3R68A

Molecular analysis of the pdz3 domain of pdzk1
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
85
Chain Sequence
b'SPHQPRVVVIKKGSNGYGFYLRAGQKGQIIKDIEPGSPAEAAGLKNNDLVVAVNGKSVEALDHDGVVEMIRKGGDQTTLLVLDKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Na(+)/H(+) exchange regulatory cofactor NHE-RF3
publication title Identification of the PDZ3 Domain of the Adaptor Protein PDZK1 as a Second, Physiologically Functional Binding Site for the C Terminus of the High Density Lipoprotein Receptor Scavenger Receptor Class B Type I.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 20
structure length 85
sequence length 87
ec nomenclature
pdb deposition date 2011-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3r68A00
3DJ3A 2EDVA 3ID1A 4NMTA 1QAVB 2JIKA 1U38A 3MH6A 1WF8A 5A2PA 3ID4A 2QKUA 1UJDA 2M0TA 3PV5A 3CYYA 5B6LA 2EEJA 3HPMA 2MHOA 2PKUA 2H2BA 1UEQA 4JOHA 1UITA 2LA8A 1OBXA 2DC2A 2L4TA 3TMHA 3GDSA 2KAWA 5HEBA 1WIFA 2YUBA 3LNXA 1LCYA 2VWRA 2YTWA 2D92A 3KHFA 2YUYA 5HFFA 1TE0A 3PS4A 4NXQA 1UJUA 3O46A 5HF1A 3I1EA 5DTHA 5E22A 2F5YA 2MX6A 1V5LA 3MH4A 5HJ1A 2Q9VA 2EAQA 2I0LA 3VQGA 2CSSA 2JINA 2VSPA 2KOJA 3RL7A 3DORA 1D5GA 1N7EA 4NNLA 1MFGA 4JOFA 1R6JA 1GQ4A 1U39A 4UU5A 3GCNA 1UF1A 3DIWA 1Q3OA 4P2AB 4Q2QA 2ZPMA 4RI0A 3R0HA 2H3LA 1X6DA 1V5QA 1IU2A 3PV2A 1RGWA 2E7KA 3SHWA 4NMOA 2V1WA 1WI4A 2JXOA 4NMRA 3MH7A 2KL1A 5E21A 1K32A 5HF4A 2KRGA 1FC9A 3QIKA 2KJPA 1U37A 2L97A 2Z17A 1P1DA 3GSLA 1WG6A 2EGKA 2P3WA 3I4WA 4YYXA 1GQ5A 1V6BA 1SOZA 3SOEA 3EGHC 4E3BA 4NMSA 1UM1A 4Q2PA 2D8IA 2ENOA 2KJDA 5FHTA 3FY5A 3I18A 4Q6HA 1UEZA 1Q3PA 2EGNA 3NFLA 4G69A 3R68A 1KY9A 2DB5A 2KJKA 4JORA 1L6OA 1N6DA 2KV8A 5HFBA 2HGAA 2W4FA 2PNTA 2M0ZA 2HE2A 1VCWA 2R3YA 3GGEA 1MC7A 5HEDA 4NMPA 2PKTA 2M0UA 1X5NA 1M5ZA 2FE5A 1X5RA 2I04A 2LOBA 3OTPA 5HDYA 2M10A 1QLCA 2I6VA 5GLJA 2DLUA 3ZRTA 3R69A 2YT8A 2M0VA 4OEPA 2QKTA 1IHJA 4OEOA 2AINA 1X45A 2DLSA 1OBYA 4EDJA 4P0CA 2EGOA 3CBXA 3SHUA 4AMHA 2JOAA 3GDUA 2L4SA 2AWUA 2DAZA 1OBZA 1Y7NA 2ZPLA 3RL8A 3CC0A 1QAUA 1N6FA 1VB7A 3LNYA 4K72A 3QE1A 5HEYA 4WYTA 2KYLA 1NF3C 4NXRA 4MPAA 2KPLA 2OMJA 2EEIA 3CS0A 2FNEA 4HOPA 1IU0A 2VZ5A 3WKMA 2REYA 4REYA 2HE4A 2LC6A 3HPKA 1BFEA 3HVQC 4KFWA 3TSWA 2H2CA 2EDPA 2KOHA 4R2ZA 3EGGC 1P1EA 3BPUA 5HFDA 2QG1A 3KZEA 4Q2OA 5E11A 3SUZA 5HETA 3O5NA 5JXBA 2KQFA 4E35A 1TP5A 4JOKA 2LC7A 4LMMA 2K1ZA 4JOGA 4HOPB 2V90A 1N7TA 4NMVA 3DJAA 3STJA 2OCSA 4JOEA 1W9EA 4KFVA 4XHVA 4H11A 1X8SA 1W9OA 2QT5A 1XZ9A 1Z87A 1U3BA 2JWEA 2EEGA 3TSVA 2OZFA 1GM1A 2I0IA 2I1NA 2WL7A 1I16A 1UEPA 2UZCA 3TSZA 1N7FA 1WHDA 4F8KA 3QO6A 4FGMA 3NGHA 3VQFA 2LUIA 4K78A 2W7RA 1Z86A 3RLEA 1FC6A 4E34A 1VJ6A 4IC6A 1FCFA 1UFXA 2DMZA 2RCZA 4O06A 2YT7A 4OAJA 4JOPA 2FN5A 1UJVA 1I92A 2JREA 2M3MA 3GDVA 3B76A 1V62A 1WHAA 2QBWA 1WFVA 2IWOA 1N99A 4GHNA 2AWWA 3QGLA 3PV4A 3QJMA 1B8QA 2X7ZA 5E6PB 2KPKA 1RZXA 1ZUBA 2R4HA 1KWAA 2VSVA 3ID2A 2DM8A 1X5QA 2DJTA 2H3MA 1TP3A 2Q3GA 2OSGA 2QKVA 4NXPA 2EHRA 3GCOA 1FC7A 1W9QA 