K78A 1UFXA 1TE0A 4NMPA 1FC6A 2Z17A 3KZEA 4YYXA 3GJ9A 3PV5A 1Y8TA 1Y7NA 4Q6HA 2QBWA 3KZDA 2JOAA 2QT5A 2VPHA 3R68A 1Z86A 1MFLA 2EDVA 2KAWA 2LC6A 1QAVA 3R0HA 4UU5A 3ID3A 2R4HA 2P3WA 4GVCA 3O5NA 3GDSA 2PA1A 1UEPA 4YDPA 3NFLA 2PKUA 3RL7A 2JWEA 4WYUA 2HE4A 2DB5A 3CYYA 1X5RA 2VWRA 2H3LA 2FE5A 4KFWA 2HGAA 3STJA 2W7RA 2OZFA 4OEPA 2IWPA 1WHAA 1WIFA 1X8SA 2CSJA 2ENOA 3VQFA 3LNYA 4K72A 1SOZA 4OAJA 2EV8A 1PDRA 1I92A 5B6LA 4L8NA 3RL8A 5EZ0A 4P0CA 2KPLA 5HFBA 1X6DA 2I0IA 3K50A 1MFGA 2JINA 3QGLA 4NXPA 2QKUA 1I16A 4NMRA 3EGGC 4OEOA 4EDJA 2M10A 1UHPA 2WL7A 2D92A 1UEQA 5A2PA 1WHDA 2L97A 3MH7A 4E34A 4JOJA 4G69A 1IU0A 4Q2PA 2YT8A 2I04A 1OBXA 3GDUA 4Q2QA 3DJ3A 2KG2A 2M0UA 2EEJA 2CSSA 2H2BA 2GZVA 1OBYA 2PZDA 3B76A 3TSZA 2QG1A 2FNEA 5G1EA 3HPMA 2EEIA 3VQGA 3TMHA 3CBXA 1U38A 1U39A 1X5NA 2IWNA 2BYGA 1P1DA 1RGRA 1WJLA 2IWOA 4JORA 2KRGA 2I6VA 4Q3HA 1N6EA 5E22A 1KY9A 1T2MA 3PS4A 3PV2A 3AXAA 1IU2A 4Z33A 4JOGA 2KJDA 2YUBA 5FHTA 3SHWA 3SOEA 4JOHA 2D90A 2JREA 1RZXA 2EDPA 4P2AB 2YTWA 3GSLA 3QO6A 1BFEA 4NMVA 2DC2A 5HFEA 4AMHA 2L4TA 4FGMA 3OTPA 1V5QA 2E7KA 1LCYA 5HEYA 1RY4A 1P1EA 2CS5A 3DORA 5GLJA 4NNLA 2DKRA 2RRMA 2OSGA 2YT7A 3EGHC 5HEDA 2EEHA 1QAVB 2LUIA 2PKTA 3QJMA 2OMJA 5F3XA
chains in the Genus database with same CATH superfamily
4Q2OA 3PDZA 1W9OA 2M0ZA 1Q3PA 2OQSA 3HPKA 1WF8A 2EJYA 4XHVA 5E21A 5E6PB 3L4FD 1GM1A 2V90A 2K20A 4K75A 1GQ4A 3GCNA 1VA8A 1WH1A 5D13A 1GQ5A 1VB7A 2JILA 2L4SA 4NXRA 2MX6A 2EXGA 1NTEA 2QKTA 2EEGA 2KJPA 2M0TA 2ZPMA 1UITA 4JOPA 3FY5A 3CBYA 2QKVA 5E11A 3NGHA 3QJNA 2FCFA 2YUYA 3WKLA 2KL1A 1OBZA 2V1WA 2EGNA 2DM8A 2LA8A 1X9ZA 2R3YA 5DTHA 2OS6A 1D5GA 2KV8A 3I1EA 1TP3A 1R6JA 3HVQC 4E3BA 1MC7A 3CC0A 3PV4A 4KFVA 1V6BA 4JOFA 3DJAA 5HFDA 3SHUA 2KJKA 1FC7A 3BPUA 1UM7A 5HJ1A 2AWXA 3JXTA 4R2ZA 2AWUA 4N6XA 1N6DA 4HOPA 1TQ3A 2I4SA 1KWAA 2DLSA 3GGEA 4JL7A 2VSPA 1UF1A 3CBZA 4NMQA 4O06A 2MHOA 1X45A 3I18A 4Q6SA 1WFGA 2F5YA 2PNTA 4GHNA 1RGWA 2DMZA 4Q2NA 2VRFA 1KEFA 2KQFA 1WG6A 2DLUA 1UEWA 4F8KA 2H2CA 1UJUA 1WI4A 4PQWA 2X7ZA 3QE1A 2D8IA 1WI2A 2PDZA 2RCZA 1U3BA 4JJ3A 4NMTA 5G1DA 5HF4A 3ID1A 2O2TA 3K1RA 5HF1A 3MH6A 3RLEA 2G2LA 3ZRTA 2EDZA 3TSVA 4WYTA 3LNXA 1SOTA 2VSVA 4K6YA 1N7TA 5HETA 3NFKA 4H11A 4Z8JA 3K82A 2JIKA 2I0LA 2JSNA 1BE9A 1QAUA 4UU6A 2EGKA 4JJ0A 1U37A 3PDVA 2DAZA 3WKMA 2REYA 2KOHA 3SFJA 1VCWA 3I4WA 5ILBA 1L6OA 2EAQA 1UM1A 3QDOA 1UJVA 2Q3GA 2KOJA 5H3JA 1UJDA 2EGOA 4JOEA 3CS0A 2G5MB 1N6FA 4IC6A 2F0AA 2KOMA 1N99A 2Z9IA 1X5QA 2ZPLA 1Q7XA 2EHRA 4E35A 2IWQA 2KBSA 2H3MA 4FLNA 4NMOA 1IHJA 2FN5A 5HFCA 1XZ9A 4JOKA 1K32A 1VJ6A 3SUZA 2KYLA 1FC9A 5HEBA 1WF7A 5HFFA 5F67A 4RI0A 3KHFA 2K1ZA 5EYZA 3E17A 2KA9A 4GVDA 2VZ5A 2LC7A 3R69A 