4JORA

Cftr associated ligand (cal) pdz domain bound to hpv18 e6 oncoprotein c-terminal peptide (rlqrrretqv)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
87
structure length
87
Chain Sequence
b'GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Golgi-associated PDZ and coiled-coil motif-containing protei
publication title Stereochemical Preferences Modulate Affinity and Selectivity among Five PDZ Domains that Bind CFTR: Comparative Structural and Sequence Analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 19
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 4jorA00
2ZPLA 3QGLA 4NMTA 1P1DA 2QKTA 4OAJA 2KJPA 1X45A 2IWPA 5B6LA 5EZ0A 4JOFA 3SFJA 4NXPA 4NNMA 2O2TA 4IC6A 2OS6A 2BYGA 2KG2A 2REYA 2DLUA 4WYUA 5D13A 4Z8JA 2CSSA 3CYYA 1UITA 2EGNA 1NF3C 5E1YA 3R69A 2VPHA 1Q3OA 4NMQA 5HEYA 3GCOA 1K32A 1LCYA 4GVDA 2M0TA 2Z9IA 4F8KA 1Y7NA 5JXBA 2M0VA 3GDUA 3ID2A 2K1ZA 2OCSA 3GCNA 2HE4A 1R6JA 3TSZA 2QG1A 4MPAA 5E11A 4E35A 2DB5A 2X7ZA 3PV2A 4HOPB 5G1EA 4K6YA 3CS0A 1N7TA 2FCFA 1OBZA 3DORA 1Z86A 3TMHA 1TQ3A 2DKRA 1D5GA 2LC7A 1GQ4A 2VRFA 4NMPA 3PV4A 3CH8A 3QJNA 3O5NA 4K76A 5HEDA 2EJYA 2ZPMA 2EEIA 4G69A 2E7KA 4UU6A 5A2PA 2KJKA 2KYLA 4Q2QA 2I4SA 4RI0A 4R2ZA 3MH7A 2GZVA 5DTHA 3QO6A 1RGWA 1WI4A 4JL7A 3EGGC 1OBXA 3I18A 1N99A 1WHDA 2KOHA 4Q6SA 4N6XA 2PNTA 2YT8A 2I1NA 3RL7A 3WKLA 3MH6A 2EEGA 4NXQA 1WJLA 3VQGA 5FB8C 4JOKA 3OTPA 2Q9VA 1P1EA 2UZCA 2H2CA 1KWAA 3BPUA 2QKVA 1X5QA 2QT5A 2YUBA 1I92A 3ID3A 2L97A 1UHPA 5E22A 1Z87A 4Q3HA 2K20A 3KZEA 3I1EA 1ZUBA 2L4SA 5HFFA 3NFKA 2CS5A 2G5MB 1Y8TA 2DLSA 1FC6A 3E17A 4K72A 1MFLA 1W9OA 3CC0A 3PV5A 1G9OA 3TSVA 3DIWA 3QIKA 2AWUA 2DMZA 4JORA 1RY4A 5HF1A 1TE0A 2H2BA 2LOBA 5HFCA 1B8QA 1V62A 2HGAA 4L8NA 1Q7XA 3FY5A 2OMJA 2EEHA 1KEFA 1XZ9A 2JINA 1M5ZA 1N6EA 1MC7A 5FHTA 5F67A 4E3BA 2KJDA 2VZ5A 3K82A 2G2LA 3PDVA 3SOEA 1WG6A 1WF7A 1OZIA 1UJDA 4FGMA 2EDPA 4WYTA 3K1RA 5HFDA 2L4TA 4GVCA 5HDYA 2M0ZA 2V1WA 1NTEA 1N6FA 4JOEA 2CSJA 4UU5A 2I0LA 2LC6A 2JREA 5HF4A 1GM1A 4XHVA 1RZXA 1BFEA 2M3MA 1RGRA 4HOPA 2W7RA 2I04A 2W4FA 3GDVA 2OSGA 1UEQA 4Q6HA 1UEZA 3QDOA 2ENOA 3AXAA 4Q2OA 2D8IA 2EGOA 4NXRA 4O06A 3R68A 1X6DA 5HJ1A 2VWRA 1WI2A 3ZRTA 2HE2A 1ZOKA 3CBZA 2KPKA 1UF1A 2VSVA 4NMSA 4AMHA 1U38A 4K78A 1MFGA 2KRGA 2FN5A 2JWEA 2I6VA 5HFEA 2EGKA 1KY9A 1QAVB 4NMOA 1BE9A 1I16A 3WKMA 2EHRA 2DJTA 3PDZA 3SUZA 1UEPA 2F0AA 2YTWA 3NFLA 4EDJA 1V1TA 2V90A 3QJMA 3STJA 3DJAA 2IWQA 2MHOA 2FE5A 1V6BA 2QKUA 2OPGA 