1X6DA

Solution structures of the pdz domain of human interleukin-16
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
119
structure length
119
Chain Sequence
GSSGSSGATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVITVHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTPEAMPDLNSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-16
publication title Solution structures of the PDZ domain of human Interleukin-16
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1x6dA01
2EGOA 3K82A 3JXTA 1TQ3A 3ID2A 4Q3HA 2M0ZA 2I0LA 1N99A 1WF7A 2FE5A 5HFEA 1IU2A 2W7RA 5H3JA 1LCYA 4NMVA 2KBSA 4K72A 2KOMA 3GDUA 2CS5A 2VZ5A 2EJYA 2EDPA 2AWXA 2QKTA 2EDZA 1UM1A 1VAEA 2LC6A 1L6OA 2CSSA 2F5YA 5HFDA 1V5QA 2I1NA 4NMRA 4NMSA 5HF4A 3STJA 2ZPLA 2G2LA 2OMJA 2L4SA 1UF1A 1GQ4A 2G5MB 2RRMA 4H11A 1QAVB 2M0VA 2K20A 2YT8A 2FCFA 2LC7A 1X45A 1U38A 1RGWA 2I0IA 2KJPA 1FC6A 2JOAA 3MH6A 1FCFA 4KFVA 3TSVA 1WG6A 1IU0A 3PV4A 4LMMA 2RCZA 4XHVA 2H3LA 2QBWA 3GGEA 1QAVA 2GZVA 1SOZA 5E11A 5HF1A 3CBZA 2JINA 3HPMA 3GCNA 5HDYA 3QO6A 1UFXA 3VQFA 1QLCA 1Y8TA 5E22A 2DC2A 2HE2A 2EEGA 2EEHA 2EXGA 2D92A 4NXRA 5G1EA 1UEWA 1VA8A 1Y7NA 3R68A 4Q2OA 2KYLA 3SFJA 1GM1A 1TP3A 3K50A 2EHRA 4K78A 2BYGA 1NF3C 3ID1A 2YUBA 4NNMA 3O5NA 4KFWA 3VQGA 4EDJA 3OU0A 3DJAA 4Q2PA 5HEYA 3NGHA 3CC0A 2PA1A 3QIKA 3SOEA 2M0TA 1I16A 5F3XA 4OEOA 1NTEA 4E35A 2KPKA 2P3WA 4E34A 1WJLA 5HJ1A 1X6DA 1K32A 2CSJA 3LNYA 4Z33A 4N6XA 4NNLA 1UEQA 2D8IA 1P1DA 3GCOA 1UITA 3KZEA 3CYYA 5FB8C 3ID3A 2QT5A 2QKUA 2KAWA 2KJDA 5HFCA 3MH4A 5B6LA 3BPUA 3I18A 1Z87A 2PKUA 1FC7A 2KV8A 4JL7A 3PV5A 2LUIA 2AWUA 2KOJA 1OBXA 4P0CA 4MPAA 5F67A 2DLSA 4JOHA 2VRFA 2JREA 1Z86A 2IWNA 5G1DA 1WI2A 4K6YA 4Q2NA 5FHTA 2OQSA 3I1EA 2DB5A 3CS0A 5E21A 3ZRTA 2IWQA 2LOBA 1IHJA 1VCWA 1WH1A 2HGAA 3PDVA 1Q3OA 1FC9A 5D13A 1UHPA 1BE9A 3RL7A 1WI4A 3CBYA 4K75A 2DAZA 1MFLA 2D90A 3RL8A 4GVDA 1UEZA 1UJDA 2JWEA 1X5NA 3L4FD 2L4TA 2I6VA 1XZ9A 4F8KA 2DM8A 2KA9A 2WL7A 4AMHA 3TSWA 1X5RA 2MHOA 2K1ZA 2FNEA 3DJ1A 2EV8A 1MC7A 1PDRA 2H2BA 1N6EA 4Z8JA 3NFKA 2YT7A 3I4WA 2I4SA 2M10A 2OPGA 4L8NA 5HEDA 2YUYA 5A2PA 4JOFA 2L97A 4UU6A 2KG2A 2I04A 1B8QA 2E7KA 3GDVA 3HVQC 1UJUA 3KHFA 3MH7A 1W9OA 1G9OA 1RZXA 1R6JA 4HOPB 2OCSA 2M0UA 2EAQA 4JOGA 2OSGA 1V5LA 1OZIA 1WHAA 3E17A 3SHUA 2Z9IA 3DIWA 5GNDA 2JIKA 4RI0A 4NMTA 2O2TA 2EDVA 4WYUA 1RGRA 3PS4A 2OS6A 1D5GA 4HOPA 5EYZA 1N7FA 3K1RA 2R3YA 1N6DA 2QG1A 2KJKA 4Q6HA 2PKTA 2KQFA 1KWAA 2PNTA 1Q3PA 3QGLA 5HFFA 1RY4A 3RLEA 4WYTA 2VWRA 1WIFA 5HEBA 2JXOA 2Z17A 2KL1A 3SHWA 1WFVA 4O06A 4PQWA 2M3MA 5EZ0A 2H3MA 3QJNA 2KOHA 2IWPA 2V90A 3AXAA 1V6BA 3QE1A 4GVCA 5GLJA 2DMZA 1KEFA 2FN5A 2V1WA 2X7ZA 3HPKA 2F0AA 1MFGA 2MX6A 1TE0A 1GQ5A 2PDZA 2VSVA 4IC6A 1WHDA 3GJ9A 1X8SA 2EEJA 5I7ZA 2IWOA 2YTWA 1W9EA 1VJ6A 1UEPA 2UZCA 4Q6SA 3O46A 1V62A 3EGHC 1I92A 1BFEA 2REYA 2ENOA 2VSPA 4NMPA 3SUZA 3DJ3A 1P1EA 5JXBA 3WKLA 3TMHA 3GSLA 3B76A 1N6FA 2EEIA 2EGKA 4JOKA 1OBZA 2KPLA 5HFBA 3R0HA 4OEPA 4NXQA 2DKRA 