2OCSA 2I1NA 1QLCA 3DIWA 1OZIA 4NNMA 4MPAA 1VAEA 5HDYA 3ID2A 1NF3C 5IL9A 1B8QA 1YBOA 1FCFA 1V62A 1V5LA 1TP5A 2HE2A 2UZCA 1WFVA 5GNDA 2KPKA 3MH4A 4HOPB 4REYA 2OPGA 3CH8A 4K76A 2Q9VA 5JXBA 2W4FA 1G9OA 2LOBA 3OU0A 4NXQA 1Z87A 3DJ1A 1M5ZA 3KDGA 1V1TA 5E1YA 3TSWA 1ZUBA 2DJTA 2JXOA 3GCOA 4LMMA 3O46A 2M0VA 1W9EA 1Q3OA 1UEZA 2M3MA 3GDVA 5FB8C 2AINA 3ID4A 2OGPA 1W9QA 1ZOKA 2AWWA 1N7EA 1N7FA 3QIKA 5I7ZA 4NMSA 4K78A 1UFXA 1TE0A 4NMPA 1FC6A 2Z17A 3KZEA 4YYXA 3GJ9A 3PV5A 1Y8TA 1Y7NA 4Q6HA 2QBWA 3KZDA 2JOAA 2QT5A 2VPHA 3R68A 1Z86A 1MFLA 2EDVA 2KAWA 2LC6A 1QAVA 3R0HA 4UU5A 3ID3A 2R4HA 2P3WA 4GVCA 3O5NA 3GDSA 2PA1A 1UEPA 4YDPA 3NFLA 2PKUA 3RL7A 2JWEA 4WYUA 2HE4A 2DB5A 3CYYA 1X5RA 2VWRA 2H3LA 2FE5A 4KFWA 2HGAA 3STJA 2W7RA 2OZFA 4OEPA 2IWPA 1WHAA 1WIFA 1X8SA 2CSJA 2ENOA 3VQFA 3LNYA 4K72A 1SOZA 4OAJA 2EV8A 1PDRA 1I92A 2GEFA 5B6LA 4L8NA 3RL8A 5EZ0A 4P0CA 2KPLA 5HFBA 1X6DA 2I0IA 3K50A 1MFGA 2JINA 3QGLA 4NXPA 2QKUA 1I16A 4NMRA 3EGGC 4OEOA 4EDJA 2M10A 1UHPA 2WL7A 2D92A 1UEQA 5A2PA 1WHDA 2L97A 3MH7A 4E34A 4JOJA 4G69A 1IU0A 4Q2PA 2YT8A 2I04A 1OBXA 3GDUA 4Q2QA 3DJ3A 2KG2A 2M0UA 2EEJA 2CSSA 2H2BA 2GZVA 1OBYA 2PZDA 3B76A 3TSZA 2QG1A 2FNEA 5G1EA 3HPMA 2EEIA 3VQGA 3TMHA 3CBXA 1U38A 1U39A 1X5NA 2IWNA 3NCVA 2BYGA 1P1DA 1RGRA 1WJLA 2IWOA 4JORA 2KRGA 2I6VA 4Q3HA 1N6EA 5E22A 1KY9A 1T2MA 3PS4A 3PV2A 3AXAA 1IU2A 3GABA 4Z33A 4JOGA 2KJDA 2YUBA 5FHTA 3SHWA 3SOEA 4JOHA 2D90A 2JREA 1RZXA 2EDPA 4P2AB 2YTWA 3GSLA 3QO6A 1BFEA 4NMVA 2DC2A 5HFEA 4AMHA 2L4TA 4FGMA 3OTPA 1V5QA 2E7KA 1LCYA 5HEYA 1RY4A 1P1EA 2CS5A 3DORA 5GLJA 3KDKA 4NNLA 2DKRA 2RRMA 5B42A 2OSGA 2YT7A 3EGHC 5HEDA 2EEHA 1QAVB 2LUIA 2PKTA 3QJMA 2OMJA 5F3XA
chains in the Genus database with same CATH topology
4Q2OA 3PDZA 1W9OA 2M0ZA 1Q3PA 2OQSA 3HPKA 1WF8A 2EJYA 4XHVA 5E21A 5E6PB 3L4FD 1GM1A 2V90A 2K20A 4K75A 1GQ4A 3GCNA 1VA8A 1WH1A 5D13A 1GQ5A 1VB7A 2JILA 2L4SA 4NXRA 2MX6A 2EXGA 1NTEA 2QKTA 2EEGA 2KJPA 2M0TA 2ZPMA 1UITA 4JOPA 3FY5A 3CBYA 2QKVA 5E11A 3NGHA 3QJNA 2FCFA 2YUYA 3WKLA 2KL1A 1OBZA 2V1WA 2EGNA 2DM8A 2LA8A 1X9ZA 2R3YA 5DTHA 2OS6A 1D5GA 2KV8A 3I1EA 1TP3A 1R6JA 3HVQC 4E3BA 1MC7A 3CC0A 3PV4A 4KFVA 1V6BA 4JOFA 3DJAA 5HFDA 3SHUA 2KJKA 1FC7A 3BPUA 1UM7A 5HJ1A 2AWXA 3JXTA 4R2ZA 2AWUA 4N6XA 1N6DA 4HOPA 1TQ3A 2I4SA 1KWAA 2DLSA 3GGEA 4JL7A 2VSPA 1UF1A 3CBZA 4NMQA 4O06A 2MHOA 1X45A 3I18A 4Q6SA 1WFGA 2F5YA 2PNTA 4GHNA 1RGWA 2DMZA 4Q2NA 2VRFA 1KEFA 2KQFA 1WG6A 2DLUA 1UEWA 4F8KA 2H2CA 1UJUA 1WI4A 4PQWA 2X7ZA 3QE1A 2D8IA 1WI2A 2PDZA 2RCZA 1U3BA 4JJ3A 4NMTA 5G1DA 5HF4A 3ID1A 2O2TA 3K1RA 5HF1A 3MH6A 3RLEA 2G2LA 3ZRTA 2EDZA 3TSVA 4WYTA 3LNXA 1SOTA 2VSVA 4K6YA 1N7TA 5HETA 3NFKA 4H11A 4Z8JA 3K82A 