5EYZA

Crystal structure of the ptpn4 pdz domain complexed with the tailored peptide cyto8-retev
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
HDNLVLIRMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLLVRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein phosphatase non-receptor type 4
publication title Molecular Basis of the Interaction of the Human Protein Tyrosine Phosphatase Non-receptor Type 4 (PTPN4) with the Mitogen-activated Protein Kinase p38 gamma.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 20
structure length 93
sequence length 93
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2015-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 5eyzA00
2YUBA 4REYA 4WYUA 1RZXA 2EGOA 1KY9A 1VJ6A 5E21A 1WIFA 3CS0A 4Q2QA 1FCFA 2KA9A 2YT7A 2DAZA 3K82A 1TQ3A 2KPKA 2CSJA 2L4TA 2LUIA 1L6OA 1U38A 4NXRA 4JOGA 3STJA 1K32A 2KAWA 1WJLA 3WKMA 4YYXA 1OBYA 2M0VA 1X6DA 2KBSA 3MH4A 5A2PA 2EDPA 2EEGA 4YDPA 5E11A 1ZUBA 2Z9IA 1U37A 2EGKA 1Y7NA 1WG6A 2OCSA 3HVQC 4NMSA 4Z8JA 2R4HA 1RY4A 5HETA 3K1RA 1VB7A 3ID2A 3O46A 2DMZA 3ID3A 2W4FA 5G1EA 4XHVA 5HFCA 1TP5A 4K78A 1V1TA 2JXOA 4P2AB 2Q3GA 3E17A 3ID1A 1WH1A 4JORA 1V62A 2DM8A 3PV2A 3QJNA 1I16A 2YT8A 2VPHA 3WKLA 2EV8A 4HOPA 5HEDA 3GDVA 4PQWA 2KOJA 2KJPA 3BPUA 2K1ZA 2M3MA 2JREA 1UEQA 5FHTA 3RL8A 1UHPA 4P0CA 1WHDA 2EEIA 1T2MA 2EHRA 3AXAA 2KJKA 1LCYA 2MHOA 3LNXA 2PKTA 3QO6A 5EZ0A 2M10A 5GLJA 5FB8C 4NMOA 1V6BA 3KZDA 3I1EA 2JOAA 3CC0A 4NMTA 2IWNA 2KRGA 2ENOA 4Q6HA 2QKVA 3GCOA 1UEWA 3I18A 2EGNA 2KQFA 4NNLA 4OEPA 2H3MA 1NTEA 2JILA 2OGPA 3SFJA 3CH8A 2OPGA 1G9OA 2QG1A 3GDSA 1W9QA 2JWEA 4KFVA 3R69A 1WHAA 1NF3C 1IHJA 1WF8A 4K72A 2QKTA 2KG2A 1BFEA 1GM1A 2I1NA 1V5QA 2KV8A 1UEPA 4GVDA 2KJDA 4NNMA 1UJVA 2UZCA 2D92A 5B6LA 2E7KA 3SOEA 1Z86A 1WF7A 2ZPMA 1Q3PA 1Q3OA 2I6VA 1OBXA 1IU0A 2EJYA 5HEBA 2L97A 2IWQA 2EDZA 3SHWA 5GNDA 1BE9A 1U39A 2LOBA 3PDZA 4NMRA 3TMHA 2QBWA 2G2LA 2HE4A 1VCWA 3DORA 1X5RA 1I92A 2FE5A 3HPKA 2PDZA 1MFLA 3DJAA 1KWAA 2OMJA 2OS6A 3PDVA 1RGRA 4O06A 5I7ZA 4HOPB 2PNTA 1QAVA 2AWXA 3QIKA 2X7ZA 2IWPA 3TSVA 4Q2OA 1OZIA 3QJMA 3DJ1A 2KPLA 2DC2A 4NMQA 5F3XA 1OBZA 2FCFA 2VRFA 1Q7XA 2KL1A 2QKUA 1Y8TA 1UFXA 1M5ZA 4Q2PA 4N6XA 5F67A 3DJ3A 2EDVA 3PV5A 3EGHC 4L8NA 2DB5A 4RI0A 1P1DA 4R2ZA 3MH7A 2W7RA 2GZVA 1W9OA 5HFDA 1MC7A 4F8KA 2LC6A 1FC6A 3CYYA 5DTHA 3GCNA 2I0IA 4K6YA 1VA8A 1MFGA 3QE1A 4H11A 4NXQA 5D13A 1N7TA 5JXBA 3ID4A 2R3YA 5HJ1A 4JL7A 1V5LA 3SUZA 1UM7A 1VAEA 2H2BA 2M0TA 4E34A 3QGLA 4JOJA 2F5YA 4UU6A 2LC7A 2G5MB 3OU0A 4EDJA 1N6EA 2PZDA 2V90A 1N6DA 2M0UA 1UM1A 2QT5A 2Q9VA 3GSLA 3TSWA 3CBYA 2I04A 4FGMA 4AMHA 1PDRA 2HGAA 3KHFA 1IU2A 2CS5A 2VZ5A 1N7FA 3PV4A 4Q6SA 2KOMA 5HEYA 2FNEA 1N99A 2FN5A 3K50A 4GVCA 2I0LA 4JOEA 1TE0A 4NXPA 2DKRA 4Q3HA 2KOHA 3DIWA 1QAVB 3CBZA 1WFVA 1FC9A 2VSVA 1N7EA 2D90A 1WFGA 2K20A 1TP3A 2M0ZA 5HFEA 1SOTA 4Q2NA 1P1EA 3VQFA 2H2CA 2CSSA 2AWUA 2H3LA 5G1DA 5HF4A 4OAJA 4KFWA 1QAUA 4NMPA 3JXTA 4Z33A 1UEZA 4K76A 3L4FD 1N6FA 2EAQA 