5DTHA 4JORA 2QKVA 4FGMA 1TP5A 2AWWA 1X5QA 3QJMA 3NFLA 2DLUA 2W4FA 4JOJA 2JILA 1VB7A 4R2ZA 2ZPMA 1U39A 4NXPA 1N7EA 4K76A 1WF8A 1UM7A 4YDPA 4YYXA 2R4HA 3TSZA 1WFGA 1U3BA 1ZOKA 3KZDA 1UJVA 3EGGC 1KY9A 4NMOA 1QAUA 1ZUBA 2HE4A 3CH8A 2PZDA 4UU5A 2H2CA 2Q9VA 1N7TA 1T2MA 4JOPA 3CBXA 4P2AB 4OAJA 3GDSA 2KRGA 4E3BA 1YBOA 2OGPA 2OZFA 4REYA 1W9QA 5HETA 5E1YA 1Q7XA 1M5ZA 3OTPA 1V1TA 4G69A 4GHNA 3LNXA 1SOTA 4NMQA 2AINA 3PDZA 3QDOA 2LA8A 2DJTA 1U37A 2VPHA 5E6PB 3DORA 3ID4A 3WKMA 4JOEA 2EGNA 3R69A 4Q2QA 3PV2A 2Q3GA 1OBYA 3FY5A
chains in the Genus database with same CATH superfamily
2EGOA 3K82A 3JXTA 1TQ3A 3ID2A 4Q3HA 2M0ZA 2I0LA 1N99A 1WF7A 2FE5A 5HFEA 1IU2A 2W7RA 5H3JA 1LCYA 4NMVA 2KBSA 4K72A 2KOMA 3GDUA 2CS5A 2VZ5A 2EJYA 2EDPA 2AWXA 2QKTA 2EDZA 1UM1A 1VAEA 2LC6A 1L6OA 2CSSA 2F5YA 5HFDA 1V5QA 2I1NA 4NMRA 5IL9A 4NMSA 5HF4A 3STJA 2ZPLA 2G2LA 2OMJA 2L4SA 1UF1A 1GQ4A 2G5MB 2RRMA 4H11A 1QAVB 2M0VA 2K20A 2YT8A 2FCFA 3KDGA 2LC7A 1X45A 1U38A 1RGWA 2I0IA 2KJPA 1FC6A 2JOAA 3MH6A 1FCFA 4KFVA 3TSVA 1WG6A 1IU0A 3PV4A 4LMMA 2RCZA 4XHVA 2H3LA 2QBWA 3GGEA 1QAVA 2GZVA 1SOZA 2GEFA 5E11A 5HF1A 3CBZA 2JINA 3HPMA 3GCNA 5HDYA 3QO6A 1UFXA 3VQFA 1QLCA 1Y8TA 5E22A 2DC2A 2HE2A 2EEGA 2EEHA 2EXGA 2D92A 4NXRA 5G1EA 1UEWA 1VA8A 1Y7NA 3R68A 4Q2OA 2KYLA 3SFJA 1GM1A 1TP3A 3K50A 2EHRA 4K78A 2BYGA 1NF3C 3ID1A 2YUBA 4NNMA 3O5NA 4KFWA 3VQGA 4EDJA 3OU0A 3DJAA 4Q2PA 5HEYA 3NGHA 3CC0A 4JJ3A 2PA1A 3QIKA 3SOEA 2M0TA 1I16A 5F3XA 4OEOA 1NTEA 4E35A 2KPKA 2P3WA 4E34A 1WJLA 5HJ1A 1X6DA 1K32A 2CSJA 3LNYA 4Z33A 4N6XA 4NNLA 1UEQA 2D8IA 1P1DA 3GCOA 1UITA 3KZEA 3CYYA 5FB8C 3ID3A 2QT5A 2QKUA 2KAWA 2KJDA 5B42A 5HFCA 3MH4A 5B6LA 3BPUA 3I18A 1Z87A 2PKUA 1FC7A 2KV8A 4JL7A 3PV5A 2LUIA 2AWUA 2KOJA 1OBXA 4P0CA 4MPAA 5F67A 2DLSA 4JOHA 2VRFA 2JREA 1Z86A 2IWNA 5G1DA 1WI2A 4K6YA 4Q2NA 5FHTA 2OQSA 3I1EA 2DB5A 3CS0A 5E21A 3ZRTA 2IWQA 2LOBA 1IHJA 1VCWA 1WH1A 2HGAA 3PDVA 1Q3OA 1FC9A 5D13A 1UHPA 1BE9A 4FLNA 3RL7A 1WI4A 3CBYA 4K75A 2DAZA 1MFLA 2D90A 3RL8A 4GVDA 1UEZA 1UJDA 2JWEA 1X5NA 3L4FD 2L4TA 2I6VA 1XZ9A 4F8KA 2DM8A 2KA9A 2WL7A 4AMHA 3TSWA 1X5RA 2MHOA 2K1ZA 2FNEA 3DJ1A 2EV8A 1MC7A 1PDRA 2H2BA 1N6EA 4Z8JA 3NFKA 2YT7A 3I4WA 2I4SA 2M10A 4JJ0A 2OPGA 4L8NA 5HEDA 2YUYA 5A2PA 4JOFA 2L97A 4UU6A 2KG2A 2I04A 1B8QA 2E7KA 3GDVA 5ILBA 3HVQC 1UJUA 3KHFA 3MH7A 1W9OA 1G9OA 1RZXA 1R6JA 4HOPB 2OCSA 2M0UA 2EAQA 4JOGA 2OSGA 1V5LA 3GABA 1OZIA 1WHAA 3E17A 3SHUA 2Z9IA 3DIWA 5GNDA 2JIKA 4RI0A 4NMTA 2O2TA 2EDVA 4WYUA 1RGRA 3PS4A 2OS6A 1D5GA 4HOPA 5EYZA 1N7FA 3K1RA 2R3YA 1N6DA 2QG1A 2KJKA 4Q6HA 2PKTA 2KQFA 1KWAA 2PNTA 1Q3PA 3QGLA 5HFFA 1RY4A 3RLEA 4WYTA 2VWRA 1WIFA 5HEBA 2JXOA 2Z17A 2KL1A 3SHWA 1WFVA 4O06A 4PQWA 2M3MA 5EZ0A 2H3MA 3QJNA 2KOHA 2IWPA 2V90A 3AXAA 1V6BA 3QE1A 4GVCA 5GLJA 2DMZA 1KEFA 2FN5A 2V1WA 2JSNA 2X7ZA 3HPKA 2F0AA 1MFGA 2MX6A 1TE0A 1GQ5A 2PDZA 2VSVA 4IC6A 1WHDA 3GJ9A 1X8SA 2EEJA 5I7ZA 2IWOA 2YTWA 1W9EA 1VJ6A 1UEPA 2UZCA 4Q6SA 3O46A 1V62A 3EGHC 1I92A 