2JIKA 2I0LA 2JSNA 1BE9A 1QAUA 4UU6A 2EGKA 4JJ0A 1U37A 3PDVA 2DAZA 3WKMA 2REYA 2KOHA 3SFJA 1VCWA 3I4WA 5ILBA 1L6OA 2EAQA 1UM1A 3QDOA 1UJVA 2Q3GA 2KOJA 5H3JA 1UJDA 2EGOA 4JOEA 3CS0A 2G5MB 1N6FA 4IC6A 2F0AA 2KOMA 1N99A 2Z9IA 1X5QA 2ZPLA 1Q7XA 2EHRA 4E35A 2IWQA 2KBSA 2H3MA 4FLNA 4NMOA 1IHJA 2FN5A 5HFCA 1XZ9A 4JOKA 1K32A 1VJ6A 3SUZA 2KYLA 1FC9A 5HEBA 1WF7A 5HFFA 5F67A 4RI0A 3KHFA 2K1ZA 5EYZA 3E17A 2KA9A 4GVDA 2VZ5A 2LC7A 3R69A 2OCSA 2I1NA 1QLCA 3DIWA 1OZIA 4NNMA 4MPAA 1VAEA 5HDYA 3ID2A 1NF3C 5IL9A 1B8QA 1YBOA 1FCFA 1V62A 1V5LA 1TP5A 2HE2A 2UZCA 1WFVA 5GNDA 2KPKA 3MH4A 4HOPB 4REYA 2OPGA 3CH8A 4K76A 2Q9VA 5JXBA 2W4FA 1G9OA 2LOBA 3OU0A 4NXQA 1Z87A 3DJ1A 1M5ZA 3KDGA 1V1TA 5E1YA 3TSWA 1ZUBA 2DJTA 2JXOA 3GCOA 4LMMA 3O46A 2M0VA 1W9EA 1Q3OA 1UEZA 2M3MA 3GDVA 5FB8C 2AINA 3ID4A 2OGPA 1W9QA 1ZOKA 2AWWA 1N7EA 1N7FA 3QIKA 5I7ZA 4NMSA 4K78A 1UFXA 1TE0A 4NMPA 1FC6A 2Z17A 3KZEA 4YYXA 3GJ9A 3PV5A 1Y8TA 1Y7NA 4Q6HA 2QBWA 3KZDA 2JOAA 2QT5A 2VPHA 3R68A 1Z86A 1MFLA 2EDVA 2KAWA 2LC6A 1QAVA 3R0HA 4UU5A 3ID3A 2R4HA 2P3WA 4GVCA 3O5NA 3GDSA 2PA1A 1UEPA 4YDPA 3NFLA 2PKUA 3RL7A 2JWEA 4WYUA 2HE4A 2DB5A 3CYYA 1X5RA 2VWRA 2H3LA 2FE5A 4KFWA 2HGAA 3STJA 2W7RA 2OZFA 4OEPA 2IWPA 1WHAA 1WIFA 1X8SA 2CSJA 2ENOA 3VQFA 3LNYA 4K72A 1SOZA 4OAJA 2EV8A 1PDRA 1I92A 2GEFA 5B6LA 4L8NA 3RL8A 5EZ0A 4P0CA 2KPLA 5HFBA 1X6DA 2I0IA 3K50A 1MFGA 2JINA 3QGLA 4NXPA 2QKUA 1I16A 4NMRA 3EGGC 4OEOA 4EDJA 2M10A 1UHPA 2WL7A 2D92A 1UEQA 5A2PA 1WHDA 2L97A 3MH7A 4E34A 4JOJA 4G69A 1IU0A 4Q2PA 2YT8A 2I04A 1OBXA 3GDUA 4Q2QA 3DJ3A 2KG2A 2M0UA 2EEJA 2CSSA 2H2BA 2GZVA 1OBYA 2PZDA 3B76A 3TSZA 2QG1A 2FNEA 5G1EA 3HPMA 2EEIA 3VQGA 3TMHA 3CBXA 1U38A 1U39A 1X5NA 2IWNA 3NCVA 2BYGA 1P1DA 1RGRA 1WJLA 2IWOA 4JORA 2KRGA 2I6VA 4Q3HA 1N6EA 5E22A 1KY9A 1T2MA 3PS4A 3PV2A 3AXAA 1IU2A 3GABA 4Z33A 4JOGA 2KJDA 2YUBA 5FHTA 3SHWA 3SOEA 4JOHA 2D90A 2JREA 1RZXA 2EDPA 4P2AB 2YTWA 3GSLA 3QO6A 1BFEA 4NMVA 2DC2A 5HFEA 4AMHA 2L4TA 4FGMA 3OTPA 1V5QA 2E7KA 1LCYA 5HEYA 1RY4A 1P1EA 2CS5A 3DORA 5GLJA 3KDKA 4NNLA 2DKRA 2RRMA 5B42A 2OSGA 2YT7A 3EGHC 5HEDA 2EEHA 1QAVB 2LUIA 2PKTA 3QJMA 2OMJA 5F3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2O A;  3PDZ A;  1W9O A;  2M0Z A;  1Q3P A;  2OQS A;  3HPK A;  1WF8 A;  2EJY A;  4XHV A;  5E21 A;  5E6P B;  3L4F D;  1GM1 A;  2V90 A;  2K20 A;  4K75 A;  1GQ4 A;  3GCN A;  1VA8 A;  1WH1 A;  5D13 A;  1GQ5 A;  1VB7 A;  2JIL A;  2L4S A;  4NXR A;  2MX6 A;  2EXG A;  1NTE A;  2QKT A;  2EEG A;  2KJP A;  2M0T A;  2ZPM A;  1UIT A;  4JOP A;  3FY5 A;  3CBY A;  2QKV A;  5E11 A;  3NGH A;  3QJN A;  2FCF A;  2YUY A;  3WKL A;  2KL1 A;  1OBZ A;  2V1W A;  2EGN A;  2DM8 A;  2LA8 A;  