2OQSA 2KYLA 5EYZA 3TSZA 1R6JA 1KEFA 2OSGA 1D5GA 2LA8A 4E35A 3OTPA 4GHNA 3ZRTA 2DLUA 3RLEA 2YTWA 4LMMA 1UJUA 5E6PB 1B8QA 1SOZA 1X45A 4JOKA 3CBXA 1W9EA 3I4WA 5HF1A 3NGHA 2YUYA 1UITA 3QDOA 4IC6A 3RL7A 2JINA 2AWWA 1X5NA 3NFKA 2DJTA 5E1YA 1WI4A 2O2TA 3GDUA 1ZOKA 2WL7A 2ZPLA 2RCZA 2VSPA 2Z17A 1Z87A 3NFLA 5HDYA 2OZFA 1RGWA 2P3WA 4JOFA 1U3BA 1GQ5A 5H3JA 2DLSA 3VQGA 4MPAA 2EXGA 2F0AA 3HPMA 3SHUA 1X5QA 2AINA 3GJ9A 4JOPA 2RRMA 2V1WA 2EEHA 5HFFA 1YBOA 4G69A 2REYA 1FC7A 3MH6A 2JIKA 3B76A 1X8SA 1UJDA 3EGGC 3GGEA 2IWOA 1GQ4A 2L4SA 2EEJA 4WYTA 1UF1A 2MX6A 3LNYA 2VWRA 4K75A 4UU5A 4E3BA 2PA1A 1QLCA 2BYGA 5HFBA 3KZEA 2PKUA 1WI2A 2D8IA 4OEOA 2I4SA 4JOHA 3O5NA 3R68A 3R0HA 3PS4A 3FY5A 5E22A 1XZ9A 2HE2A 4NMVA
chains in the Genus database with same CATH superfamily
2YUBA 4REYA 4WYUA 1RZXA 2EGOA 1KY9A 1VJ6A 5E21A 1WIFA 3CS0A 4Q2QA 1FCFA 2KA9A 2YT7A 2DAZA 3K82A 1TQ3A 2KPKA 2CSJA 2L4TA 2LUIA 1L6OA 1U38A 4NXRA 4JOGA 3STJA 1K32A 2KAWA 1WJLA 3WKMA 3KDGA 4YYXA 1OBYA 2M0VA 1X6DA 2KBSA 3MH4A 5A2PA 2EDPA 2EEGA 4YDPA 5E11A 1ZUBA 2Z9IA 1U37A 2EGKA 1Y7NA 1WG6A 2OCSA 3HVQC 4NMSA 4Z8JA 2R4HA 1RY4A 5HETA 3K1RA 1VB7A 3ID2A 3O46A 2DMZA 3ID3A 2W4FA 5G1EA 4XHVA 5HFCA 1TP5A 4K78A 1V1TA 2JXOA 4P2AB 2Q3GA 3E17A 3ID1A 1WH1A 4JORA 1V62A 2DM8A 3PV2A 3QJNA 1I16A 2YT8A 2VPHA 3WKLA 2EV8A 3KDKA 4HOPA 5HEDA 3GDVA 4PQWA 2KOJA 2KJPA 3BPUA 2K1ZA 2M3MA 2JREA 1UEQA 5FHTA 3RL8A 1UHPA 4P0CA 1WHDA 2EEIA 1T2MA 2EHRA 3AXAA 2KJKA 1LCYA 2MHOA 3LNXA 2PKTA 3QO6A 5EZ0A 2M10A 5GLJA 5FB8C 4NMOA 1V6BA 3KZDA 3I1EA 2JOAA 3CC0A 4NMTA 2IWNA 2KRGA 2ENOA 4Q6HA 2QKVA 3GCOA 1UEWA 3I18A 2EGNA 2KQFA 4NNLA 4OEPA 2H3MA 1NTEA 2JILA 2OGPA 3SFJA 3CH8A 2OPGA 1G9OA 2QG1A 3GDSA 1W9QA 2JWEA 4KFVA 3R69A 1WHAA 1NF3C 1IHJA 1WF8A 4K72A 2QKTA 2KG2A 1BFEA 1GM1A 2I1NA 1V5QA 2KV8A 1UEPA 4GVDA 2JSNA 2KJDA 4NNMA 1UJVA 2UZCA 2D92A 5B6LA 2E7KA 3SOEA 1Z86A 1WF7A 2ZPMA 1Q3PA 1Q3OA 2I6VA 1OBXA 1IU0A 2EJYA 5HEBA 2L97A 2IWQA 2EDZA 3SHWA 5B42A 5GNDA 1BE9A 1U39A 2LOBA 3PDZA 4NMRA 3TMHA 2QBWA 2G2LA 2HE4A 1VCWA 3DORA 1X5RA 1I92A 2FE5A 3HPKA 2PDZA 1MFLA 3DJAA 1KWAA 2OMJA 2OS6A 3PDVA 1RGRA 4O06A 5I7ZA 4HOPB 2PNTA 1QAVA 2AWXA 3QIKA 2X7ZA 2IWPA 3TSVA 4Q2OA 1OZIA 3QJMA 3DJ1A 2KPLA 2DC2A 4NMQA 5F3XA 1OBZA 2FCFA 2VRFA 1Q7XA 2KL1A 2QKUA 1Y8TA 1UFXA 1M5ZA 4Q2PA 4N6XA 5F67A 3DJ3A 2EDVA 3PV5A 3EGHC 4L8NA 2DB5A 4RI0A 1P1DA 4R2ZA 3MH7A 2W7RA 2GZVA 1W9OA 5HFDA 1MC7A 4F8KA 2LC6A 1FC6A 3CYYA 5DTHA 3GCNA 2I0IA 4K6YA 1VA8A 3NCVA 1MFGA 3QE1A 4H11A 4NXQA 5D13A 1N7TA 5JXBA 3ID4A 2R3YA 5HJ1A 4JL7A 1V5LA 3SUZA 1UM7A 1VAEA 2H2BA 2M0TA 4E34A 3QGLA 4JOJA 2F5YA 4UU6A 2LC7A 2G5MB 3OU0A 4EDJA 1N6EA 2PZDA 2V90A 1N6DA 2M0UA 1UM1A 2QT5A 2Q9VA 3GSLA 3TSWA 3CBYA 2I04A 4FGMA 4AMHA 1PDRA 2HGAA 3KHFA 1IU2A 2CS5A 2VZ5A 1N7FA 3PV4A 4Q6SA 2KOMA 5HEYA 2FNEA 1N99A 2FN5A 3K50A 4GVCA 2I0LA 4JOEA 1TE0A 4NXPA 2DKRA 4Q3HA 2KOHA 2GEFA 3DIWA 1QAVB 3CBZA 1WFVA 1FC9A 2VSVA 1N7EA 2D90A 1WFGA 2K20A 1TP3A 2M0ZA 5HFEA 1SOTA 4Q2NA 1P1EA 3VQFA 2H2CA 