2PDZA 5EYZA 1WJLA 3QJNA 2FCFA 4GVDA 5HFCA 2VRFA 5G1DA 1KEFA 2G5MB 2Z9IA 3K82A 2I4SA 1G9OA 1MFLA 2PZDA 2IWQA 3K1RA 5E1YA 2EXGA 2K20A 1ZOKA 3WKLA 3OU0A 4YDPA 1UM7A 3PDVA 1WF7A 4K6YA 1YBOA 2GZVA 3PDZA 3K50A 2RRMA 5EZ0A 1SOTA 3CH8A 4Q2NA 4Q6SA 4L8NA 2O2TA 4K75A 1VAEA 1WI2A 1UHPA 2CSJA 2CS5A 2DKRA 2G2LA 5F3XA 4Z33A 3E17A 4JL7A 4PQWA 4WYUA 5D13A 1WFGA 3NFKA 2PA1A 2D90A 3JXTA 4JOJA 1RY4A 1VA8A 2KG2A 5FB8C 1TQ3A 5GNDA 2JILA 5H3JA 2F0AA 4Q3HA 3SFJA 2AWXA 2EEHA 4N6XA 2OQSA 3AXAA 3L4FD 5G1EA 1N6EA 5I7ZA 2KBSA 2VPHA 5F67A 4UU6A 2KA9A 1BE9A 2OGPA 4GVCA 1NTEA 1Q7XA 2OPGA 2IWNA 1T2MA 1RGRA 2EJYA 3ID3A 2KOMA 5HFEA 2IWPA 2OS6A 2BYGA 1Y8TA 1QAVA 4NMQA 4NNMA 3CBZA 4K76A 3KZDA 1PDRA 3QDOA 2EDZA 3DJ1A 3CBYA 1WH1A 1OZIA 1UEWA 2EV8A 3GJ9A 4Z8JA 1V1TA
chains in the Genus database with same CATH superfamily
3DJ3A 2EDVA 3ID1A 4NMTA 1QAVB 2JIKA 1U38A 3MH6A 1WF8A 5A2PA 3ID4A 2QKUA 1UJDA 2M0TA 3PV5A 3CYYA 5B6LA 2EEJA 3HPMA 2MHOA 2PKUA 2H2BA 1UEQA 4JOHA 1UITA 1X9ZA 2LA8A 1OBXA 2DC2A 2L4TA 3TMHA 3GDSA 2KAWA 5HEBA 1WIFA 2YUBA 3LNXA 1LCYA 2VWRA 2YTWA 2D92A 3KHFA 2YUYA 5HFFA 1TE0A 3PS4A 4NXQA 1UJUA 3O46A 5HF1A 3I1EA 5DTHA 5E22A 2F5YA 2MX6A 1V5LA 3MH4A 5HJ1A 2Q9VA 2EAQA 2I0LA 3VQGA 2CSSA 2JINA 2VSPA 2KOJA 3RL7A 3DORA 1D5GA 1N7EA 4NNLA 1MFGA 2JSNA 4JOFA 1R6JA 1GQ4A 1U39A 4UU5A 3GCNA 1UF1A 3DIWA 1Q3OA 4P2AB 5ILBA 4Q2QA 2ZPMA 4RI0A 3R0HA 2H3LA 1X6DA 1V5QA 1IU2A 3PV2A 3KDKA 1RGWA 2E7KA 3SHWA 4NMOA 2V1WA 1WI4A 2JXOA 4NMRA 3MH7A 2KL1A 5E21A 1K32A 5HF4A 2KRGA 1FC9A 3QIKA 2KJPA 1U37A 2L97A 2Z17A 1P1DA 3GSLA 1WG6A 2EGKA 2P3WA 3I4WA 4YYXA 1GQ5A 1V6BA 1SOZA 3SOEA 3EGHC 4E3BA 4NMSA 1UM1A 4Q2PA 2D8IA 2ENOA 2KJDA 5FHTA 3FY5A 3I18A 4Q6HA 1UEZA 1Q3PA 2EGNA 3NFLA 4G69A 3R68A 1KY9A 2DB5A 2KJKA 4JORA 1L6OA 1N6DA 3GABA 2KV8A 5HFBA 2HGAA 2W4FA 2PNTA 2M0ZA 2HE2A 1VCWA 2R3YA 3GGEA 1MC7A 5HEDA 4NMPA 2PKTA 2M0UA 1X5NA 1M5ZA 2FE5A 1X5RA 2I04A 2LOBA 3OTPA 5HDYA 2M10A 1QLCA 2I6VA 5GLJA 4JJ0A 2DLUA 3ZRTA 3R69A 2YT8A 2M0VA 4OEPA 2QKTA 1IHJA 4OEOA 2AINA 1X45A 2DLSA 1OBYA 4EDJA 4P0CA 2EGOA 3CBXA 3SHUA 4AMHA 2JOAA 3GDUA 2L4SA 3KDGA 2AWUA 2DAZA 1OBZA 1Y7NA 2ZPLA 3RL8A 3CC0A 1QAUA 1N6FA 1VB7A 3LNYA 4K72A 3QE1A 5HEYA 4WYTA 2KYLA 1NF3C 4NXRA 4MPAA 2KPLA 2OMJA 2EEIA 3CS0A 2FNEA 4HOPA 1IU0A 2VZ5A 3WKMA 2REYA 4REYA 2HE4A 2LC6A 3HPKA 1BFEA 3HVQC 4KFWA 3TSWA 2H2CA 2EDPA 2KOHA 4R2ZA 3EGGC 1P1EA 3BPUA 5HFDA 2QG1A 3KZEA 4Q2OA 5E11A 3SUZA 5HETA 3O5NA 5JXBA 2KQFA 4E35A 1TP5A 4JOKA 2LC7A 4LMMA 2K1ZA 4JOGA 4HOPB 2V90A 1N7TA 4NMVA 3DJAA 3STJA 2OCSA 4JOEA 1W9EA 4KFVA 4XHVA 4H11A 1X8SA 1W9OA 2QT5A 1XZ9A 1Z87A 1U3BA 2JWEA 2EEGA 3TSVA 2OZFA 1GM1A 2I0IA 2I1NA 2WL7A 1I16A 1UEPA 2UZCA 3TSZA 1N7FA 1WHDA 4F8KA 3QO6A 4FGMA 3NGHA 3VQFA 2LUIA 4K78A 2W7RA 1Z86A 3RLEA 1FC6A 4E34A 1VJ6A 4IC6A 1FCFA 1UFXA 2DMZA 2RCZA 4O06A 2YT7A 4OAJA 4JOPA 2FN5A 1UJVA 1I92A 2JREA 2M3MA 3GDVA 3B76A 1V62A 1WHAA 2QBWA 1WFVA 2IWOA 1N99A 4GHNA 2AWWA 3QGLA 3PV4A 3QJMA 1B8QA 2X7ZA 5E6PB 2KPKA 1RZXA 1ZUBA 2R4HA 1KWAA 