1BFEA 2REYA 2ENOA 2VSPA 4NMPA 3SUZA 3DJ3A 1P1EA 5JXBA 3WKLA 3TMHA 1X9ZA 3GSLA 3B76A 1N6FA 2EEIA 2EGKA 4JOKA 1OBZA 2KPLA 5HFBA 3R0HA 4OEPA 4NXQA 2DKRA 5DTHA 4JORA 2QKVA 4FGMA 1TP5A 2AWWA 1X5QA 3QJMA 3NFLA 2DLUA 2W4FA 4JOJA 2JILA 1VB7A 4R2ZA 2ZPMA 1U39A 4NXPA 1N7EA 4K76A 1WF8A 1UM7A 4YDPA 4YYXA 2R4HA 3TSZA 1WFGA 1U3BA 3NCVA 1ZOKA 3KZDA 1UJVA 3EGGC 1KY9A 4NMOA 1QAUA 1ZUBA 2HE4A 3CH8A 2PZDA 4UU5A 2H2CA 2Q9VA 1N7TA 1T2MA 4JOPA 3KDKA 3CBXA 4P2AB 4OAJA 3GDSA 2KRGA 4E3BA 1YBOA 2OGPA 2OZFA 4REYA 1W9QA 5HETA 5E1YA 1Q7XA 1M5ZA 3OTPA 1V1TA 4G69A 4GHNA 3LNXA 1SOTA 4NMQA 2AINA 3PDZA 3QDOA 2LA8A 2DJTA 1U37A 2VPHA 5E6PB 3DORA 3ID4A 3WKMA 4JOEA 2EGNA 3R69A 4Q2QA 3PV2A 2Q3GA 1OBYA 3FY5A
chains in the Genus database with same CATH topology
2EGOA 3K82A 3JXTA 1TQ3A 3ID2A 4Q3HA 2M0ZA 2I0LA 1N99A 1WF7A 2FE5A 5HFEA 1IU2A 2W7RA 5H3JA 1LCYA 4NMVA 2KBSA 4K72A 2KOMA 3GDUA 2CS5A 2VZ5A 2EJYA 2EDPA 2AWXA 2QKTA 2EDZA 1UM1A 1VAEA 2LC6A 1L6OA 2CSSA 2F5YA 5HFDA 1V5QA 2I1NA 4NMRA 5IL9A 4NMSA 5HF4A 3STJA 2ZPLA 2G2LA 2OMJA 2L4SA 1UF1A 1GQ4A 2G5MB 2RRMA 4H11A 1QAVB 2M0VA 2K20A 2YT8A 2FCFA 3KDGA 2LC7A 1X45A 1U38A 1RGWA 2I0IA 2KJPA 1FC6A 2JOAA 3MH6A 1FCFA 4KFVA 3TSVA 1WG6A 1IU0A 3PV4A 4LMMA 2RCZA 4XHVA 2H3LA 2QBWA 3GGEA 1QAVA 2GZVA 1SOZA 2GEFA 5E11A 5HF1A 3CBZA 2JINA 3HPMA 3GCNA 5HDYA 3QO6A 1UFXA 3VQFA 1QLCA 1Y8TA 5E22A 2DC2A 2HE2A 2EEGA 2EEHA 2EXGA 2D92A 4NXRA 5G1EA 1UEWA 1VA8A 1Y7NA 3R68A 4Q2OA 2KYLA 3SFJA 1GM1A 1TP3A 3K50A 2EHRA 4K78A 2BYGA 1NF3C 3ID1A 2YUBA 4NNMA 3O5NA 4KFWA 3VQGA 4EDJA 3OU0A 3DJAA 4Q2PA 5HEYA 3NGHA 3CC0A 4JJ3A 2PA1A 3QIKA 3SOEA 2M0TA 1I16A 5F3XA 4OEOA 1NTEA 4E35A 2KPKA 2P3WA 4E34A 1WJLA 5HJ1A 1X6DA 1K32A 2CSJA 3LNYA 4Z33A 4N6XA 4NNLA 1UEQA 2D8IA 1P1DA 3GCOA 1UITA 3KZEA 3CYYA 5FB8C 3ID3A 2QT5A 2QKUA 2KAWA 2KJDA 5B42A 5HFCA 3MH4A 5B6LA 3BPUA 3I18A 1Z87A 2PKUA 1FC7A 2KV8A 4JL7A 3PV5A 2LUIA 2AWUA 2KOJA 1OBXA 4P0CA 4MPAA 5F67A 2DLSA 4JOHA 2VRFA 2JREA 1Z86A 2IWNA 5G1DA 1WI2A 4K6YA 4Q2NA 5FHTA 2OQSA 3I1EA 2DB5A 3CS0A 5E21A 3ZRTA 2IWQA 2LOBA 1IHJA 1VCWA 1WH1A 2HGAA 3PDVA 1Q3OA 1FC9A 5D13A 1UHPA 1BE9A 4FLNA 3RL7A 1WI4A 3CBYA 4K75A 2DAZA 1MFLA 2D90A 3RL8A 4GVDA 1UEZA 1UJDA 2JWEA 1X5NA 3L4FD 2L4TA 2I6VA 1XZ9A 4F8KA 2DM8A 2KA9A 2WL7A 4AMHA 3TSWA 1X5RA 2MHOA 2K1ZA 2FNEA 3DJ1A 2EV8A 1MC7A 1PDRA 2H2BA 1N6EA 4Z8JA 3NFKA 2YT7A 3I4WA 2I4SA 2M10A 4JJ0A 2OPGA 4L8NA 5HEDA 2YUYA 5A2PA 4JOFA 2L97A 4UU6A 2KG2A 2I04A 1B8QA 2E7KA 3GDVA 5ILBA 3HVQC 1UJUA 3KHFA 3MH7A 1W9OA 1G9OA 1RZXA 1R6JA 4HOPB 2OCSA 2M0UA 2EAQA 4JOGA 2OSGA 1V5LA 3GABA 1OZIA 1WHAA 3E17A 3SHUA 2Z9IA 3DIWA 5GNDA 2JIKA 4RI0A 4NMTA 2O2TA 2EDVA 4WYUA 1RGRA 3PS4A 2OS6A 1D5GA 4HOPA 5EYZA 1N7FA 3K1RA 2R3YA 1N6DA 2QG1A 2KJKA 4Q6HA 2PKTA 2KQFA 1KWAA 2PNTA 1Q3PA 3QGLA 5HFFA 1RY4A 3RLEA 4WYTA 2VWRA 1WIFA 5HEBA 2JXOA 2Z17A 2KL1A 3SHWA 1WFVA 4O06A 4PQWA 2M3MA 5EZ0A 2H3MA 3QJNA 2KOHA 2IWPA 2V90A 3AXAA 1V6BA 3QE1A 4GVCA 5GLJA 2DMZA 1KEFA 2FN5A 2V1WA 