2R3Y A;  5DTH A;  2OS6 A;  1D5G A;  2KV8 A;  3I1E A;  1TP3 A;  1R6J A;  3HVQ C;  4E3B A;  1MC7 A;  3CC0 A;  3PV4 A;  4KFV A;  1V6B A;  4JOF A;  3DJA A;  5HFD A;  3SHU A;  2KJK A;  1FC7 A;  3BPU A;  1UM7 A;  5HJ1 A;  2AWX A;  3JXT A;  4R2Z A;  2AWU A;  4N6X A;  1N6D A;  4HOP A;  1TQ3 A;  2I4S A;  1KWA A;  2DLS A;  3GGE A;  4JL7 A;  2VSP A;  1UF1 A;  3CBZ A;  4NMQ A;  4O06 A;  2MHO A;  1X45 A;  3I18 A;  4Q6S A;  1WFG A;  2F5Y A;  2PNT A;  4GHN A;  1RGW A;  2DMZ A;  4Q2N A;  2VRF A;  1KEF A;  2KQF A;  1WG6 A;  2DLU A;  1UEW A;  4F8K A;  2H2C A;  1UJU A;  1WI4 A;  4PQW A;  2X7Z A;  3QE1 A;  2D8I A;  1WI2 A;  2PDZ A;  2RCZ A;  1U3B A;  4NMT A;  5G1D A;  5HF4 A;  3ID1 A;  2O2T A;  3K1R A;  5HF1 A;  3MH6 A;  3RLE A;  2G2L A;  3ZRT A;  2EDZ A;  3TSV A;  4WYT A;  3LNX A;  1SOT A;  2VSV A;  4K6Y A;  1N7T A;  5HET A;  3NFK A;  4H11 A;  4Z8J A;  3K82 A;  2JIK A;  2I0L A;  1BE9 A;  1QAU A;  4UU6 A;  2EGK A;  1U37 A;  3PDV A;  2DAZ A;  3WKM A;  2REY A;  2KOH A;  3SFJ A;  1VCW A;  3I4W A;  1L6O A;  2EAQ A;  1UM1 A;  3QDO A;  1UJV A;  2Q3G A;  2KOJ A;  5H3J A;  1UJD A;  2EGO A;  4JOE A;  3CS0 A;  2G5M B;  1N6F A;  4IC6 A;  2F0A A;  2KOM A;  1N99 A;  2Z9I A;  1X5Q A;  2ZPL A;  1Q7X A;  2EHR A;  4E35 A;  2IWQ A;  2KBS A;  2H3M A;  4NMO A;  1IHJ A;  2FN5 A;  5HFC A;  1XZ9 A;  4JOK A;  1K32 A;  1VJ6 A;  3SUZ A;  2KYL A;  1FC9 A;  5HEB A;  1WF7 A;  5HFF A;  5F67 A;  4RI0 A;  3KHF A;  2K1Z A;  5EYZ A;  3E17 A;  2KA9 A;  4GVD A;  2VZ5 A;  2LC7 A;  3R69 A;  2OCS A;  2I1N A;  1QLC A;  3DIW A;  1OZI A;  4NNM A;  4MPA A;  1VAE A;  5HDY A;  3ID2 A;  1NF3 C;  1B8Q A;  1YBO A;  1FCF A;  1V62 A;  1V5L A;  1TP5 A;  2HE2 A;  2UZC A;  1WFV A;  5GND A;  2KPK A;  3MH4 A;  4HOP B;  4REY A;  2OPG A;  3CH8 A;  4K76 A;  2Q9V A;  5JXB A;  2W4F A;  1G9O A;  2LOB A;  3OU0 A;  4NXQ A;  1Z87 A;  3DJ1 A;  1M5Z A;  1V1T A;  5E1Y A;  3TSW A;  1ZUB A;  2DJT A;  2JXO A;  3GCO A;  4LMM A;  3O46 A;  2M0V A;  1W9E A;  1Q3O A;  1UEZ A;  2M3M A;  3GDV A;  5FB8 C;  2AIN A;  3ID4 A;  2OGP A;  1W9Q A;  1ZOK A;  2AWW A;  1N7E A;  1N7F A;  3QIK A;  5I7Z A;  4NMS A;  4K78 A;  1UFX A;  1TE0 A;  4NMP A;  1FC6 A;  2Z17 A;  3KZE A;  4YYX A;  3GJ9 A;  3PV5 A;  1Y8T A;  1Y7N A;  4Q6H A;  2QBW A;  3KZD A;  2JOA A;  2QT5 A;  2VPH A;  3R68 A;  1Z86 A;  1MFL A;  2EDV A;  2KAW A;  2LC6 A;  1QAV A;  3R0H A;  4UU5 A;  3ID3 A;  2R4H A;  2P3W A;  4GVC A;  3O5N A;  3GDS A;  2PA1 A;  1UEP A;  4YDP A;  3NFL A;  2PKU A;  3RL7 A;  2JWE A;  4WYU A;  2HE4 A;  2DB5 A;  3CYY A;  1X5R A;  2VWR A;  2H3L A;  2FE5 A;  4KFW A;  2HGA A;  3STJ A;  2W7R A;  2OZF A;  4OEP A;  2IWP A;  