2VSVA 3ID2A 2DM8A 4JJ3A 4FLNA 1X5QA 2DJTA 2H3MA 1TP3A 2Q3GA 2OSGA 2QKVA 4NXPA 2EHRA 3GCOA 1FC7A 1W9QA 2PDZA 5EYZA 1WJLA 2GEFA 3QJNA 2FCFA 4GVDA 5HFCA 2VRFA 5G1DA 1KEFA 2G5MB 2Z9IA 3K82A 2I4SA 1G9OA 1MFLA 2PZDA 2IWQA 3K1RA 5E1YA 2EXGA 2K20A 1ZOKA 3WKLA 3OU0A 4YDPA 1UM7A 3PDVA 1WF7A 4K6YA 1YBOA 2GZVA 3PDZA 3K50A 2RRMA 5IL9A 5EZ0A 1SOTA 3CH8A 4Q2NA 4Q6SA 4L8NA 2O2TA 4K75A 1VAEA 1WI2A 1UHPA 2CSJA 2CS5A 2DKRA 2G2LA 5F3XA 4Z33A 3E17A 4JL7A 4PQWA 4WYUA 5D13A 1WFGA 3NFKA 2PA1A 2D90A 3JXTA 4JOJA 1RY4A 1VA8A 2KG2A 5FB8C 1TQ3A 5GNDA 2JILA 5H3JA 2F0AA 4Q3HA 3SFJA 2AWXA 2EEHA 4N6XA 2OQSA 3NCVA 3AXAA 3L4FD 5G1EA 1N6EA 5I7ZA 2KBSA 2VPHA 5F67A 4UU6A 2KA9A 1BE9A 2OGPA 4GVCA 1NTEA 1Q7XA 2OPGA 2IWNA 1T2MA 1RGRA 2EJYA 3ID3A 2KOMA 5B42A 5HFEA 2IWPA 2OS6A 2BYGA 1Y8TA 1QAVA 4NMQA 4NNMA 3CBZA 4K76A 3KZDA 1PDRA 3QDOA 2EDZA 3DJ1A 3CBYA 1WH1A 1OZIA 1UEWA 2EV8A 3GJ9A 4Z8JA 1V1TA
chains in the Genus database with same CATH topology
3DJ3A 2EDVA 3ID1A 4NMTA 1QAVB 2JIKA 1U38A 3MH6A 1WF8A 5A2PA 3ID4A 2QKUA 1UJDA 2M0TA 3PV5A 3CYYA 5B6LA 2EEJA 3HPMA 2MHOA 2PKUA 2H2BA 1UEQA 4JOHA 1UITA 1X9ZA 2LA8A 1OBXA 2DC2A 2L4TA 3TMHA 3GDSA 2KAWA 5HEBA 1WIFA 2YUBA 3LNXA 1LCYA 2VWRA 2YTWA 2D92A 3KHFA 2YUYA 5HFFA 1TE0A 3PS4A 4NXQA 1UJUA 3O46A 5HF1A 3I1EA 5DTHA 5E22A 2F5YA 2MX6A 1V5LA 3MH4A 5HJ1A 2Q9VA 2EAQA 2I0LA 3VQGA 2CSSA 2JINA 2VSPA 2KOJA 3RL7A 3DORA 1D5GA 1N7EA 4NNLA 1MFGA 2JSNA 4JOFA 1R6JA 1GQ4A 1U39A 4UU5A 3GCNA 1UF1A 3DIWA 1Q3OA 4P2AB 5ILBA 4Q2QA 2ZPMA 4RI0A 3R0HA 2H3LA 1X6DA 1V5QA 1IU2A 3PV2A 3KDKA 1RGWA 2E7KA 3SHWA 4NMOA 2V1WA 1WI4A 2JXOA 4NMRA 3MH7A 2KL1A 5E21A 1K32A 5HF4A 2KRGA 1FC9A 3QIKA 2KJPA 1U37A 2L97A 2Z17A 1P1DA 3GSLA 1WG6A 2EGKA 2P3WA 3I4WA 4YYXA 1GQ5A 1V6BA 1SOZA 3SOEA 3EGHC 4E3BA 4NMSA 1UM1A 4Q2PA 2D8IA 2ENOA 2KJDA 5FHTA 3FY5A 3I18A 4Q6HA 1UEZA 1Q3PA 2EGNA 3NFLA 4G69A 3R68A 1KY9A 2DB5A 2KJKA 4JORA 1L6OA 1N6DA 3GABA 2KV8A 5HFBA 2HGAA 2W4FA 2PNTA 2M0ZA 2HE2A 1VCWA 2R3YA 3GGEA 1MC7A 5HEDA 4NMPA 2PKTA 2M0UA 1X5NA 1M5ZA 2FE5A 1X5RA 2I04A 2LOBA 3OTPA 5HDYA 2M10A 1QLCA 2I6VA 5GLJA 4JJ0A 2DLUA 3ZRTA 3R69A 2YT8A 2M0VA 4OEPA 2QKTA 1IHJA 4OEOA 2AINA 1X45A 2DLSA 1OBYA 4EDJA 4P0CA 2EGOA 3CBXA 3SHUA 4AMHA 2JOAA 3GDUA 2L4SA 3KDGA 2AWUA 2DAZA 1OBZA 1Y7NA 2ZPLA 3RL8A 3CC0A 1QAUA 1N6FA 1VB7A 3LNYA 4K72A 3QE1A 5HEYA 4WYTA 2KYLA 1NF3C 4NXRA 4MPAA 2KPLA 2OMJA 2EEIA 3CS0A 2FNEA 4HOPA 1IU0A 2VZ5A 3WKMA 2REYA 4REYA 2HE4A 2LC6A 3HPKA 1BFEA 3HVQC 4KFWA 3TSWA 2H2CA 2EDPA 2KOHA 4R2ZA 3EGGC 1P1EA 3BPUA 5HFDA 2QG1A 3KZEA 4Q2OA 5E11A 3SUZA 5HETA 3O5NA 5JXBA 2KQFA 4E35A 1TP5A 4JOKA 2LC7A 4LMMA 2K1ZA 4JOGA 4HOPB 2V90A 1N7TA 4NMVA 3DJAA 3STJA 2OCSA 4JOEA 1W9EA 4KFVA 4XHVA 4H11A 1X8SA 1W9OA 2QT5A 1XZ9A 1Z87A 1U3BA 2JWEA 2EEGA 3TSVA 2OZFA 1GM1A 2I0IA 2I1NA 2WL7A 1I16A 1UEPA 2UZCA 3TSZA 1N7FA 1WHDA 4F8KA 3QO6A 4FGMA 3NGHA 3VQFA 2LUIA 4K78A 2W7RA 1Z86A 3RLEA 1FC6A 4E34A 1VJ6A 4IC6A 1FCFA 1UFXA 2DMZA 2RCZA 4O06A 2YT7A 4OAJA 4JOPA 2FN5A 1UJVA 1I92A 2JREA 