2CSSA 2AWUA 2H3LA 5G1DA 5HF4A 4OAJA 4KFWA 1QAUA 4NMPA 3JXTA 4Z33A 4FLNA 1UEZA 4K76A 3L4FD 1N6FA 2EAQA 2OQSA 2KYLA 5EYZA 3TSZA 1R6JA 1KEFA 2OSGA 1D5GA 2LA8A 4E35A 3OTPA 4GHNA 3ZRTA 2DLUA 3RLEA 2YTWA 4LMMA 1UJUA 5E6PB 1B8QA 1SOZA 1X45A 4JOKA 3CBXA 1W9EA 3I4WA 5HF1A 3NGHA 2YUYA 1UITA 3QDOA 4IC6A 3RL7A 2JINA 2AWWA 1X5NA 3NFKA 2DJTA 5E1YA 1WI4A 5ILBA 2O2TA 3GDUA 1ZOKA 2WL7A 2ZPLA 2RCZA 2VSPA 2Z17A 1Z87A 3NFLA 5HDYA 2OZFA 1RGWA 2P3WA 4JOFA 1U3BA 1GQ5A 5H3JA 4JJ3A 2DLSA 3VQGA 4MPAA 1X9ZA 2EXGA 2F0AA 3HPMA 3GABA 3SHUA 1X5QA 2AINA 3GJ9A 4JOPA 2RRMA 2V1WA 2EEHA 5HFFA 1YBOA 4G69A 2REYA 1FC7A 3MH6A 2JIKA 3B76A 1X8SA 1UJDA 3EGGC 3GGEA 2IWOA 1GQ4A 5IL9A 2L4SA 2EEJA 4WYTA 1UF1A 2MX6A 3LNYA 2VWRA 4K75A 4UU5A 4E3BA 2PA1A 1QLCA 2BYGA 5HFBA 3KZEA 2PKUA 1WI2A 2D8IA 4OEOA 2I4SA 4JOHA 3O5NA 3R68A 3R0HA 3PS4A 3FY5A 5E22A 1XZ9A 4JJ0A 2HE2A 4NMVA
chains in the Genus database with same CATH topology
2YUBA 4REYA 4WYUA 1RZXA 2EGOA 1KY9A 1VJ6A 5E21A 1WIFA 3CS0A 4Q2QA 1FCFA 2KA9A 2YT7A 2DAZA 3K82A 1TQ3A 2KPKA 2CSJA 2L4TA 2LUIA 1L6OA 1U38A 4NXRA 4JOGA 3STJA 1K32A 2KAWA 1WJLA 3WKMA 3KDGA 4YYXA 1OBYA 2M0VA 1X6DA 2KBSA 3MH4A 5A2PA 2EDPA 2EEGA 4YDPA 5E11A 1ZUBA 2Z9IA 1U37A 2EGKA 1Y7NA 1WG6A 2OCSA 3HVQC 4NMSA 4Z8JA 2R4HA 1RY4A 5HETA 3K1RA 1VB7A 3ID2A 3O46A 2DMZA 3ID3A 2W4FA 5G1EA 4XHVA 5HFCA 1TP5A 4K78A 1V1TA 2JXOA 4P2AB 2Q3GA 3E17A 3ID1A 1WH1A 4JORA 1V62A 2DM8A 3PV2A 3QJNA 1I16A 2YT8A 2VPHA 3WKLA 2EV8A 3KDKA 4HOPA 5HEDA 3GDVA 4PQWA 2KOJA 2KJPA 3BPUA 2K1ZA 2M3MA 2JREA 1UEQA 5FHTA 3RL8A 1UHPA 4P0CA 1WHDA 2EEIA 1T2MA 2EHRA 3AXAA 2KJKA 1LCYA 2MHOA 3LNXA 2PKTA 3QO6A 5EZ0A 2M10A 5GLJA 5FB8C 4NMOA 1V6BA 3KZDA 3I1EA 2JOAA 3CC0A 4NMTA 2IWNA 2KRGA 2ENOA 4Q6HA 2QKVA 3GCOA 1UEWA 3I18A 2EGNA 2KQFA 4NNLA 4OEPA 2H3MA 1NTEA 2JILA 2OGPA 3SFJA 3CH8A 2OPGA 1G9OA 2QG1A 3GDSA 1W9QA 2JWEA 4KFVA 3R69A 1WHAA 1NF3C 1IHJA 1WF8A 4K72A 2QKTA 2KG2A 1BFEA 1GM1A 2I1NA 1V5QA 2KV8A 1UEPA 4GVDA 2JSNA 2KJDA 4NNMA 1UJVA 2UZCA 2D92A 5B6LA 2E7KA 3SOEA 1Z86A 1WF7A 2ZPMA 1Q3PA 1Q3OA 2I6VA 1OBXA 1IU0A 2EJYA 5HEBA 2L97A 2IWQA 2EDZA 3SHWA 5B42A 5GNDA 1BE9A 1U39A 2LOBA 3PDZA 4NMRA 3TMHA 2QBWA 2G2LA 2HE4A 1VCWA 3DORA 1X5RA 1I92A 2FE5A 3HPKA 2PDZA 1MFLA 3DJAA 1KWAA 2OMJA 2OS6A 3PDVA 1RGRA 4O06A 5I7ZA 4HOPB 2PNTA 1QAVA 2AWXA 3QIKA 2X7ZA 2IWPA 3TSVA 4Q2OA 1OZIA 3QJMA 3DJ1A 2KPLA 2DC2A 4NMQA 5F3XA 1OBZA 2FCFA 2VRFA 1Q7XA 2KL1A 2QKUA 1Y8TA 1UFXA 1M5ZA 4Q2PA 4N6XA 5F67A 3DJ3A 2EDVA 3PV5A 3EGHC 4L8NA 2DB5A 4RI0A 1P1DA 4R2ZA 3MH7A 2W7RA 2GZVA 1W9OA 5HFDA 1MC7A 4F8KA 2LC6A 1FC6A 3CYYA 5DTHA 3GCNA 2I0IA 4K6YA 1VA8A 3NCVA 1MFGA 3QE1A 4H11A 4NXQA 5D13A 1N7TA 5JXBA 3ID4A 2R3YA 5HJ1A 4JL7A 1V5LA 3SUZA 1UM7A 1VAEA 2H2BA 2M0TA 4E34A 3QGLA 4JOJA 2F5YA 4UU6A 2LC7A 2G5MB 3OU0A 4EDJA 1N6EA 2PZDA 2V90A 1N6DA 2M0UA 1UM1A 2QT5A 2Q9VA 3GSLA 3TSWA 3CBYA 2I04A 4FGMA 4AMHA 1PDRA 2HGAA 3KHFA 1IU2A 2CS5A 2VZ5A 1N7FA 3PV4A 4Q6SA 2KOMA 5HEYA 2FNEA 1N99A 2FN5A 3K50A 4GVCA 2I0LA 4JOEA 1TE0A 4NXPA 