1WHA A;  1WIF A;  1X8S A;  2CSJ A;  2ENO A;  3VQF A;  3LNY A;  4K72 A;  1SOZ A;  4OAJ A;  2EV8 A;  1PDR A;  1I92 A;  5B6L A;  4L8N A;  3RL8 A;  5EZ0 A;  4P0C A;  2KPL A;  5HFB A;  1X6D A;  2I0I A;  3K50 A;  1MFG A;  2JIN A;  3QGL A;  4NXP A;  2QKU A;  1I16 A;  4NMR A;  3EGG C;  4OEO A;  4EDJ A;  2M10 A;  1UHP A;  2WL7 A;  2D92 A;  1UEQ A;  5A2P A;  1WHD A;  2L97 A;  3MH7 A;  4E34 A;  4JOJ A;  4G69 A;  1IU0 A;  4Q2P A;  2YT8 A;  2I04 A;  1OBX A;  3GDU A;  4Q2Q A;  3DJ3 A;  2KG2 A;  2M0U A;  2EEJ A;  2CSS A;  2H2B A;  2GZV A;  1OBY A;  2PZD A;  3B76 A;  3TSZ A;  2QG1 A;  2FNE A;  5G1E A;  3HPM A;  2EEI A;  3VQG A;  3TMH A;  3CBX A;  1U38 A;  1U39 A;  1X5N A;  2IWN A;  2BYG A;  1P1D A;  1RGR A;  1WJL A;  2IWO A;  4JOR A;  2KRG A;  2I6V A;  4Q3H A;  1N6E A;  5E22 A;  1KY9 A;  1T2M A;  3PS4 A;  3PV2 A;  3AXA A;  1IU2 A;  4Z33 A;  4JOG A;  2KJD A;  2YUB A;  5FHT A;  3SHW A;  3SOE A;  4JOH A;  2D90 A;  2JRE A;  1RZX A;  2EDP A;  4P2A B;  2YTW A;  3GSL A;  3QO6 A;  1BFE A;  4NMV A;  2DC2 A;  5HFE A;  4AMH A;  2L4T A;  4FGM A;  3OTP A;  1V5Q A;  2E7K A;  1LCY A;  5HEY A;  1RY4 A;  1P1E A;  2CS5 A;  3DOR A;  5GLJ A;  4NNL A;  2DKR A;  2RRM A;  2OSG A;  2YT7 A;  3EGH C;  5HED A;  2EEH A;  1QAV B;  2LUI A;  2PKT A;  3QJM A;  2OMJ A;  5F3X A; 
#chains in the Genus database with same CATH topology
 4Q2O A;  3PDZ A;  1W9O A;  2M0Z A;  1Q3P A;  2OQS A;  3HPK A;  1WF8 A;  2EJY A;  4XHV A;  5E21 A;  5E6P B;  3L4F D;  1GM1 A;  2V90 A;  2K20 A;  4K75 A;  1GQ4 A;  3GCN A;  1VA8 A;  1WH1 A;  5D13 A;  1GQ5 A;  1VB7 A;  2JIL A;  2L4S A;  4NXR A;  2MX6 A;  2EXG A;  1NTE A;  2QKT A;  2EEG A;  2KJP A;  2M0T A;  2ZPM A;  1UIT A;  4JOP A;  3FY5 A;  3CBY A;  2QKV A;  5E11 A;  3NGH A;  3QJN A;  2FCF A;  2YUY A;  3WKL A;  2KL1 A;  1OBZ A;  2V1W A;  2EGN A;  2DM8 A;  2LA8 A;  1X9Z A;  2R3Y A;  5DTH A;  2OS6 A;  1D5G A;  2KV8 A;  3I1E A;  1TP3 A;  1R6J A;  3HVQ C;  4E3B A;  1MC7 A;  3CC0 A;  3PV4 A;  4KFV A;  1V6B A;  4JOF A;  3DJA A;  5HFD A;  3SHU A;  2KJK A;  1FC7 A;  3BPU A;  1UM7 A;  5HJ1 A;  2AWX A;  3JXT A;  4R2Z A;  2AWU A;  4N6X A;  1N6D A;  4HOP A;  1TQ3 A;  2I4S A;  1KWA A;  2DLS A;  3GGE A;  4JL7 A;  2VSP A;  1UF1 A;  3CBZ A;  4NMQ A;  4O06 A;  2MHO A;  1X45 A;  3I18 A;  4Q6S A;  1WFG A;  2F5Y A;  2PNT A;  4GHN A;  1RGW A;  2DMZ A;  4Q2N A;  2VRF A;  1KEF A;  2KQF A;  1WG6 A;  2DLU A;  1UEW A;  4F8K A;  2H2C A;  1UJU A;  1WI4 A;  4PQW A;  2X7Z A;  3QE1 A;  2D8I A;  1WI2 A;  2PDZ A;  2RCZ A;  1U3B A;  4JJ3 A;  4NMT A;  5G1D A;  5HF4 A;  3ID1 A;  2O2T A;  3K1R A;  5HF1 A;  3MH6 A;  3RLE A;  2G2L A;  3ZRT A;  2EDZ A;  