2M3MA 3GDVA 3B76A 1V62A 1WHAA 2QBWA 1WFVA 2IWOA 1N99A 4GHNA 2AWWA 3QGLA 3PV4A 3QJMA 1B8QA 2X7ZA 5E6PB 2KPKA 1RZXA 1ZUBA 2R4HA 1KWAA 2VSVA 3ID2A 2DM8A 4JJ3A 4FLNA 1X5QA 2DJTA 2H3MA 1TP3A 2Q3GA 2OSGA 2QKVA 4NXPA 2EHRA 3GCOA 1FC7A 1W9QA 2PDZA 5EYZA 1WJLA 2GEFA 3QJNA 2FCFA 4GVDA 5HFCA 2VRFA 5G1DA 1KEFA 2G5MB 2Z9IA 3K82A 2I4SA 1G9OA 1MFLA 2PZDA 2IWQA 3K1RA 5E1YA 2EXGA 2K20A 1ZOKA 3WKLA 3OU0A 4YDPA 1UM7A 3PDVA 1WF7A 4K6YA 1YBOA 2GZVA 3PDZA 3K50A 2RRMA 5IL9A 5EZ0A 1SOTA 3CH8A 4Q2NA 4Q6SA 4L8NA 2O2TA 4K75A 1VAEA 1WI2A 1UHPA 2CSJA 2CS5A 2DKRA 2G2LA 5F3XA 4Z33A 3E17A 4JL7A 4PQWA 4WYUA 5D13A 1WFGA 3NFKA 2PA1A 2D90A 3JXTA 4JOJA 1RY4A 1VA8A 2KG2A 5FB8C 1TQ3A 5GNDA 2JILA 5H3JA 2F0AA 4Q3HA 3SFJA 2AWXA 2EEHA 4N6XA 2OQSA 3NCVA 3AXAA 3L4FD 5G1EA 1N6EA 5I7ZA 2KBSA 2VPHA 5F67A 4UU6A 2KA9A 1BE9A 2OGPA 4GVCA 1NTEA 1Q7XA 2OPGA 2IWNA 1T2MA 1RGRA 2EJYA 3ID3A 2KOMA 5B42A 5HFEA 2IWPA 2OS6A 2BYGA 1Y8TA 1QAVA 4NMQA 4NNMA 3CBZA 4K76A 3KZDA 1PDRA 3QDOA 2EDZA 3DJ1A 3CBYA 1WH1A 1OZIA 1UEWA 2EV8A 3GJ9A 4Z8JA 1V1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJ3 A;  2EDV A;  3ID1 A;  4NMT A;  1QAV B;  2JIK A;  1U38 A;  3MH6 A;  1WF8 A;  5A2P A;  3ID4 A;  2QKU A;  1UJD A;  2M0T A;  3PV5 A;  3CYY A;  5B6L A;  2EEJ A;  3HPM A;  2MHO A;  2PKU A;  2H2B A;  1UEQ A;  4JOH A;  1UIT A;  2LA8 A;  1OBX A;  2DC2 A;  2L4T A;  3TMH A;  3GDS A;  2KAW A;  5HEB A;  1WIF A;  2YUB A;  3LNX A;  1LCY A;  2VWR A;  2YTW A;  2D92 A;  3KHF A;  2YUY A;  5HFF A;  1TE0 A;  3PS4 A;  4NXQ A;  1UJU A;  3O46 A;  5HF1 A;  3I1E A;  5DTH A;  5E22 A;  2F5Y A;  2MX6 A;  1V5L A;  3MH4 A;  5HJ1 A;  2Q9V A;  2EAQ A;  2I0L A;  3VQG A;  2CSS A;  2JIN A;  2VSP A;  2KOJ A;  3RL7 A;  3DOR A;  1D5G A;  1N7E A;  4NNL A;  1MFG A;  4JOF A;  1R6J A;  1GQ4 A;  1U39 A;  4UU5 A;  3GCN A;  1UF1 A;  3DIW A;  1Q3O A;  4P2A B;  4Q2Q A;  2ZPM A;  4RI0 A;  3R0H A;  2H3L A;  1X6D A;  1V5Q A;  1IU2 A;  3PV2 A;  1RGW A;  2E7K A;  3SHW A;  4NMO A;  2V1W A;  1WI4 A;  2JXO A;  4NMR A;  3MH7 A;  2KL1 A;  5E21 A;  1K32 A;  5HF4 A;  2KRG A;  1FC9 A;  3QIK A;  2KJP A;  1U37 A;  2L97 A;  2Z17 A;  1P1D A;  3GSL A;  1WG6 A;  2EGK A;  2P3W A;  3I4W A;  4YYX A;  1GQ5 A;  1V6B A;  1SOZ A;  3SOE A;  3EGH C;  4E3B A;  4NMS A;  1UM1 A;  4Q2P A;  2D8I A;  2ENO A;  2KJD A;  5FHT A;  3FY5 A;  3I18 A;  4Q6H A;  1UEZ A;  1Q3P A;  2EGN A;  3NFL A;  4G69 A;  3R68 A;  1KY9 A;  2DB5 A;  2KJK A;  4JOR A;  1L6O A;  1N6D A;  2KV8 A;  5HFB A;  2HGA A;  2W4F A;  2PNT A;  2M0Z A;  2HE2 A;  1VCW A;  2R3Y A;  3GGE A;  1MC7 A;  5HED A;  4NMP A;  2PKT A;  2M0U A;  1X5N A;  1M5Z A;  2FE5 A;  1X5R A;  2I04 A;  2LOB A;  3OTP A;  5HDY A;  2M10 A;  1QLC A;  2I6V A;  5GLJ A;  2DLU A;  3ZRT A;  3R69 A;  2YT8 A;  2M0V A;  4OEP A;  2QKT A;  1IHJ A;  4OEO A;  2AIN A;  1X45 A;  2DLS A;  1OBY A;  4EDJ A;  4P0C A;  2EGO A;  3CBX A;  3SHU A;  4AMH A;  2JOA A;  3GDU A;  2L4S A;  2AWU A;  2DAZ A;  1OBZ A;  1Y7N A;  2ZPL A;  3RL8 A;  