2JSNA 2X7ZA 3HPKA 2F0AA 1MFGA 2MX6A 1TE0A 1GQ5A 2PDZA 2VSVA 4IC6A 1WHDA 3GJ9A 1X8SA 2EEJA 5I7ZA 2IWOA 2YTWA 1W9EA 1VJ6A 1UEPA 2UZCA 4Q6SA 3O46A 1V62A 3EGHC 1I92A 1BFEA 2REYA 2ENOA 2VSPA 4NMPA 3SUZA 3DJ3A 1P1EA 5JXBA 3WKLA 3TMHA 1X9ZA 3GSLA 3B76A 1N6FA 2EEIA 2EGKA 4JOKA 1OBZA 2KPLA 5HFBA 3R0HA 4OEPA 4NXQA 2DKRA 5DTHA 4JORA 2QKVA 4FGMA 1TP5A 2AWWA 1X5QA 3QJMA 3NFLA 2DLUA 2W4FA 4JOJA 2JILA 1VB7A 4R2ZA 2ZPMA 1U39A 4NXPA 1N7EA 4K76A 1WF8A 1UM7A 4YDPA 4YYXA 2R4HA 3TSZA 1WFGA 1U3BA 3NCVA 1ZOKA 3KZDA 1UJVA 3EGGC 1KY9A 4NMOA 1QAUA 1ZUBA 2HE4A 3CH8A 2PZDA 4UU5A 2H2CA 2Q9VA 1N7TA 1T2MA 4JOPA 3KDKA 3CBXA 4P2AB 4OAJA 3GDSA 2KRGA 4E3BA 1YBOA 2OGPA 2OZFA 4REYA 1W9QA 5HETA 5E1YA 1Q7XA 1M5ZA 3OTPA 1V1TA 4G69A 4GHNA 3LNXA 1SOTA 4NMQA 2AINA 3PDZA 3QDOA 2LA8A 2DJTA 1U37A 2VPHA 5E6PB 3DORA 3ID4A 3WKMA 4JOEA 2EGNA 3R69A 4Q2QA 3PV2A 2Q3GA 1OBYA 3FY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EGO A;  3K82 A;  3JXT A;  1TQ3 A;  3ID2 A;  4Q3H A;  2M0Z A;  2I0L A;  1N99 A;  1WF7 A;  2FE5 A;  5HFE A;  1IU2 A;  2W7R A;  5H3J A;  1LCY A;  4NMV A;  2KBS A;  4K72 A;  2KOM A;  3GDU A;  2CS5 A;  2VZ5 A;  2EJY A;  2EDP A;  2AWX A;  2QKT A;  2EDZ A;  1UM1 A;  1VAE A;  2LC6 A;  1L6O A;  2CSS A;  2F5Y A;  5HFD A;  1V5Q A;  2I1N A;  4NMR A;  4NMS A;  5HF4 A;  3STJ A;  2ZPL A;  2G2L A;  2OMJ A;  2L4S A;  1UF1 A;  1GQ4 A;  2G5M B;  2RRM A;  4H11 A;  1QAV B;  2M0V A;  2K20 A;  2YT8 A;  2FCF A;  2LC7 A;  1X45 A;  1U38 A;  1RGW A;  2I0I A;  2KJP A;  1FC6 A;  2JOA A;  3MH6 A;  1FCF A;  4KFV A;  3TSV A;  1WG6 A;  1IU0 A;  3PV4 A;  4LMM A;  2RCZ A;  4XHV A;  2H3L A;  2QBW A;  3GGE A;  1QAV A;  2GZV A;  1SOZ A;  5E11 A;  5HF1 A;  3CBZ A;  2JIN A;  3HPM A;  3GCN A;  5HDY A;  3QO6 A;  1UFX A;  3VQF A;  1QLC A;  1Y8T A;  5E22 A;  2DC2 A;  2HE2 A;  2EEG A;  2EEH A;  2EXG A;  2D92 A;  4NXR A;  5G1E A;  1UEW A;  1VA8 A;  1Y7N A;  3R68 A;  4Q2O A;  2KYL A;  3SFJ A;  1GM1 A;  1TP3 A;  3K50 A;  2EHR A;  4K78 A;  2BYG A;  1NF3 C;  3ID1 A;  2YUB A;  4NNM A;  3O5N A;  4KFW A;  3VQG A;  4EDJ A;  3OU0 A;  3DJA A;  4Q2P A;  5HEY A;  3NGH A;  3CC0 A;  2PA1 A;  3QIK A;  3SOE A;  2M0T A;  1I16 A;  5F3X A;  4OEO A;  1NTE A;  4E35 A;  2KPK A;  2P3W A;  4E34 A;  1WJL A;  5HJ1 A;  1X6D A;  1K32 A;  2CSJ A;  3LNY A;  4Z33 A;  4N6X A;  4NNL A;  1UEQ A;  2D8I A;  1P1D A;  3GCO A;  1UIT A;  3KZE A;  3CYY A;  5FB8 C;  3ID3 A;  2QT5 A;  2QKU A;  2KAW A;  2KJD A;  5HFC A;  3MH4 A;  5B6L A;  3BPU A;  3I18 A;  1Z87 A;  2PKU A;  1FC7 A;  2KV8 A;  4JL7 A;  3PV5 A;  2LUI A;  2AWU A;  2KOJ A;  1OBX A;  4P0C A;  4MPA A;  5F67 A;  2DLS A;  4JOH A;  2VRF A;  2JRE A;  1Z86 A;  2IWN A;  5G1D A;  1WI2 A;  4K6Y A;  4Q2N A;  5FHT A;  2OQS A;  3I1E A;  2DB5 A;  3CS0 A;  5E21 A;  3ZRT A;  2IWQ A;  2LOB A;  1IHJ A;  1VCW A;  1WH1 A;  2HGA A;  3PDV A;  1Q3O A;  1FC9 A;  5D13 A;  1UHP A;  1BE9 A;  3RL7 A;  1WI4 A;  3CBY A;  4K75 A;  2DAZ A;  1MFL