2DKRA 4Q3HA 2KOHA 2GEFA 3DIWA 1QAVB 3CBZA 1WFVA 1FC9A 2VSVA 1N7EA 2D90A 1WFGA 2K20A 1TP3A 2M0ZA 5HFEA 1SOTA 4Q2NA 1P1EA 3VQFA 2H2CA 2CSSA 2AWUA 2H3LA 5G1DA 5HF4A 4OAJA 4KFWA 1QAUA 4NMPA 3JXTA 4Z33A 4FLNA 1UEZA 4K76A 3L4FD 1N6FA 2EAQA 2OQSA 2KYLA 5EYZA 3TSZA 1R6JA 1KEFA 2OSGA 1D5GA 2LA8A 4E35A 3OTPA 4GHNA 3ZRTA 2DLUA 3RLEA 2YTWA 4LMMA 1UJUA 5E6PB 1B8QA 1SOZA 1X45A 4JOKA 3CBXA 1W9EA 3I4WA 5HF1A 3NGHA 2YUYA 1UITA 3QDOA 4IC6A 3RL7A 2JINA 2AWWA 1X5NA 3NFKA 2DJTA 5E1YA 1WI4A 5ILBA 2O2TA 3GDUA 1ZOKA 2WL7A 2ZPLA 2RCZA 2VSPA 2Z17A 1Z87A 3NFLA 5HDYA 2OZFA 1RGWA 2P3WA 4JOFA 1U3BA 1GQ5A 5H3JA 4JJ3A 2DLSA 3VQGA 4MPAA 1X9ZA 2EXGA 2F0AA 3HPMA 3GABA 3SHUA 1X5QA 2AINA 3GJ9A 4JOPA 2RRMA 2V1WA 2EEHA 5HFFA 1YBOA 4G69A 2REYA 1FC7A 3MH6A 2JIKA 3B76A 1X8SA 1UJDA 3EGGC 3GGEA 2IWOA 1GQ4A 5IL9A 2L4SA 2EEJA 4WYTA 1UF1A 2MX6A 3LNYA 2VWRA 4K75A 4UU5A 4E3BA 2PA1A 1QLCA 2BYGA 5HFBA 3KZEA 2PKUA 1WI2A 2D8IA 4OEOA 2I4SA 4JOHA 3O5NA 3R68A 3R0HA 3PS4A 3FY5A 5E22A 1XZ9A 4JJ0A 2HE2A 4NMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUB A;  4REY A;  4WYU A;  1RZX A;  2EGO A;  1KY9 A;  1VJ6 A;  5E21 A;  1WIF A;  3CS0 A;  4Q2Q A;  1FCF A;  2KA9 A;  2YT7 A;  2DAZ A;  3K82 A;  1TQ3 A;  2KPK A;  2CSJ A;  2L4T A;  2LUI A;  1L6O A;  1U38 A;  4NXR A;  4JOG A;  3STJ A;  1K32 A;  2KAW A;  1WJL A;  3WKM A;  4YYX A;  1OBY A;  2M0V A;  1X6D A;  2KBS A;  3MH4 A;  5A2P A;  2EDP A;  2EEG A;  4YDP A;  5E11 A;  1ZUB A;  2Z9I A;  1U37 A;  2EGK A;  1Y7N A;  1WG6 A;  2OCS A;  3HVQ C;  4NMS A;  4Z8J A;  2R4H A;  1RY4 A;  5HET A;  3K1R A;  1VB7 A;  3ID2 A;  3O46 A;  2DMZ A;  3ID3 A;  2W4F A;  5G1E A;  4XHV A;  5HFC A;  1TP5 A;  4K78 A;  1V1T A;  2JXO A;  4P2A B;  2Q3G A;  3E17 A;  3ID1 A;  1WH1 A;  4JOR A;  1V62 A;  2DM8 A;  3PV2 A;  3QJN A;  1I16 A;  2YT8 A;  2VPH A;  3WKL A;  2EV8 A;  4HOP A;  5HED A;  3GDV A;  4PQW A;  2KOJ A;  2KJP A;  3BPU A;  2K1Z A;  2M3M A;  2JRE A;  1UEQ A;  5FHT A;  3RL8 A;  1UHP A;  4P0C A;  1WHD A;  2EEI A;  1T2M A;  2EHR A;  3AXA A;  2KJK A;  1LCY A;  2MHO A;  3LNX A;  2PKT A;  3QO6 A;  5EZ0 A;  2M10 A;  5GLJ A;  5FB8 C;  4NMO A;  1V6B A;  3KZD A;  3I1E A;  2JOA A;  3CC0 A;  4NMT A;  2IWN A;  2KRG A;  2ENO A;  4Q6H A;  2QKV A;  3GCO A;  1UEW A;  3I18 A;  2EGN A;  2KQF A;  4NNL A;  4OEP A;  2H3M A;  1NTE A;  2JIL A;  2OGP A;  3SFJ A;  3CH8 A;  2OPG A;  1G9O A;  2QG1 A;  3GDS A;  1W9Q A;  2JWE A;  4KFV A;  3R69 A;  1WHA A;  1NF3 C;  1IHJ A;  1WF8 A;  4K72 A;  2QKT A;  2KG2 A;  1BFE A;  1GM1 A;  2I1N A;  1V5Q A;  2KV8 A;  1UEP A;  4GVD A;  2KJD A;  4NNM A;  1UJV A;  2UZC A;  2D92 A;  5B6L A;  2E7K A;  3SOE A;  1Z86 A;  1WF7 A;  2ZPM A;  1Q3P A;  1Q3O A;  2I6V A;  1OBX A;  1IU0 A;  2EJY A;  5HEB A;  2L97 A;  2IWQ A;  2EDZ A;  3SHW A;  5GND A;  1BE9 A;  1U39 A;  2LOB A;  3PDZ A;  4NMR A;  3TMH A;  2QBW A;  2G2L A;  2HE4 A;  1VCW A;  3DOR A;  1X5R A;  1I92 A;  2FE5 A;  3HPK A;  2PDZ A;  1MFL A;  3DJA A;  1KWA A;  