3CC0 A;  1QAU A;  1N6F A;  1VB7 A;  3LNY A;  4K72 A;  3QE1 A;  5HEY A;  4WYT A;  2KYL A;  1NF3 C;  4NXR A;  4MPA A;  2KPL A;  2OMJ A;  2EEI A;  3CS0 A;  2FNE A;  4HOP A;  1IU0 A;  2VZ5 A;  3WKM A;  2REY A;  4REY A;  2HE4 A;  2LC6 A;  3HPK A;  1BFE A;  3HVQ C;  4KFW A;  3TSW A;  2H2C A;  2EDP A;  2KOH A;  4R2Z A;  3EGG C;  1P1E A;  3BPU A;  5HFD A;  2QG1 A;  3KZE A;  4Q2O A;  5E11 A;  3SUZ A;  5HET A;  3O5N A;  5JXB A;  2KQF A;  4E35 A;  1TP5 A;  4JOK A;  2LC7 A;  4LMM A;  2K1Z A;  4JOG A;  4HOP B;  2V90 A;  1N7T A;  4NMV A;  3DJA A;  3STJ A;  2OCS A;  4JOE A;  1W9E A;  4KFV A;  4XHV A;  4H11 A;  1X8S A;  1W9O A;  2QT5 A;  1XZ9 A;  1Z87 A;  1U3B A;  2JWE A;  2EEG A;  3TSV A;  2OZF A;  1GM1 A;  2I0I A;  2I1N A;  2WL7 A;  1I16 A;  1UEP A;  2UZC A;  3TSZ A;  1N7F A;  1WHD A;  4F8K A;  3QO6 A;  4FGM A;  3NGH A;  3VQF A;  2LUI A;  4K78 A;  2W7R A;  1Z86 A;  3RLE A;  1FC6 A;  4E34 A;  1VJ6 A;  4IC6 A;  1FCF A;  1UFX A;  2DMZ A;  2RCZ A;  4O06 A;  2YT7 A;  4OAJ A;  4JOP A;  2FN5 A;  1UJV A;  1I92 A;  2JRE A;  2M3M A;  3GDV A;  3B76 A;  1V62 A;  1WHA A;  2QBW A;  1WFV A;  2IWO A;  1N99 A;  4GHN A;  2AWW A;  3QGL A;  3PV4 A;  3QJM A;  1B8Q A;  2X7Z A;  5E6P B;  2KPK A;  1RZX A;  1ZUB A;  2R4H A;  1KWA A;  2VSV A;  3ID2 A;  2DM8 A;  1X5Q A;  2DJT A;  2H3M A;  1TP3 A;  2Q3G A;  2OSG A;  2QKV A;  4NXP A;  2EHR A;  3GCO A;  1FC7 A;  1W9Q A;  2PDZ A;  5EYZ A;  1WJL A;  3QJN A;  2FCF A;  4GVD A;  5HFC A;  2VRF A;  5G1D A;  1KEF A;  2G5M B;  2Z9I A;  3K82 A;  2I4S A;  1G9O A;  1MFL A;  2PZD A;  2IWQ A;  3K1R A;  5E1Y A;  2EXG A;  2K20 A;  1ZOK A;  3WKL A;  3OU0 A;  4YDP A;  1UM7 A;  3PDV A;  1WF7 A;  4K6Y A;  1YBO A;  2GZV A;  3PDZ A;  3K50 A;  2RRM A;  5EZ0 A;  1SOT A;  3CH8 A;  4Q2N A;  4Q6S A;  4L8N A;  2O2T A;  4K75 A;  1VAE A;  1WI2 A;  1UHP A;  2CSJ A;  2CS5 A;  2DKR A;  2G2L A;  5F3X A;  4Z33 A;  3E17 A;  4JL7 A;  4PQW A;  4WYU A;  5D13 A;  1WFG A;  3NFK A;  2PA1 A;  2D90 A;  3JXT A;  4JOJ A;  1RY4 A;  1VA8 A;  2KG2 A;  5FB8 C;  1TQ3 A;  5GND A;  2JIL A;  5H3J A;  2F0A A;  4Q3H A;  3SFJ A;  2AWX A;  2EEH A;  4N6X A;  2OQS A;  3AXA A;  3L4F D;  5G1E A;  1N6E A;  5I7Z A;  2KBS A;  2VPH A;  5F67 A;  4UU6 A;  2KA9 A;  1BE9 A;  2OGP A;  4GVC A;  1NTE A;  1Q7X A;  2OPG A;  2IWN A;  1T2M A;  1RGR A;  2EJY A;  3ID3 A;  2KOM A;  5HFE A;  2IWP A;  2OS6 A;  2BYG A;  1Y8T A;  1QAV A;  4NMQ A;  4NNM A;  3CBZ A;  4K76 A;  3KZD A;  1PDR A;  3QDO A;  2EDZ A;  3DJ1 A;  3CBY A;  1WH1 A;  1OZI A;  1UEW A;  2EV8 A;  3GJ9 A;  4Z8J A;  1V1T A; 
#chains in the Genus database with same CATH topology