3TSV A;  4WYT A;  3LNX A;  1SOT A;  2VSV A;  4K6Y A;  1N7T A;  5HET A;  3NFK A;  4H11 A;  4Z8J A;  3K82 A;  2JIK A;  2I0L A;  2JSN A;  1BE9 A;  1QAU A;  4UU6 A;  2EGK A;  4JJ0 A;  1U37 A;  3PDV A;  2DAZ A;  3WKM A;  2REY A;  2KOH A;  3SFJ A;  1VCW A;  3I4W A;  5ILB A;  1L6O A;  2EAQ A;  1UM1 A;  3QDO A;  1UJV A;  2Q3G A;  2KOJ A;  5H3J A;  1UJD A;  2EGO A;  4JOE A;  3CS0 A;  2G5M B;  1N6F A;  4IC6 A;  2F0A A;  2KOM A;  1N99 A;  2Z9I A;  1X5Q A;  2ZPL A;  1Q7X A;  2EHR A;  4E35 A;  2IWQ A;  2KBS A;  2H3M A;  4FLN A;  4NMO A;  1IHJ A;  2FN5 A;  5HFC A;  1XZ9 A;  4JOK A;  1K32 A;  1VJ6 A;  3SUZ A;  2KYL A;  1FC9 A;  5HEB A;  1WF7 A;  5HFF A;  5F67 A;  4RI0 A;  3KHF A;  2K1Z A;  5EYZ A;  3E17 A;  2KA9 A;  4GVD A;  2VZ5 A;  2LC7 A;  3R69 A;  2OCS A;  2I1N A;  1QLC A;  3DIW A;  1OZI A;  4NNM A;  4MPA A;  1VAE A;  5HDY A;  3ID2 A;  1NF3 C;  5IL9 A;  1B8Q A;  1YBO A;  1FCF A;  1V62 A;  1V5L A;  1TP5 A;  2HE2 A;  2UZC A;  1WFV A;  5GND A;  2KPK A;  3MH4 A;  4HOP B;  4REY A;  2OPG A;  3CH8 A;  4K76 A;  2Q9V A;  5JXB A;  2W4F A;  1G9O A;  2LOB A;  3OU0 A;  4NXQ A;  1Z87 A;  3DJ1 A;  1M5Z A;  3KDG A;  1V1T A;  5E1Y A;  3TSW A;  1ZUB A;  2DJT A;  2JXO A;  3GCO A;  4LMM A;  3O46 A;  2M0V A;  1W9E A;  1Q3O A;  1UEZ A;  2M3M A;  3GDV A;  5FB8 C;  2AIN A;  3ID4 A;  2OGP A;  1W9Q A;  1ZOK A;  2AWW A;  1N7E A;  1N7F A;  3QIK A;  5I7Z A;  4NMS A;  4K78 A;  1UFX A;  1TE0 A;  4NMP A;  1FC6 A;  2Z17 A;  3KZE A;  4YYX A;  3GJ9 A;  3PV5 A;  1Y8T A;  1Y7N A;  4Q6H A;  2QBW A;  3KZD A;  2JOA A;  2QT5 A;  2VPH A;  3R68 A;  1Z86 A;  1MFL A;  2EDV A;  2KAW A;  2LC6 A;  1QAV A;  3R0H A;  4UU5 A;  3ID3 A;  2R4H A;  2P3W A;  4GVC A;  3O5N A;  3GDS A;  2PA1 A;  1UEP A;  4YDP A;  3NFL A;  2PKU A;  3RL7 A;  2JWE A;  4WYU A;  2HE4 A;  2DB5 A;  3CYY A;  1X5R A;  2VWR A;  2H3L A;  2FE5 A;  4KFW A;  2HGA A;  3STJ A;  2W7R A;  2OZF A;  4OEP A;  2IWP A;  1WHA A;  1WIF A;  1X8S A;  2CSJ A;  2ENO A;  3VQF A;  3LNY A;  4K72 A;  1SOZ A;  4OAJ A;  2EV8 A;  1PDR A;  1I92 A;  2GEF A;  5B6L A;  4L8N A;  3RL8 A;  5EZ0 A;  4P0C A;  2KPL A;  5HFB A;  1X6D A;  2I0I A;  3K50 A;  1MFG A;  2JIN A;  3QGL A;  4NXP A;  2QKU A;  1I16 A;  4NMR A;  3EGG C;  4OEO A;  4EDJ A;  2M10 A;  1UHP A;  2WL7 A;  2D92 A;  1UEQ A;  5A2P A;  1WHD A;  2L97 A;  3MH7 A;  4E34 A;  4JOJ A;  4G69 A;  1IU0 A;  4Q2P A;  2YT8 A;  2I04 A;  1OBX A;  3GDU A;  4Q2Q A;  3DJ3 A;  2KG2 A;  2M0U A;  2EEJ A;  2CSS A;  2H2B A;  2GZV A;  1OBY A;  2PZD A;  3B76 A;  3TSZ A;  2QG1 A;  2FNE A;  5G1E A;  3HPM A;  2EEI A;  3VQG A;  3TMH A;  3CBX A;  1U38 A;  1U39 A;  1X5N A;  2IWN A;  3NCV A;  2BYG