A;  2D90 A;  3RL8 A;  4GVD A;  1UEZ A;  1UJD A;  2JWE A;  1X5N A;  3L4F D;  2L4T A;  2I6V A;  1XZ9 A;  4F8K A;  2DM8 A;  2KA9 A;  2WL7 A;  4AMH A;  3TSW A;  1X5R A;  2MHO A;  2K1Z A;  2FNE A;  3DJ1 A;  2EV8 A;  1MC7 A;  1PDR A;  2H2B A;  1N6E A;  4Z8J A;  3NFK A;  2YT7 A;  3I4W A;  2I4S A;  2M10 A;  2OPG A;  4L8N A;  5HED A;  2YUY A;  5A2P A;  4JOF A;  2L97 A;  4UU6 A;  2KG2 A;  2I04 A;  1B8Q A;  2E7K A;  3GDV A;  3HVQ C;  1UJU A;  3KHF A;  3MH7 A;  1W9O A;  1G9O A;  1RZX A;  1R6J A;  4HOP B;  2OCS A;  2M0U A;  2EAQ A;  4JOG A;  2OSG A;  1V5L A;  1OZI A;  1WHA A;  3E17 A;  3SHU A;  2Z9I A;  3DIW A;  5GND A;  2JIK A;  4RI0 A;  4NMT A;  2O2T A;  2EDV A;  4WYU A;  1RGR A;  3PS4 A;  2OS6 A;  1D5G A;  4HOP A;  5EYZ A;  1N7F A;  3K1R A;  2R3Y A;  1N6D A;  2QG1 A;  2KJK A;  4Q6H A;  2PKT A;  2KQF A;  1KWA A;  2PNT A;  1Q3P A;  3QGL A;  5HFF A;  1RY4 A;  3RLE A;  4WYT A;  2VWR A;  1WIF A;  5HEB A;  2JXO A;  2Z17 A;  2KL1 A;  3SHW A;  1WFV A;  4O06 A;  4PQW A;  2M3M A;  5EZ0 A;  2H3M A;  3QJN A;  2KOH A;  2IWP A;  2V90 A;  3AXA A;  1V6B A;  3QE1 A;  4GVC A;  5GLJ A;  2DMZ A;  1KEF A;  2FN5 A;  2V1W A;  2X7Z A;  3HPK A;  2F0A A;  1MFG A;  2MX6 A;  1TE0 A;  1GQ5 A;  2PDZ A;  2VSV A;  4IC6 A;  1WHD A;  3GJ9 A;  1X8S A;  2EEJ A;  5I7Z A;  2IWO A;  2YTW A;  1W9E A;  1VJ6 A;  1UEP A;  2UZC A;  4Q6S A;  3O46 A;  1V62 A;  3EGH C;  1I92 A;  1BFE A;  2REY A;  2ENO A;  2VSP A;  4NMP A;  3SUZ A;  3DJ3 A;  1P1E A;  5JXB A;  3WKL A;  3TMH A;  3GSL A;  3B76 A;  1N6F A;  2EEI A;  2EGK A;  4JOK A;  1OBZ A;  2KPL A;  5HFB A;  3R0H A;  4OEP A;  4NXQ A;  2DKR A;  5DTH A;  4JOR A;  2QKV A;  4FGM A;  1TP5 A;  2AWW A;  1X5Q A;  3QJM A;  3NFL A;  2DLU A;  2W4F A;  4JOJ A;  2JIL A;  1VB7 A;  4R2Z A;  2ZPM A;  1U39 A;  4NXP A;  1N7E A;  4K76 A;  1WF8 A;  1UM7 A;  4YDP A;  4YYX A;  2R4H A;  3TSZ A;  1WFG A;  1U3B A;  1ZOK A;  3KZD A;  1UJV A;  3EGG C;  1KY9 A;  4NMO A;  1QAU A;  1ZUB A;  2HE4 A;  3CH8 A;  2PZD A;  4UU5 A;  2H2C A;  2Q9V A;  1N7T A;  1T2M A;  4JOP A;  3CBX A;  4P2A B;  4OAJ A;  3GDS A;  2KRG A;  4E3B A;  1YBO A;  2OGP A;  2OZF A;  4REY A;  1W9Q A;  5HET A;  5E1Y A;  1Q7X A;  1M5Z A;  3OTP A;  1V1T A;  4G69 A;  4GHN A;  3LNX A;  1SOT A;  4NMQ A;  2AIN A;  3PDZ A;  3QDO A;  2LA8 A;  2DJT A;  1U37 A;  2VPH A;  5E6P B;  3DOR A;  3ID4 A;  3WKM A;  4JOE A;  2EGN A;  3R69 A;  4Q2Q A;  3PV2 A;  2Q3G A;  1OBY A;  3FY5 A; 
#chains in the Genus database with same CATH topology
 2EGO A;  3K82 A;  3JXT A;  1TQ3 A;  3ID2 A;  4Q3H A;  2M0Z A;  2I0L A;  1N99 A;  1WF7 A;  2FE5 A;  5HFE A;  1IU2 A;  2W7R A;  5H3J A;  1LCY A;  4NMV A;  2KBS A;  4K72 A;  2KOM A;  3GDU A;  2CS5 A;  2VZ5 A;  2EJY A;  2EDP A;  2AWX A;  2QKT A;  2EDZ A;  1UM1 A;  1VAE A;  2LC6 A;  1L6O A;  2CSS A;  2F5Y A;  5HFD A;  1V5Q A;  2I1N A;  4NMR A;  5IL9 A;  4NMS A;  5HF4 A;  3STJ A;  2ZPL A;  2G2L A;  2OMJ A;  2L4S A;  1UF1 A;  