 3DJ3 A;  2EDV A;  3ID1 A;  4NMT A;  1QAV B;  2JIK A;  1U38 A;  3MH6 A;  1WF8 A;  5A2P A;  3ID4 A;  2QKU A;  1UJD A;  2M0T A;  3PV5 A;  3CYY A;  5B6L A;  2EEJ A;  3HPM A;  2MHO A;  2PKU A;  2H2B A;  1UEQ A;  4JOH A;  1UIT A;  1X9Z A;  2LA8 A;  1OBX A;  2DC2 A;  2L4T A;  3TMH A;  3GDS A;  2KAW A;  5HEB A;  1WIF A;  2YUB A;  3LNX A;  1LCY A;  2VWR A;  2YTW A;  2D92 A;  3KHF A;  2YUY A;  5HFF A;  1TE0 A;  3PS4 A;  4NXQ A;  1UJU A;  3O46 A;  5HF1 A;  3I1E A;  5DTH A;  5E22 A;  2F5Y A;  2MX6 A;  1V5L A;  3MH4 A;  5HJ1 A;  2Q9V A;  2EAQ A;  2I0L A;  3VQG A;  2CSS A;  2JIN A;  2VSP A;  2KOJ A;  3RL7 A;  3DOR A;  1D5G A;  1N7E A;  4NNL A;  1MFG A;  2JSN A;  4JOF A;  1R6J A;  1GQ4 A;  1U39 A;  4UU5 A;  3GCN A;  1UF1 A;  3DIW A;  1Q3O A;  4P2A B;  5ILB A;  4Q2Q A;  2ZPM A;  4RI0 A;  3R0H A;  2H3L A;  1X6D A;  1V5Q A;  1IU2 A;  3PV2 A;  3KDK A;  1RGW A;  2E7K A;  3SHW A;  4NMO A;  2V1W A;  1WI4 A;  2JXO A;  4NMR A;  3MH7 A;  2KL1 A;  5E21 A;  1K32 A;  5HF4 A;  2KRG A;  1FC9 A;  3QIK A;  2KJP A;  1U37 A;  2L97 A;  2Z17 A;  1P1D A;  3GSL A;  1WG6 A;  2EGK A;  2P3W A;  3I4W A;  4YYX A;  1GQ5 A;  1V6B A;  1SOZ A;  3SOE A;  3EGH C;  4E3B A;  4NMS A;  1UM1 A;  4Q2P A;  2D8I A;  2ENO A;  2KJD A;  5FHT A;  3FY5 A;  3I18 A;  4Q6H A;  1UEZ A;  1Q3P A;  2EGN A;  3NFL A;  4G69 A;  3R68 A;  1KY9 A;  2DB5 A;  2KJK A;  4JOR A;  1L6O A;  1N6D A;  3GAB A;  2KV8 A;  5HFB A;  2HGA A;  2W4F A;  2PNT A;  2M0Z A;  2HE2 A;  1VCW A;  2R3Y A;  3GGE A;  1MC7 A;  5HED A;  4NMP A;  2PKT A;  2M0U A;  1X5N A;  1M5Z A;  2FE5 A;  1X5R A;  2I04 A;  2LOB A;  3OTP A;  5HDY A;  2M10 A;  1QLC A;  2I6V A;  5GLJ A;  4JJ0 A;  2DLU A;  3ZRT A;  3R69 A;  2YT8 A;  2M0V A;  4OEP A;  2QKT A;  1IHJ A;  4OEO A;  2AIN A;  1X45 A;  2DLS A;  1OBY A;  4EDJ A;  4P0C A;  2EGO A;  3CBX A;  3SHU A;  4AMH A;  2JOA A;  3GDU A;  2L4S A;  3KDG A;  2AWU A;  2DAZ A;  1OBZ A;  1Y7N A;  2ZPL A;  3RL8 A;  3CC0 A;  1QAU A;  1N6F A;  1VB7 A;  3LNY A;  4K72 A;  3QE1 A;  5HEY A;  4WYT A;  2KYL A;  1NF3 C;  4NXR A;  4MPA A;  2KPL A;  2OMJ A;  2EEI A;  3CS0 A;  2FNE A;  4HOP A;  1IU0 A;  2VZ5 A;  3WKM A;  2REY A;  4REY A;  2HE4 A;  2LC6 A;  3HPK A;  1BFE A;  3HVQ C;  4KFW A;  3TSW A;  2H2C A;  2EDP A;  2KOH A;  4R2Z A;  3EGG C;  1P1E A;  3BPU A;  5HFD A;  2QG1 A;  3KZE A;  4Q2O A;  5E11 A;  3SUZ A;  5HET A;  3O5N A;  5JXB A;  2KQF A;  4E35 A;  1TP5 A;  4JOK A;  2LC7 A;  4LMM A;  2K1Z A;  4JOG A;  4HOP B;  2V90 A;  1N7T A;  4NMV A;  3DJA A;  3STJ A;  2OCS A;  4JOE A;  1W9E A;  4KFV A;  4XHV A;  4H11 A;  1X8S A;  1W9O A;  2QT5 A;  1XZ9 A;  1Z87 A;  1U3B A;  2JWE A;  2EEG A;  3TSV A;  2OZF A;  1GM1 A;  2I0I A;  2I1N A;  2WL7 A;  1I16 A;  1UEP A;  2UZC A;  3TSZ A;  1N7F A;  1WHD A;  4F8K A;  3QO6 A;  4FGM A;  3NGH A;  3VQF A;  2LUI A;  4K78 A;  2W7R A;  1Z86 A;  3RLE A;  1FC6 A;  4E34 A;  1VJ6 A;  4IC6 A;  1FCF A;  1UFX A;  2DMZ A;  2RCZ A;  4O06 A;  2YT7 A;  4OAJ A;  4JOP A;  2FN5 A;  1UJV A;  1I92 A;  2JRE A;  2M3M A;  3GDV A;  3B76 A;  1V62 A;  1WHA A;  2QBW A;  1WFV A;  2IWO A;  1N99 A;  4GHN A;  2AWW A;  3QGL A;  3PV4 A;  3QJM A;  1B8Q A;  2X7Z A;  5E6P B;  2KPK A;  1RZX A;  1ZUB A;  2R4H A;  1KWA A;  2VSV A;  3ID2 A;  2DM8 A;  4JJ3 A;  4FLN A;  1X5Q A;  2DJT A;  2H3M A;  1TP3 A;  2Q3G A;  