2OMJ A;  2OS6 A;  3PDV A;  1RGR A;  4O06 A;  5I7Z A;  4HOP B;  2PNT A;  1QAV A;  2AWX A;  3QIK A;  2X7Z A;  2IWP A;  3TSV A;  4Q2O A;  1OZI A;  3QJM A;  3DJ1 A;  2KPL A;  2DC2 A;  4NMQ A;  5F3X A;  1OBZ A;  2FCF A;  2VRF A;  1Q7X A;  2KL1 A;  2QKU A;  1Y8T A;  1UFX A;  1M5Z A;  4Q2P A;  4N6X A;  5F67 A;  3DJ3 A;  2EDV A;  3PV5 A;  3EGH C;  4L8N A;  2DB5 A;  4RI0 A;  1P1D A;  4R2Z A;  3MH7 A;  2W7R A;  2GZV A;  1W9O A;  5HFD A;  1MC7 A;  4F8K A;  2LC6 A;  1FC6 A;  3CYY A;  5DTH A;  3GCN A;  2I0I A;  4K6Y A;  1VA8 A;  1MFG A;  3QE1 A;  4H11 A;  4NXQ A;  5D13 A;  1N7T A;  5JXB A;  3ID4 A;  2R3Y A;  5HJ1 A;  4JL7 A;  1V5L A;  3SUZ A;  1UM7 A;  1VAE A;  2H2B A;  2M0T A;  4E34 A;  3QGL A;  4JOJ A;  2F5Y A;  4UU6 A;  2LC7 A;  2G5M B;  3OU0 A;  4EDJ A;  1N6E A;  2PZD A;  2V90 A;  1N6D A;  2M0U A;  1UM1 A;  2QT5 A;  2Q9V A;  3GSL A;  3TSW A;  3CBY A;  2I04 A;  4FGM A;  4AMH A;  1PDR A;  2HGA A;  3KHF A;  1IU2 A;  2CS5 A;  2VZ5 A;  1N7F A;  3PV4 A;  4Q6S A;  2KOM A;  5HEY A;  2FNE A;  1N99 A;  2FN5 A;  3K50 A;  4GVC A;  2I0L A;  4JOE A;  1TE0 A;  4NXP A;  2DKR A;  4Q3H A;  2KOH A;  3DIW A;  1QAV B;  3CBZ A;  1WFV A;  1FC9 A;  2VSV A;  1N7E A;  2D90 A;  1WFG A;  2K20 A;  1TP3 A;  2M0Z A;  5HFE A;  1SOT A;  4Q2N A;  1P1E A;  3VQF A;  2H2C A;  2CSS A;  2AWU A;  2H3L A;  5G1D A;  5HF4 A;  4OAJ A;  4KFW A;  1QAU A;  4NMP A;  3JXT A;  4Z33 A;  1UEZ A;  4K76 A;  3L4F D;  1N6F A;  2EAQ A;  2OQS A;  2KYL A;  5EYZ A;  3TSZ A;  1R6J A;  1KEF A;  2OSG A;  1D5G A;  2LA8 A;  4E35 A;  3OTP A;  4GHN A;  3ZRT A;  2DLU A;  3RLE A;  2YTW A;  4LMM A;  1UJU A;  5E6P B;  1B8Q A;  1SOZ A;  1X45 A;  4JOK A;  3CBX A;  1W9E A;  3I4W A;  5HF1 A;  3NGH A;  2YUY A;  1UIT A;  3QDO A;  4IC6 A;  3RL7 A;  2JIN A;  2AWW A;  1X5N A;  3NFK A;  2DJT A;  5E1Y A;  1WI4 A;  2O2T A;  3GDU A;  1ZOK A;  2WL7 A;  2ZPL A;  2RCZ A;  2VSP A;  2Z17 A;  1Z87 A;  3NFL A;  5HDY A;  2OZF A;  1RGW A;  2P3W A;  4JOF A;  1U3B A;  1GQ5 A;  5H3J A;  2DLS A;  3VQG A;  4MPA A;  2EXG A;  2F0A A;  3HPM A;  3SHU A;  1X5Q A;  2AIN A;  3GJ9 A;  4JOP A;  2RRM A;  2V1W A;  2EEH A;  5HFF A;  1YBO A;  4G69 A;  2REY A;  1FC7 A;  3MH6 A;  2JIK A;  3B76 A;  1X8S A;  1UJD A;  3EGG C;  3GGE A;  2IWO A;  1GQ4 A;  2L4S A;  2EEJ A;  4WYT A;  1UF1 A;  2MX6 A;  3LNY A;  2VWR A;  4K75 A;  4UU5 A;  4E3B A;  2PA1 A;  1QLC A;  2BYG A;  5HFB A;  3KZE A;  2PKU A;  1WI2 A;  2D8I A;  4OEO A;  2I4S A;  4JOH A;  3O5N A;  3R68 A;  3R0H A;  3PS4 A;  3FY5 A;  5E22 A;  1XZ9 A;  2HE2 A;  4NMV A; 
#chains in the Genus database with same CATH topology