1GQ4 A;  2G5M B;  2RRM A;  4H11 A;  1QAV B;  2M0V A;  2K20 A;  2YT8 A;  2FCF A;  3KDG A;  2LC7 A;  1X45 A;  1U38 A;  1RGW A;  2I0I A;  2KJP A;  1FC6 A;  2JOA A;  3MH6 A;  1FCF A;  4KFV A;  3TSV A;  1WG6 A;  1IU0 A;  3PV4 A;  4LMM A;  2RCZ A;  4XHV A;  2H3L A;  2QBW A;  3GGE A;  1QAV A;  2GZV A;  1SOZ A;  2GEF A;  5E11 A;  5HF1 A;  3CBZ A;  2JIN A;  3HPM A;  3GCN A;  5HDY A;  3QO6 A;  1UFX A;  3VQF A;  1QLC A;  1Y8T A;  5E22 A;  2DC2 A;  2HE2 A;  2EEG A;  2EEH A;  2EXG A;  2D92 A;  4NXR A;  5G1E A;  1UEW A;  1VA8 A;  1Y7N A;  3R68 A;  4Q2O A;  2KYL A;  3SFJ A;  1GM1 A;  1TP3 A;  3K50 A;  2EHR A;  4K78 A;  2BYG A;  1NF3 C;  3ID1 A;  2YUB A;  4NNM A;  3O5N A;  4KFW A;  3VQG A;  4EDJ A;  3OU0 A;  3DJA A;  4Q2P A;  5HEY A;  3NGH A;  3CC0 A;  4JJ3 A;  2PA1 A;  3QIK A;  3SOE A;  2M0T A;  1I16 A;  5F3X A;  4OEO A;  1NTE A;  4E35 A;  2KPK A;  2P3W A;  4E34 A;  1WJL A;  5HJ1 A;  1X6D A;  1K32 A;  2CSJ A;  3LNY A;  4Z33 A;  4N6X A;  4NNL A;  1UEQ A;  2D8I A;  1P1D A;  3GCO A;  1UIT A;  3KZE A;  3CYY A;  5FB8 C;  3ID3 A;  2QT5 A;  2QKU A;  2KAW A;  2KJD A;  5B42 A;  5HFC A;  3MH4 A;  5B6L A;  3BPU A;  3I18 A;  1Z87 A;  2PKU A;  1FC7 A;  2KV8 A;  4JL7 A;  3PV5 A;  2LUI A;  2AWU A;  2KOJ A;  1OBX A;  4P0C A;  4MPA A;  5F67 A;  2DLS A;  4JOH A;  2VRF A;  2JRE A;  1Z86 A;  2IWN A;  5G1D A;  1WI2 A;  4K6Y A;  4Q2N A;  5FHT A;  2OQS A;  3I1E A;  2DB5 A;  3CS0 A;  5E21 A;  3ZRT A;  2IWQ A;  2LOB A;  1IHJ A;  1VCW A;  1WH1 A;  2HGA A;  3PDV A;  1Q3O A;  1FC9 A;  5D13 A;  1UHP A;  1BE9 A;  4FLN A;  3RL7 A;  1WI4 A;  3CBY A;  4K75 A;  2DAZ A;  1MFL A;  2D90 A;  3RL8 A;  4GVD A;  1UEZ A;  1UJD A;  2JWE A;  1X5N A;  3L4F D;  2L4T A;  2I6V A;  1XZ9 A;  4F8K A;  2DM8 A;  2KA9 A;  2WL7 A;  4AMH A;  3TSW A;  1X5R A;  2MHO A;  2K1Z A;  2FNE A;  3DJ1 A;  2EV8 A;  1MC7 A;  1PDR A;  2H2B A;  1N6E A;  4Z8J A;  3NFK A;  2YT7 A;  3I4W A;  2I4S A;  2M10 A;  4JJ0 A;  2OPG A;  4L8N A;  5HED A;  2YUY A;  5A2P A;  4JOF A;  2L97 A;  4UU6 A;  2KG2 A;  2I04 A;  1B8Q A;  2E7K A;  3GDV A;  5ILB A;  3HVQ C;  1UJU A;  3KHF A;  3MH7 A;  1W9O A;  1G9O A;  1RZX A;  1R6J A;  4HOP B;  2OCS A;  2M0U A;  2EAQ A;  4JOG A;  2OSG A;  1V5L A;  3GAB A;  1OZI A;  1WHA A;  3E17 A;  3SHU A;  2Z9I A;  3DIW A;  5GND A;  2JIK A;  4RI0 A;  4NMT A;  2O2T A;  2EDV A;  4WYU A;  1RGR A;  3PS4 A;  2OS6 A;  1D5G A;  4HOP A;  5EYZ A;  1N7F A;  3K1R A;  2R3Y A;  1N6D A;  2QG1 A;  2KJK A;  4Q6H A;  2PKT A;  2KQF A;  1KWA A;  2PNT A;  1Q3P A;  3QGL A;  5HFF A;  1RY4 A;  3RLE A;  4WYT A;  2VWR A;  1WIF A;  5HEB A;  2JXO A;  2Z17 A;  2KL1 A;  3SHW A;  1WFV A;  4O06 A;  4PQW A;  2M3M A;  5EZ0 A;  2H3M A;  3QJN A;  2KOH A;  2IWP A;  2V90 A;  3AXA A;  1V6B A;  3QE1 A;  4GVC A;  5GLJ A;  2DMZ A;  1KEF A;  2FN5 A;  2V1W A;  2JSN A;  2X7Z A;  3HPK A;  2F0A A;  1MFG A;  2MX6 A;  1TE0 A;  1GQ5 A;  2PDZ A;  2VSV A;  4IC6 A;  1WHD A;  3GJ9 A;  