2OSG A;  2QKV A;  4NXP A;  2EHR A;  3GCO A;  1FC7 A;  1W9Q A;  2PDZ A;  5EYZ A;  1WJL A;  2GEF A;  3QJN A;  2FCF A;  4GVD A;  5HFC A;  2VRF A;  5G1D A;  1KEF A;  2G5M B;  2Z9I A;  3K82 A;  2I4S A;  1G9O A;  1MFL A;  2PZD A;  2IWQ A;  3K1R A;  5E1Y A;  2EXG A;  2K20 A;  1ZOK A;  3WKL A;  3OU0 A;  4YDP A;  1UM7 A;  3PDV A;  1WF7 A;  4K6Y A;  1YBO A;  2GZV A;  3PDZ A;  3K50 A;  2RRM A;  5IL9 A;  5EZ0 A;  1SOT A;  3CH8 A;  4Q2N A;  4Q6S A;  4L8N A;  2O2T A;  4K75 A;  1VAE A;  1WI2 A;  1UHP A;  2CSJ A;  2CS5 A;  2DKR A;  2G2L A;  5F3X A;  4Z33 A;  3E17 A;  4JL7 A;  4PQW A;  4WYU A;  5D13 A;  1WFG A;  3NFK A;  2PA1 A;  2D90 A;  3JXT A;  4JOJ A;  1RY4 A;  1VA8 A;  2KG2 A;  5FB8 C;  1TQ3 A;  5GND A;  2JIL A;  5H3J A;  2F0A A;  4Q3H A;  3SFJ A;  2AWX A;  2EEH A;  4N6X A;  2OQS A;  3NCV A;  3AXA A;  3L4F D;  5G1E A;  1N6E A;  5I7Z A;  2KBS A;  2VPH A;  5F67 A;  4UU6 A;  2KA9 A;  1BE9 A;  2OGP A;  4GVC A;  1NTE A;  1Q7X A;  2OPG A;  2IWN A;  1T2M A;  1RGR A;  2EJY A;  3ID3 A;  2KOM A;  5B42 A;  5HFE A;  2IWP A;  2OS6 A;  2BYG A;  1Y8T A;  1QAV A;  4NMQ A;  4NNM A;  3CBZ A;  4K76 A;  3KZD A;  1PDR A;  3QDO A;  2EDZ A;  3DJ1 A;  3CBY A;  1WH1 A;  1OZI A;  1UEW A;  2EV8 A;  3GJ9 A;  4Z8J A;  1V1T A; 
#chains in the Genus database with same CATH homology
 3DJ3 A;  2EDV A;  3ID1 A;  4NMT A;  1QAV B;  2JIK A;  1U38 A;  3MH6 A;  1WF8 A;  5A2P A;  3ID4 A;  2QKU A;  1UJD A;  2M0T A;  3PV5 A;  3CYY A;  5B6L A;  2EEJ A;  3HPM A;  2MHO A;  2PKU A;  2H2B A;  1UEQ A;  4JOH A;  1UIT A;  1X9Z A;  2LA8 A;  1OBX A;  2DC2 A;  2L4T A;  3TMH A;  3GDS A;  2KAW A;  5HEB A;  1WIF A;  2YUB A;  3LNX A;  1LCY A;  2VWR A;  2YTW A;  2D92 A;  3KHF A;  2YUY A;  5HFF A;  1TE0 A;  3PS4 A;  4NXQ A;  1UJU A;  3O46 A;  5HF1 A;  3I1E A;  5DTH A;  5E22 A;  2F5Y A;  2MX6 A;  1V5L A;  3MH4 A;  5HJ1 A;  2Q9V A;  2EAQ A;  2I0L A;  3VQG A;  2CSS A;  2JIN A;  2VSP A;  2KOJ A;  3RL7 A;  3DOR A;  1D5G A;  1N7E A;  4NNL A;  1MFG A;  2JSN A;  4JOF A;  1R6J A;  1GQ4 A;  1U39 A;  4UU5 A;  3GCN A;  1UF1 A;  3DIW A;  1Q3O A;  4P2A B;  5ILB A;  4Q2Q A;  2ZPM A;  4RI0 A;  3R0H A;  2H3L A;  1X6D A;  1V5Q A;  1IU2 A;  3PV2 A;  3KDK A;  1RGW A;  2E7K A;  3SHW A;  4NMO A;  2V1W A;  1WI4 A;  2JXO A;  4NMR A;  3MH7 A;  2KL1 A;  5E21 A;  1K32 A;  5HF4 A;  2KRG A;  1FC9 A;  3QIK A;  2KJP A;  1U37 A;  2L97 A;  2Z17 A;  1P1D A;  3GSL A;  1WG6 A;  2EGK A;  2P3W A;  3I4W A;  4YYX A;  1GQ5 A;  1V6B A;  1SOZ A;  3SOE A;  3EGH C;  4E3B A;  4NMS A;  1UM1 A;  4Q2P A;  2D8I A;  2ENO A;  2KJD A;  5FHT A;  3FY5 A;  3I18 A;  4Q6H A;  1UEZ A;  1Q3P A;  2EGN A;  3NFL A;  4G69 A;  3R68 A;  1KY9 A;  2DB5 A;  2KJK A;  4JOR A;  1L6O A;  1N6D A;  3GAB A;  2KV8 A;  5HFB A;  2HGA A;  2W4F A;  2PNT A;  2M0Z A;  2HE2 A;  1VCW A;  2R3Y A;  3GGE A;  1MC7 A;  5HED A;  4NMP A;  2PKT A;  2M0U A;  1X5N A;  1M5Z A;  2FE5 A;  1X5R A;  2I04 A;  2LOB A;  3OTP A;  5HDY A;  2M10 A;  1QLC A;  2I6V A;  