 2YUB A;  4REY A;  4WYU A;  1RZX A;  2EGO A;  1KY9 A;  1VJ6 A;  5E21 A;  1WIF A;  3CS0 A;  4Q2Q A;  1FCF A;  2KA9 A;  2YT7 A;  2DAZ A;  3K82 A;  1TQ3 A;  2KPK A;  2CSJ A;  2L4T A;  2LUI A;  1L6O A;  1U38 A;  4NXR A;  4JOG A;  3STJ A;  1K32 A;  2KAW A;  1WJL A;  3WKM A;  3KDG A;  4YYX A;  1OBY A;  2M0V A;  1X6D A;  2KBS A;  3MH4 A;  5A2P A;  2EDP A;  2EEG A;  4YDP A;  5E11 A;  1ZUB A;  2Z9I A;  1U37 A;  2EGK A;  1Y7N A;  1WG6 A;  2OCS A;  3HVQ C;  4NMS A;  4Z8J A;  2R4H A;  1RY4 A;  5HET A;  3K1R A;  1VB7 A;  3ID2 A;  3O46 A;  2DMZ A;  3ID3 A;  2W4F A;  5G1E A;  4XHV A;  5HFC A;  1TP5 A;  4K78 A;  1V1T A;  2JXO A;  4P2A B;  2Q3G A;  3E17 A;  3ID1 A;  1WH1 A;  4JOR A;  1V62 A;  2DM8 A;  3PV2 A;  3QJN A;  1I16 A;  2YT8 A;  2VPH A;  3WKL A;  2EV8 A;  3KDK A;  4HOP A;  5HED A;  3GDV A;  4PQW A;  2KOJ A;  2KJP A;  3BPU A;  2K1Z A;  2M3M A;  2JRE A;  1UEQ A;  5FHT A;  3RL8 A;  1UHP A;  4P0C A;  1WHD A;  2EEI A;  1T2M A;  2EHR A;  3AXA A;  2KJK A;  1LCY A;  2MHO A;  3LNX A;  2PKT A;  3QO6 A;  5EZ0 A;  2M10 A;  5GLJ A;  5FB8 C;  4NMO A;  1V6B A;  3KZD A;  3I1E A;  2JOA A;  3CC0 A;  4NMT A;  2IWN A;  2KRG A;  2ENO A;  4Q6H A;  2QKV A;  3GCO A;  1UEW A;  3I18 A;  2EGN A;  2KQF A;  4NNL A;  4OEP A;  2H3M A;  1NTE A;  2JIL A;  2OGP A;  3SFJ A;  3CH8 A;  2OPG A;  1G9O A;  2QG1 A;  3GDS A;  1W9Q A;  2JWE A;  4KFV A;  3R69 A;  1WHA A;  1NF3 C;  1IHJ A;  1WF8 A;  4K72 A;  2QKT A;  2KG2 A;  1BFE A;  1GM1 A;  2I1N A;  1V5Q A;  2KV8 A;  1UEP A;  4GVD A;  2JSN A;  2KJD A;  4NNM A;  1UJV A;  2UZC A;  2D92 A;  5B6L A;  2E7K A;  3SOE A;  1Z86 A;  1WF7 A;  2ZPM A;  1Q3P A;  1Q3O A;  2I6V A;  1OBX A;  1IU0 A;  2EJY A;  5HEB A;  2L97 A;  2IWQ A;  2EDZ A;  3SHW A;  5B42 A;  5GND A;  1BE9 A;  1U39 A;  2LOB A;  3PDZ A;  4NMR A;  3TMH A;  2QBW A;  2G2L A;  2HE4 A;  1VCW A;  3DOR A;  1X5R A;  1I92 A;  2FE5 A;  3HPK A;  2PDZ A;  1MFL A;  3DJA A;  1KWA A;  2OMJ A;  2OS6 A;  3PDV A;  1RGR A;  4O06 A;  5I7Z A;  4HOP B;  2PNT A;  1QAV A;  2AWX A;  3QIK A;  2X7Z A;  2IWP A;  3TSV A;  4Q2O A;  1OZI A;  3QJM A;  3DJ1 A;  2KPL A;  2DC2 A;  4NMQ A;  5F3X A;  1OBZ A;  2FCF A;  2VRF A;  1Q7X A;  2KL1 A;  2QKU A;  1Y8T A;  1UFX A;  1M5Z A;  4Q2P A;  4N6X A;  5F67 A;  3DJ3 A;  2EDV A;  3PV5 A;  3EGH C;  4L8N A;  2DB5 A;  4RI0 A;  1P1D A;  4R2Z A;  3MH7 A;  2W7R A;  2GZV A;  1W9O A;  5HFD A;  1MC7 A;  4F8K A;  2LC6 A;  1FC6 A;  3CYY A;  5DTH A;  3GCN A;  2I0I A;  4K6Y A;  1VA8 A;  3NCV A;  1MFG A;  3QE1 A;  4H11 A;  4NXQ A;  5D13 A;  1N7T A;  5JXB A;  3ID4 A;  2R3Y A;  5HJ1 A;  4JL7 A;  1V5L A;  3SUZ A;  1UM7 A;  1VAE A;  2H2B A;  2M0T A;  4E34 A;  3QGL A;  4JOJ A;  2F5Y A;  4UU6 A;  2LC7 A;  2G5M B;  3OU0 A;  4EDJ A;  1N6E A;  2PZD A;  2V90 A;  1N6D A;  2M0U A;  1UM1 A;  2QT5 A;  2Q9V A;  3GSL A;  3TSW A;  3CBY A;  2I04 A;  4FGM A;  4AMH A;  1PDR A;  2HGA A;  3KHF A;  1IU2 A;  2CS5 A;  2VZ5 A;  1N7F A;  3PV4 A;  4Q6S A;  2KOM A;  5HEY A;  2FNE A;  1N99 A;  2FN5 A;  3K50 A;  4GVC A;  2I0L A;  4JOE A;  1TE0 A;  4NXP A;  2DKR A;  4Q3H A;  2KOH A;  2GEF A;  3DIW A;  1QAV B;  3CBZ A;  1WFV A;  1FC9 A;  2VSV A;  1N7E A;  2D90 A;  1WFG A;  2K20 A;  1TP3 A;  2M0Z A;  5HFE A;  1SOT A;  4Q2N A;  1P1E A;  3VQF A;  2H2C A;  2CSS A;  2AWU A;  2H3L A;  5G1D A;  5HF4 A;  4OAJ A;  4KFW