1X8S A;  2EEJ A;  5I7Z A;  2IWO A;  2YTW A;  1W9E A;  1VJ6 A;  1UEP A;  2UZC A;  4Q6S A;  3O46 A;  1V62 A;  3EGH C;  1I92 A;  1BFE A;  2REY A;  2ENO A;  2VSP A;  4NMP A;  3SUZ A;  3DJ3 A;  1P1E A;  5JXB A;  3WKL A;  3TMH A;  1X9Z A;  3GSL A;  3B76 A;  1N6F A;  2EEI A;  2EGK A;  4JOK A;  1OBZ A;  2KPL A;  5HFB A;  3R0H A;  4OEP A;  4NXQ A;  2DKR A;  5DTH A;  4JOR A;  2QKV A;  4FGM A;  1TP5 A;  2AWW A;  1X5Q A;  3QJM A;  3NFL A;  2DLU A;  2W4F A;  4JOJ A;  2JIL A;  1VB7 A;  4R2Z A;  2ZPM A;  1U39 A;  4NXP A;  1N7E A;  4K76 A;  1WF8 A;  1UM7 A;  4YDP A;  4YYX A;  2R4H A;  3TSZ A;  1WFG A;  1U3B A;  3NCV A;  1ZOK A;  3KZD A;  1UJV A;  3EGG C;  1KY9 A;  4NMO A;  1QAU A;  1ZUB A;  2HE4 A;  3CH8 A;  2PZD A;  4UU5 A;  2H2C A;  2Q9V A;  1N7T A;  1T2M A;  4JOP A;  3KDK A;  3CBX A;  4P2A B;  4OAJ A;  3GDS A;  2KRG A;  4E3B A;  1YBO A;  2OGP A;  2OZF A;  4REY A;  1W9Q A;  5HET A;  5E1Y A;  1Q7X A;  1M5Z A;  3OTP A;  1V1T A;  4G69 A;  4GHN A;  3LNX A;  1SOT A;  4NMQ A;  2AIN A;  3PDZ A;  3QDO A;  2LA8 A;  2DJT A;  1U37 A;  2VPH A;  5E6P B;  3DOR A;  3ID4 A;  3WKM A;  4JOE A;  2EGN A;  3R69 A;  4Q2Q A;  3PV2 A;  2Q3G A;  1OBY A;  3FY5 A; 
#chains in the Genus database with same CATH homology
 2EGO A;  3K82 A;  3JXT A;  1TQ3 A;  3ID2 A;  4Q3H A;  2M0Z A;  2I0L A;  1N99 A;  1WF7 A;  2FE5 A;  5HFE A;  1IU2 A;  2W7R A;  5H3J A;  1LCY A;  4NMV A;  2KBS A;  4K72 A;  2KOM A;  3GDU A;  2CS5 A;  2VZ5 A;  2EJY A;  2EDP A;  2AWX A;  2QKT A;  2EDZ A;  1UM1 A;  1VAE A;  2LC6 A;  1L6O A;  2CSS A;  2F5Y A;  5HFD A;  1V5Q A;  2I1N A;  4NMR A;  5IL9 A;  4NMS A;  5HF4 A;  3STJ A;  2ZPL A;  2G2L A;  2OMJ A;  2L4S A;  1UF1 A;  1GQ4 A;  2G5M B;  2RRM A;  4H11 A;  1QAV B;  2M0V A;  2K20 A;  2YT8 A;  2FCF A;  3KDG A;  2LC7 A;  1X45 A;  1U38 A;  1RGW A;  2I0I A;  2KJP A;  1FC6 A;  2JOA A;  3MH6 A;  1FCF A;  4KFV A;  3TSV A;  1WG6 A;  1IU0 A;  3PV4 A;  4LMM A;  2RCZ A;  4XHV A;  2H3L A;  2QBW A;  3GGE A;  1QAV A;  2GZV A;  1SOZ A;  2GEF A;  5E11 A;  5HF1 A;  3CBZ A;  2JIN A;  3HPM A;  3GCN A;  5HDY A;  3QO6 A;  1UFX A;  3VQF A;  1QLC A;  1Y8T A;  5E22 A;  2DC2 A;  2HE2 A;  2EEG A;  2EEH A;  2EXG A;  2D92 A;  4NXR A;  5G1E A;  1UEW A;  1VA8 A;  1Y7N A;  3R68 A;  4Q2O A;  2KYL A;  3SFJ A;  1GM1 A;  1TP3 A;  3K50 A;  2EHR A;  4K78 A;  2BYG A;  1NF3 C;  3ID1 A;  2YUB A;  4NNM A;  3O5N A;  4KFW A;  3VQG A;  4EDJ A;  3OU0 A;  3DJA A;  4Q2P A;  5HEY A;  3NGH A;  3CC0 A;  4JJ3 A;  2PA1 A;  3QIK A;  3SOE A;  2M0T A;  1I16 A;  5F3X A;  4OEO A;  1NTE A;  4E35 A;  2KPK A;  2P3W A;  4E34 A;  1WJL A;  5HJ1 A;  1X6D A;  1K32 A;  2CSJ A;  3LNY A;  4Z33 A;  4N6X A;  4NNL A;  1UEQ A;  2D8I A;  1P1D A;  3GCO A;  1UIT A;  3KZE A;  3CYY A;  5FB8 C;  3ID3 A;  2QT5 A;  2QKU A;  2KAW A;  2KJD A;  5B42 A;  5HFC A;  3MH4 A;  5B6L A;  3BPU A;  3I18 A;  1Z87 A;  2PKU A;  1FC7 A;  2KV8 A;  4JL7 A;  3PV5 A;  2LUI A;  2AWU A;  