A;  1P1D A;  1RGR A;  1WJL A;  2IWO A;  4JOR A;  2KRG A;  2I6V A;  4Q3H A;  1N6E A;  5E22 A;  1KY9 A;  1T2M A;  3PS4 A;  3PV2 A;  3AXA A;  1IU2 A;  3GAB A;  4Z33 A;  4JOG A;  2KJD A;  2YUB A;  5FHT A;  3SHW A;  3SOE A;  4JOH A;  2D90 A;  2JRE A;  1RZX A;  2EDP A;  4P2A B;  2YTW A;  3GSL A;  3QO6 A;  1BFE A;  4NMV A;  2DC2 A;  5HFE A;  4AMH A;  2L4T A;  4FGM A;  3OTP A;  1V5Q A;  2E7K A;  1LCY A;  5HEY A;  1RY4 A;  1P1E A;  2CS5 A;  3DOR A;  5GLJ A;  3KDK A;  4NNL A;  2DKR A;  2RRM A;  5B42 A;  2OSG A;  2YT7 A;  3EGH C;  5HED A;  2EEH A;  1QAV B;  2LUI A;  2PKT A;  3QJM A;  2OMJ A;  5F3X A; 
#chains in the Genus database with same CATH homology
 4Q2O A;  3PDZ A;  1W9O A;  2M0Z A;  1Q3P A;  2OQS A;  3HPK A;  1WF8 A;  2EJY A;  4XHV A;  5E21 A;  5E6P B;  3L4F D;  1GM1 A;  2V90 A;  2K20 A;  4K75 A;  1GQ4 A;  3GCN A;  1VA8 A;  1WH1 A;  5D13 A;  1GQ5 A;  1VB7 A;  2JIL A;  2L4S A;  4NXR A;  2MX6 A;  2EXG A;  1NTE A;  2QKT A;  2EEG A;  2KJP A;  2M0T A;  2ZPM A;  1UIT A;  4JOP A;  3FY5 A;  3CBY A;  2QKV A;  5E11 A;  3NGH A;  3QJN A;  2FCF A;  2YUY A;  3WKL A;  2KL1 A;  1OBZ A;  2V1W A;  2EGN A;  2DM8 A;  2LA8 A;  1X9Z A;  2R3Y A;  5DTH A;  2OS6 A;  1D5G A;  2KV8 A;  3I1E A;  1TP3 A;  1R6J A;  3HVQ C;  4E3B A;  1MC7 A;  3CC0 A;  3PV4 A;  4KFV A;  1V6B A;  4JOF A;  3DJA A;  5HFD A;  3SHU A;  2KJK A;  1FC7 A;  3BPU A;  1UM7 A;  5HJ1 A;  2AWX A;  3JXT A;  4R2Z A;  2AWU A;  4N6X A;  1N6D A;  4HOP A;  1TQ3 A;  2I4S A;  1KWA A;  2DLS A;  3GGE A;  4JL7 A;  2VSP A;  1UF1 A;  3CBZ A;  4NMQ A;  4O06 A;  2MHO A;  1X45 A;  3I18 A;  4Q6S A;  1WFG A;  2F5Y A;  2PNT A;  4GHN A;  1RGW A;  2DMZ A;  4Q2N A;  2VRF A;  1KEF A;  2KQF A;  1WG6 A;  2DLU A;  1UEW A;  4F8K A;  2H2C A;  1UJU A;  1WI4 A;  4PQW A;  2X7Z A;  3QE1 A;  2D8I A;  1WI2 A;  2PDZ A;  2RCZ A;  1U3B A;  4JJ3 A;  4NMT A;  5G1D A;  5HF4 A;  3ID1 A;  2O2T A;  3K1R A;  5HF1 A;  3MH6 A;  3RLE A;  2G2L A;  3ZRT A;  2EDZ A;  3TSV A;  4WYT A;  3LNX A;  1SOT A;  2VSV A;  4K6Y A;  1N7T A;  5HET A;  3NFK A;  4H11 A;  4Z8J A;  3K82 A;  2JIK A;  2I0L A;  2JSN A;  1BE9 A;  1QAU A;  4UU6 A;  2EGK A;  4JJ0 A;  1U37 A;  3PDV A;  2DAZ A;  3WKM A;  2REY A;  2KOH A;  3SFJ A;  1VCW A;  3I4W A;  5ILB A;  1L6O A;  2EAQ A;  1UM1 A;  3QDO A;  1UJV A;  2Q3G A;  2KOJ A;  5H3J A;  1UJD A;  2EGO A;  4JOE A;  3CS0 A;  2G5M B;  1N6F A;  4IC6 A;  2F0A A;  2KOM A;  1N99 A;  2Z9I A;  1X5Q A;  2ZPL A;  1Q7X A;  2EHR A;  4E35 A;  2IWQ A;  2KBS A;  2H3M A;  4FLN A;  4NMO A;  1IHJ A;  2FN5 A;  5HFC A;  1XZ9 A;  4JOK A;  1K32 A;  1VJ6 A;  3SUZ A;  2KYL A;  1FC9 A;  5HEB A;  1WF7 A;  5HFF A;  5F67 