A;  1QAU A;  4NMP A;  3JXT A;  4Z33 A;  4FLN A;  1UEZ A;  4K76 A;  3L4F D;  1N6F A;  2EAQ A;  2OQS A;  2KYL A;  5EYZ A;  3TSZ A;  1R6J A;  1KEF A;  2OSG A;  1D5G A;  2LA8 A;  4E35 A;  3OTP A;  4GHN A;  3ZRT A;  2DLU A;  3RLE A;  2YTW A;  4LMM A;  1UJU A;  5E6P B;  1B8Q A;  1SOZ A;  1X45 A;  4JOK A;  3CBX A;  1W9E A;  3I4W A;  5HF1 A;  3NGH A;  2YUY A;  1UIT A;  3QDO A;  4IC6 A;  3RL7 A;  2JIN A;  2AWW A;  1X5N A;  3NFK A;  2DJT A;  5E1Y A;  1WI4 A;  5ILB A;  2O2T A;  3GDU A;  1ZOK A;  2WL7 A;  2ZPL A;  2RCZ A;  2VSP A;  2Z17 A;  1Z87 A;  3NFL A;  5HDY A;  2OZF A;  1RGW A;  2P3W A;  4JOF A;  1U3B A;  1GQ5 A;  5H3J A;  4JJ3 A;  2DLS A;  3VQG A;  4MPA A;  1X9Z A;  2EXG A;  2F0A A;  3HPM A;  3GAB A;  3SHU A;  1X5Q A;  2AIN A;  3GJ9 A;  4JOP A;  2RRM A;  2V1W A;  2EEH A;  5HFF A;  1YBO A;  4G69 A;  2REY A;  1FC7 A;  3MH6 A;  2JIK A;  3B76 A;  1X8S A;  1UJD A;  3EGG C;  3GGE A;  2IWO A;  1GQ4 A;  5IL9 A;  2L4S A;  2EEJ A;  4WYT A;  1UF1 A;  2MX6 A;  3LNY A;  2VWR A;  4K75 A;  4UU5 A;  4E3B A;  2PA1 A;  1QLC A;  2BYG A;  5HFB A;  3KZE A;  2PKU A;  1WI2 A;  2D8I A;  4OEO A;  2I4S A;  4JOH A;  3O5N A;  3R68 A;  3R0H A;  3PS4 A;  3FY5 A;  5E22 A;  1XZ9 A;  4JJ0 A;  2HE2 A;  4NMV A; 
#chains in the Genus database with same CATH homology
 2YUB A;  4REY A;  4WYU A;  1RZX A;  2EGO A;  1KY9 A;  1VJ6 A;  5E21 A;  1WIF A;  3CS0 A;  4Q2Q A;  1FCF A;  2KA9 A;  2YT7 A;  2DAZ A;  3K82 A;  1TQ3 A;  2KPK A;  2CSJ A;  2L4T A;  2LUI A;  1L6O A;  1U38 A;  4NXR A;  4JOG A;  3STJ A;  1K32 A;  2KAW A;  1WJL A;  3WKM A;  3KDG A;  4YYX A;  1OBY A;  2M0V A;  1X6D A;  2KBS A;  3MH4 A;  5A2P A;  2EDP A;  2EEG A;  4YDP A;  5E11 A;  1ZUB A;  2Z9I A;  1U37 A;  2EGK A;  1Y7N A;  1WG6 A;  2OCS A;  3HVQ C;  4NMS A;  4Z8J A;  2R4H A;  1RY4 A;  5HET A;  3K1R A;  1VB7 A;  3ID2 A;  3O46 A;  2DMZ A;  3ID3 A;  2W4F A;  5G1E A;  4XHV A;  5HFC A;  1TP5 A;  4K78 A;  1V1T A;  2JXO A;  4P2A B;  2Q3G A;  3E17 A;  3ID1 A;  1WH1 A;  4JOR A;  1V62 A;  2DM8 A;  3PV2 A;  3QJN A;  1I16 A;  2YT8 A;  2VPH A;  3WKL A;  2EV8 A;  3KDK A;  4HOP A;  5HED A;  3GDV A;  4PQW A;  2KOJ A;  2KJP A;  3BPU A;  2K1Z A;  2M3M A;  2JRE A;  1UEQ A;  5FHT A;  3RL8 A;  1UHP A;  4P0C A;  1WHD A;  2EEI A;  1T2M A;  2EHR A;  3AXA A;  2KJK A;  1LCY A;  2MHO A;  3LNX A;  2PKT A;  3QO6 A;  5EZ0 A;  2M10 A;  5GLJ A;  5FB8 C;  4NMO A;  1V6B A;  3KZD A;  3I1E A;  2JOA A;  3CC0 A;  4NMT A;  2IWN A;  2KRG A;  2ENO A;  4Q6H A;  2QKV A;  3GCO A;  1UEW A;  3I18 A;  2EGN A;  2KQF A;  4NNL A;  4OEP A;  2H3M A;  1NTE A;  2JIL A;  2OGP A;  3SFJ A;  3CH8 A;  2OPG A;  1G9O A;  2QG1 A;  3GDS A;  1W9Q A;  2JWE A;  4KFV A;  3R69 A;  1WHA A;  1NF3 C;  1IHJ A;  1WF8 A;  4K72 A;  2QKT A;  2KG2 A;  1BFE A;  1GM1 A;  2I1N A;  1V5Q A;  2KV8 A;  1UEP A;  4GVD A;  2JSN A;  2KJD A;  4NNM A;  1UJV A;  2UZC A;  2D92 A;  5B6L A;  2E7K A;  3SOE A;  1Z86 A;  1WF7 A;  2ZPM A;  1Q3P A;  1Q3O A;  2I6V