2KOJ A;  1OBX A;  4P0C A;  4MPA A;  5F67 A;  2DLS A;  4JOH A;  2VRF A;  2JRE A;  1Z86 A;  2IWN A;  5G1D A;  1WI2 A;  4K6Y A;  4Q2N A;  5FHT A;  2OQS A;  3I1E A;  2DB5 A;  3CS0 A;  5E21 A;  3ZRT A;  2IWQ A;  2LOB A;  1IHJ A;  1VCW A;  1WH1 A;  2HGA A;  3PDV A;  1Q3O A;  1FC9 A;  5D13 A;  1UHP A;  1BE9 A;  4FLN A;  3RL7 A;  1WI4 A;  3CBY A;  4K75 A;  2DAZ A;  1MFL A;  2D90 A;  3RL8 A;  4GVD A;  1UEZ A;  1UJD A;  2JWE A;  1X5N A;  3L4F D;  2L4T A;  2I6V A;  1XZ9 A;  4F8K A;  2DM8 A;  2KA9 A;  2WL7 A;  4AMH A;  3TSW A;  1X5R A;  2MHO A;  2K1Z A;  2FNE A;  3DJ1 A;  2EV8 A;  1MC7 A;  1PDR A;  2H2B A;  1N6E A;  4Z8J A;  3NFK A;  2YT7 A;  3I4W A;  2I4S A;  2M10 A;  4JJ0 A;  2OPG A;  4L8N A;  5HED A;  2YUY A;  5A2P A;  4JOF A;  2L97 A;  4UU6 A;  2KG2 A;  2I04 A;  1B8Q A;  2E7K A;  3GDV A;  5ILB A;  3HVQ C;  1UJU A;  3KHF A;  3MH7 A;  1W9O A;  1G9O A;  1RZX A;  1R6J A;  4HOP B;  2OCS A;  2M0U A;  2EAQ A;  4JOG A;  2OSG A;  1V5L A;  3GAB A;  1OZI A;  1WHA A;  3E17 A;  3SHU A;  2Z9I A;  3DIW A;  5GND A;  2JIK A;  4RI0 A;  4NMT A;  2O2T A;  2EDV A;  4WYU A;  1RGR A;  3PS4 A;  2OS6 A;  1D5G A;  4HOP A;  5EYZ A;  1N7F A;  3K1R A;  2R3Y A;  1N6D A;  2QG1 A;  2KJK A;  4Q6H A;  2PKT A;  2KQF A;  1KWA A;  2PNT A;  1Q3P A;  3QGL A;  5HFF A;  1RY4 A;  3RLE A;  4WYT A;  2VWR A;  1WIF A;  5HEB A;  2JXO A;  2Z17 A;  2KL1 A;  3SHW A;  1WFV A;  4O06 A;  4PQW A;  2M3M A;  5EZ0 A;  2H3M A;  3QJN A;  2KOH A;  2IWP A;  2V90 A;  3AXA A;  1V6B A;  3QE1 A;  4GVC A;  5GLJ A;  2DMZ A;  1KEF A;  2FN5 A;  2V1W A;  2JSN A;  2X7Z A;  3HPK A;  2F0A A;  1MFG A;  2MX6 A;  1TE0 A;  1GQ5 A;  2PDZ A;  2VSV A;  4IC6 A;  1WHD A;  3GJ9 A;  1X8S A;  2EEJ A;  5I7Z A;  2IWO A;  2YTW A;  1W9E A;  1VJ6 A;  1UEP A;  2UZC A;  4Q6S A;  3O46 A;  1V62 A;  3EGH C;  1I92 A;  1BFE A;  2REY A;  2ENO A;  2VSP A;  4NMP A;  3SUZ A;  3DJ3 A;  1P1E A;  5JXB A;  3WKL A;  3TMH A;  1X9Z A;  3GSL A;  3B76 A;  1N6F A;  2EEI A;  2EGK A;  4JOK A;  1OBZ A;  2KPL A;  5HFB A;  3R0H A;  4OEP A;  4NXQ A;  2DKR A;  5DTH A;  4JOR A;  2QKV A;  4FGM A;  1TP5 A;  2AWW A;  1X5Q A;  3QJM A;  3NFL A;  2DLU A;  2W4F A;  4JOJ A;  2JIL A;  1VB7 A;  4R2Z A;  2ZPM A;  1U39 A;  4NXP A;  1N7E A;  4K76 A;  1WF8 A;  1UM7 A;  4YDP A;  4YYX A;  2R4H A;  3TSZ A;  1WFG A;  1U3B A;  3NCV A;  1ZOK A;  3KZD A;  1UJV A;  3EGG C;  1KY9 A;  4NMO A;  1QAU A;  1ZUB A;  2HE4 A;  3CH8 A;  2PZD A;  4UU5 A;  2H2C A;  2Q9V A;  1N7T A;  1T2M A;  4JOP A;  3KDK A;  3CBX A;  4P2A B;  4OAJ A;  3GDS A;  2KRG A;  4E3B A;  1YBO A;  2OGP A;  2OZF A;  4REY A;  1W9Q A;  5HET A;  5E1Y A;  1Q7X A;  1M5Z A;  3OTP A;  1V1T A;  4G69 A;  4GHN A;  3LNX A;  1SOT A;  4NMQ A;  2AIN A;  3PDZ A;  3QDO A;  2LA8 A;  2DJT A;  1U37 A;  2VPH A;  5E6P B;  3DOR A;  3ID4 A;  3WKM A;  4JOE A;  2EGN A;  3R69 A;  4Q2Q A;  3PV2 A;  2Q3G A;  1OBY A;  3FY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...