A;  4RI0 A;  3KHF A;  2K1Z A;  5EYZ A;  3E17 A;  2KA9 A;  4GVD A;  2VZ5 A;  2LC7 A;  3R69 A;  2OCS A;  2I1N A;  1QLC A;  3DIW A;  1OZI A;  4NNM A;  4MPA A;  1VAE A;  5HDY A;  3ID2 A;  1NF3 C;  5IL9 A;  1B8Q A;  1YBO A;  1FCF A;  1V62 A;  1V5L A;  1TP5 A;  2HE2 A;  2UZC A;  1WFV A;  5GND A;  2KPK A;  3MH4 A;  4HOP B;  4REY A;  2OPG A;  3CH8 A;  4K76 A;  2Q9V A;  5JXB A;  2W4F A;  1G9O A;  2LOB A;  3OU0 A;  4NXQ A;  1Z87 A;  3DJ1 A;  1M5Z A;  3KDG A;  1V1T A;  5E1Y A;  3TSW A;  1ZUB A;  2DJT A;  2JXO A;  3GCO A;  4LMM A;  3O46 A;  2M0V A;  1W9E A;  1Q3O A;  1UEZ A;  2M3M A;  3GDV A;  5FB8 C;  2AIN A;  3ID4 A;  2OGP A;  1W9Q A;  1ZOK A;  2AWW A;  1N7E A;  1N7F A;  3QIK A;  5I7Z A;  4NMS A;  4K78 A;  1UFX A;  1TE0 A;  4NMP A;  1FC6 A;  2Z17 A;  3KZE A;  4YYX A;  3GJ9 A;  3PV5 A;  1Y8T A;  1Y7N A;  4Q6H A;  2QBW A;  3KZD A;  2JOA A;  2QT5 A;  2VPH A;  3R68 A;  1Z86 A;  1MFL A;  2EDV A;  2KAW A;  2LC6 A;  1QAV A;  3R0H A;  4UU5 A;  3ID3 A;  2R4H A;  2P3W A;  4GVC A;  3O5N A;  3GDS A;  2PA1 A;  1UEP A;  4YDP A;  3NFL A;  2PKU A;  3RL7 A;  2JWE A;  4WYU A;  2HE4 A;  2DB5 A;  3CYY A;  1X5R A;  2VWR A;  2H3L A;  2FE5 A;  4KFW A;  2HGA A;  3STJ A;  2W7R A;  2OZF A;  4OEP A;  2IWP A;  1WHA A;  1WIF A;  1X8S A;  2CSJ A;  2ENO A;  3VQF A;  3LNY A;  4K72 A;  1SOZ A;  4OAJ A;  2EV8 A;  1PDR A;  1I92 A;  2GEF A;  5B6L A;  4L8N A;  3RL8 A;  5EZ0 A;  4P0C A;  2KPL A;  5HFB A;  1X6D A;  2I0I A;  3K50 A;  1MFG A;  2JIN A;  3QGL A;  4NXP A;  2QKU A;  1I16 A;  4NMR A;  3EGG C;  4OEO A;  4EDJ A;  2M10 A;  1UHP A;  2WL7 A;  2D92 A;  1UEQ A;  5A2P A;  1WHD A;  2L97 A;  3MH7 A;  4E34 A;  4JOJ A;  4G69 A;  1IU0 A;  4Q2P A;  2YT8 A;  2I04 A;  1OBX A;  3GDU A;  4Q2Q A;  3DJ3 A;  2KG2 A;  2M0U A;  2EEJ A;  2CSS A;  2H2B A;  2GZV A;  1OBY A;  2PZD A;  3B76 A;  3TSZ A;  2QG1 A;  2FNE A;  5G1E A;  3HPM A;  2EEI A;  3VQG A;  3TMH A;  3CBX A;  1U38 A;  1U39 A;  1X5N A;  2IWN A;  3NCV A;  2BYG A;  1P1D A;  1RGR A;  1WJL A;  2IWO A;  4JOR A;  2KRG A;  2I6V A;  4Q3H A;  1N6E A;  5E22 A;  1KY9 A;  1T2M A;  3PS4 A;  3PV2 A;  3AXA A;  1IU2 A;  3GAB A;  4Z33 A;  4JOG A;  2KJD A;  2YUB A;  5FHT A;  3SHW A;  3SOE A;  4JOH A;  2D90 A;  2JRE A;  1RZX A;  2EDP A;  4P2A B;  2YTW A;  3GSL A;  3QO6 A;  1BFE A;  4NMV A;  2DC2 A;  5HFE A;  4AMH A;  2L4T A;  4FGM A;  3OTP A;  1V5Q A;  2E7K A;  1LCY A;  5HEY A;  1RY4 A;  1P1E A;  2CS5 A;  3DOR A;  5GLJ A;  3KDK A;  4NNL A;  2DKR A;  2RRM A;  5B42 A;  2OSG A;  2YT7 A;  3EGH C;  5HED A;  2EEH A;  1QAV B;  2LUI A;  2PKT A;  3QJM A;  2OMJ A;  5F3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...