A;  1OBX A;  1IU0 A;  2EJY A;  5HEB A;  2L97 A;  2IWQ A;  2EDZ A;  3SHW A;  5B42 A;  5GND A;  1BE9 A;  1U39 A;  2LOB A;  3PDZ A;  4NMR A;  3TMH A;  2QBW A;  2G2L A;  2HE4 A;  1VCW A;  3DOR A;  1X5R A;  1I92 A;  2FE5 A;  3HPK A;  2PDZ A;  1MFL A;  3DJA A;  1KWA A;  2OMJ A;  2OS6 A;  3PDV A;  1RGR A;  4O06 A;  5I7Z A;  4HOP B;  2PNT A;  1QAV A;  2AWX A;  3QIK A;  2X7Z A;  2IWP A;  3TSV A;  4Q2O A;  1OZI A;  3QJM A;  3DJ1 A;  2KPL A;  2DC2 A;  4NMQ A;  5F3X A;  1OBZ A;  2FCF A;  2VRF A;  1Q7X A;  2KL1 A;  2QKU A;  1Y8T A;  1UFX A;  1M5Z A;  4Q2P A;  4N6X A;  5F67 A;  3DJ3 A;  2EDV A;  3PV5 A;  3EGH C;  4L8N A;  2DB5 A;  4RI0 A;  1P1D A;  4R2Z A;  3MH7 A;  2W7R A;  2GZV A;  1W9O A;  5HFD A;  1MC7 A;  4F8K A;  2LC6 A;  1FC6 A;  3CYY A;  5DTH A;  3GCN A;  2I0I A;  4K6Y A;  1VA8 A;  3NCV A;  1MFG A;  3QE1 A;  4H11 A;  4NXQ A;  5D13 A;  1N7T A;  5JXB A;  3ID4 A;  2R3Y A;  5HJ1 A;  4JL7 A;  1V5L A;  3SUZ A;  1UM7 A;  1VAE A;  2H2B A;  2M0T A;  4E34 A;  3QGL A;  4JOJ A;  2F5Y A;  4UU6 A;  2LC7 A;  2G5M B;  3OU0 A;  4EDJ A;  1N6E A;  2PZD A;  2V90 A;  1N6D A;  2M0U A;  1UM1 A;  2QT5 A;  2Q9V A;  3GSL A;  3TSW A;  3CBY A;  2I04 A;  4FGM A;  4AMH A;  1PDR A;  2HGA A;  3KHF A;  1IU2 A;  2CS5 A;  2VZ5 A;  1N7F A;  3PV4 A;  4Q6S A;  2KOM A;  5HEY A;  2FNE A;  1N99 A;  2FN5 A;  3K50 A;  4GVC A;  2I0L A;  4JOE A;  1TE0 A;  4NXP A;  2DKR A;  4Q3H A;  2KOH A;  2GEF A;  3DIW A;  1QAV B;  3CBZ A;  1WFV A;  1FC9 A;  2VSV A;  1N7E A;  2D90 A;  1WFG A;  2K20 A;  1TP3 A;  2M0Z A;  5HFE A;  1SOT A;  4Q2N A;  1P1E A;  3VQF A;  2H2C A;  2CSS A;  2AWU A;  2H3L A;  5G1D A;  5HF4 A;  4OAJ A;  4KFW A;  1QAU A;  4NMP A;  3JXT A;  4Z33 A;  4FLN A;  1UEZ A;  4K76 A;  3L4F D;  1N6F A;  2EAQ A;  2OQS A;  2KYL A;  5EYZ A;  3TSZ A;  1R6J A;  1KEF A;  2OSG A;  1D5G A;  2LA8 A;  4E35 A;  3OTP A;  4GHN A;  3ZRT A;  2DLU A;  3RLE A;  2YTW A;  4LMM A;  1UJU A;  5E6P B;  1B8Q A;  1SOZ A;  1X45 A;  4JOK A;  3CBX A;  1W9E A;  3I4W A;  5HF1 A;  3NGH A;  2YUY A;  1UIT A;  3QDO A;  4IC6 A;  3RL7 A;  2JIN A;  2AWW A;  1X5N A;  3NFK A;  2DJT A;  5E1Y A;  1WI4 A;  5ILB A;  2O2T A;  3GDU A;  1ZOK A;  2WL7 A;  2ZPL A;  2RCZ A;  2VSP A;  2Z17 A;  1Z87 A;  3NFL A;  5HDY A;  2OZF A;  1RGW A;  2P3W A;  4JOF A;  1U3B A;  1GQ5 A;  5H3J A;  4JJ3 A;  2DLS A;  3VQG A;  4MPA A;  1X9Z A;  2EXG A;  2F0A A;  3HPM A;  3GAB A;  3SHU A;  1X5Q A;  2AIN A;  3GJ9 A;  4JOP A;  2RRM A;  2V1W A;  2EEH A;  5HFF A;  1YBO A;  4G69 A;  2REY A;  1FC7 A;  3MH6 A;  2JIK A;  3B76 A;  1X8S A;  1UJD A;  3EGG C;  3GGE A;  2IWO A;  1GQ4 A;  5IL9 A;  2L4S A;  2EEJ A;  4WYT A;  1UF1 A;  2MX6 A;  3LNY A;  2VWR A;  4K75 A;  4UU5 A;  4E3B A;  2PA1 A;  1QLC A;  2BYG A;  5HFB A;  3KZE A;  2PKU A;  1WI2 A;  2D8I A;  4OEO A;  2I4S A;  4JOH A;  3O5N A;  3R68 A;  3R0H A;  3PS4 A;  3FY5 A;  5E22 A;  1XZ9 A;  4JJ0 A;  2HE2 A;  4NMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...