5GLJ A;  4JJ0 A;  2DLU A;  3ZRT A;  3R69 A;  2YT8 A;  2M0V A;  4OEP A;  2QKT A;  1IHJ A;  4OEO A;  2AIN A;  1X45 A;  2DLS A;  1OBY A;  4EDJ A;  4P0C A;  2EGO A;  3CBX A;  3SHU A;  4AMH A;  2JOA A;  3GDU A;  2L4S A;  3KDG A;  2AWU A;  2DAZ A;  1OBZ A;  1Y7N A;  2ZPL A;  3RL8 A;  3CC0 A;  1QAU A;  1N6F A;  1VB7 A;  3LNY A;  4K72 A;  3QE1 A;  5HEY A;  4WYT A;  2KYL A;  1NF3 C;  4NXR A;  4MPA A;  2KPL A;  2OMJ A;  2EEI A;  3CS0 A;  2FNE A;  4HOP A;  1IU0 A;  2VZ5 A;  3WKM A;  2REY A;  4REY A;  2HE4 A;  2LC6 A;  3HPK A;  1BFE A;  3HVQ C;  4KFW A;  3TSW A;  2H2C A;  2EDP A;  2KOH A;  4R2Z A;  3EGG C;  1P1E A;  3BPU A;  5HFD A;  2QG1 A;  3KZE A;  4Q2O A;  5E11 A;  3SUZ A;  5HET A;  3O5N A;  5JXB A;  2KQF A;  4E35 A;  1TP5 A;  4JOK A;  2LC7 A;  4LMM A;  2K1Z A;  4JOG A;  4HOP B;  2V90 A;  1N7T A;  4NMV A;  3DJA A;  3STJ A;  2OCS A;  4JOE A;  1W9E A;  4KFV A;  4XHV A;  4H11 A;  1X8S A;  1W9O A;  2QT5 A;  1XZ9 A;  1Z87 A;  1U3B A;  2JWE A;  2EEG A;  3TSV A;  2OZF A;  1GM1 A;  2I0I A;  2I1N A;  2WL7 A;  1I16 A;  1UEP A;  2UZC A;  3TSZ A;  1N7F A;  1WHD A;  4F8K A;  3QO6 A;  4FGM A;  3NGH A;  3VQF A;  2LUI A;  4K78 A;  2W7R A;  1Z86 A;  3RLE A;  1FC6 A;  4E34 A;  1VJ6 A;  4IC6 A;  1FCF A;  1UFX A;  2DMZ A;  2RCZ A;  4O06 A;  2YT7 A;  4OAJ A;  4JOP A;  2FN5 A;  1UJV A;  1I92 A;  2JRE A;  2M3M A;  3GDV A;  3B76 A;  1V62 A;  1WHA A;  2QBW A;  1WFV A;  2IWO A;  1N99 A;  4GHN A;  2AWW A;  3QGL A;  3PV4 A;  3QJM A;  1B8Q A;  2X7Z A;  5E6P B;  2KPK A;  1RZX A;  1ZUB A;  2R4H A;  1KWA A;  2VSV A;  3ID2 A;  2DM8 A;  4JJ3 A;  4FLN A;  1X5Q A;  2DJT A;  2H3M A;  1TP3 A;  2Q3G A;  2OSG A;  2QKV A;  4NXP A;  2EHR A;  3GCO A;  1FC7 A;  1W9Q A;  2PDZ A;  5EYZ A;  1WJL A;  2GEF A;  3QJN A;  2FCF A;  4GVD A;  5HFC A;  2VRF A;  5G1D A;  1KEF A;  2G5M B;  2Z9I A;  3K82 A;  2I4S A;  1G9O A;  1MFL A;  2PZD A;  2IWQ A;  3K1R A;  5E1Y A;  2EXG A;  2K20 A;  1ZOK A;  3WKL A;  3OU0 A;  4YDP A;  1UM7 A;  3PDV A;  1WF7 A;  4K6Y A;  1YBO A;  2GZV A;  3PDZ A;  3K50 A;  2RRM A;  5IL9 A;  5EZ0 A;  1SOT A;  3CH8 A;  4Q2N A;  4Q6S A;  4L8N A;  2O2T A;  4K75 A;  1VAE A;  1WI2 A;  1UHP A;  2CSJ A;  2CS5 A;  2DKR A;  2G2L A;  5F3X A;  4Z33 A;  3E17 A;  4JL7 A;  4PQW A;  4WYU A;  5D13 A;  1WFG A;  3NFK A;  2PA1 A;  2D90 A;  3JXT A;  4JOJ A;  1RY4 A;  1VA8 A;  2KG2 A;  5FB8 C;  1TQ3 A;  5GND A;  2JIL A;  5H3J A;  2F0A A;  4Q3H A;  3SFJ A;  2AWX A;  2EEH A;  4N6X A;  2OQS A;  3NCV A;  3AXA A;  3L4F D;  5G1E A;  1N6E A;  5I7Z A;  2KBS A;  2VPH A;  5F67 A;  4UU6 A;  2KA9 A;  1BE9 A;  2OGP A;  4GVC A;  1NTE A;  1Q7X A;  2OPG A;  2IWN A;  1T2M A;  1RGR A;  2EJY A;  3ID3 A;  2KOM A;  5B42 A;  5HFE A;  2IWP A;  2OS6 A;  2BYG A;  1Y8T A;  1QAV A;  4NMQ A;  4NNM A;  3CBZ A;  4K76 A;  3KZD A;  1PDR A;  3QDO A;  2EDZ A;  3DJ1 A;  3CBY A;  1WH1 A;  1OZI A;  1UEW A;  2EV8 A;  3GJ9 A;  4Z8J A;  1V1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...