1QAUA 4P0CA 2IWNA 2H3LA 4KFWA 2EAQA 1VA8A 2FNEA 1YBOA 1UFXA 1QLCA 1WF8A 3PS4A 3GGEA 3JXTA 4YDPA 1WIFA 2AWXA 2IWOA 2LA8A 1IU2A 2DM8A 3ID4A 4OEOA 2OGPA 2PKTA 5GNDA 4REYA 1GQ5A 1V5LA 2EDVA 4Q2PA 3VQFA 2DC2A 1T2MA 1N6DA 3GJ9A 3SHWA 2JILA 1U39A 3DJ1A 5EYZA 4YYXA 1FC9A 5GLJA 4K75A 2AWWA 2Q3GA 2KOMA 1U37A 3B76A 1X8SA 1U3BA 2EXGA 2R4HA 1VAEA 3RLEA 2I0IA 4KFVA 3HVQC 3DJ3A 2OQSA 4LMMA 3HPKA 1VB7A 4JOPA 1N7EA 2VSPA 3ID1A 1V5QA 2M10A 2WL7A 2PDZA 3KHFA 2JXOA 1IU0A 2KPLA 4NNLA 3I4WA 3NGHA 2KBSA 3LNXA 1L6OA 1PDRA 4H11A 3LNYA 1W9EA 2KV8A 1SOTA 4GHNA 2OZFA 3CBYA 1X5RA 2JIKA 2QBWA 2H3MA 2LUIA 1UEWA 2PZDA 3K50A 1OBYA 3R0HA 5H3JA 1WH1A 5HEBA 1W9QA 2P3WA 3RL8A 1VJ6A 1UM7A 2F5YA 4P2AB 3KZDA 2EV8A 4PQWA 4E34A 4JOJA 1UJVA 2KQFA 1TP5A 1VCWA 1UM1A 2KOJA 4OEPA 4Q2NA 2PKUA 1WHAA 3TSWA 5HFBA 1UJUA 2YT7A 1N7FA 2M0UA 2RCZA 1TP3A 3L4FD 3MH4A 4JOHA 2KAWA 5HETA 1FCFA 3GSLA 4JOGA 2RRMA 5F3XA 2Z17A 2D92A 1Q3PA 1SOZA 4NMRA 4NMVA 3O46A 4Z33A 2AINA 2YUYA 2KA9A 2PA1A 1X5NA 1WFGA 2EDZA 3HPMA 3GDSA 2EEJA 1IHJA 2DAZA 3OU0A 5E6PB 5E21A 1WFVA 3SHUA 2R3YA 3CBXA 2MX6A 1QAVA 5G1DA 1FC7A 2JOAA 3EGHC 2D90A 2KL1A 5I7ZA 3QE1A
chains in the Genus database with same CATH superfamily
2ZPLA 3QGLA 4NMTA 1P1DA 2QKTA 4OAJA 2KJPA 1X45A 2IWPA 5B6LA 5EZ0A 4JOFA 3SFJA 4NXPA 4NNMA 2O2TA 4IC6A 2OS6A 2BYGA 2KG2A 2REYA 2DLUA 4WYUA 5D13A 4Z8JA 2CSSA 3CYYA 1UITA 2EGNA 1NF3C 5E1YA 3R69A 2VPHA 1Q3OA 4NMQA 5HEYA 2JSNA 3GCOA 1K32A 1LCYA 4GVDA 2M0TA 2Z9IA 4F8KA 1Y7NA 5JXBA 2M0VA 3GDUA 3ID2A 2K1ZA 2OCSA 3GCNA 2HE4A 1R6JA 3TSZA 2QG1A 4MPAA 5E11A 4E35A 2DB5A 2X7ZA 3PV2A 4HOPB 5G1EA 4K6YA 3CS0A 1N7TA 2FCFA 1OBZA 3DORA 1Z86A 3TMHA 1TQ3A 2DKRA 1D5GA 2LC7A 1GQ4A 2VRFA 4NMPA 3PV4A 3CH8A 3QJNA 3O5NA 4K76A 5HEDA 2EJYA 2ZPMA 2EEIA 4G69A 2E7KA 2GEFA 4UU6A 5A2PA 2KJKA 2KYLA 4Q2QA 2I4SA 4RI0A 4R2ZA 3MH7A 2GZVA 5DTHA 3QO6A 1RGWA 1WI4A 4JL7A 3EGGC 1OBXA 3I18A 1N99A 1WHDA 2KOHA 4Q6SA 4N6XA 2PNTA 2YT8A 2I1NA 3RL7A 3WKLA 3MH6A 2EEGA 4NXQA 1WJLA 3VQGA 5FB8C 4JOKA 3OTPA 2Q9VA 1P1EA 2UZCA 2H2CA 1KWAA 3BPUA 2QKVA 4JJ0A 1X5QA 2QT5A 2YUBA 1I92A 3ID3A 2L97A 1UHPA 5E22A 1Z87A 4Q3HA 2K20A 3KZEA 3I1EA 1ZUBA 2L4SA 5HFFA 3NFKA 2CS5A 2G5MB 1Y8TA 2DLSA 1FC6A 3E17A 4K72A 1MFLA 1W9OA 3CC0A 3PV5A 1G9OA 3TSVA 3DIWA 3QIKA 2AWUA 2DMZA 4JORA 1RY4A 5HF1A 1TE0A 2H2BA 2LOBA 5HFCA 1B8QA 1V62A 2HGAA 4L8NA 1Q7XA 3FY5A 2OMJA 2EEHA 1KEFA 1XZ9A 2JINA 1M5ZA 1N6EA 1MC7A 5FHTA 5F67A 4E3BA 2KJDA 2VZ5A 3K82A 2G2LA 3PDVA 3SOEA 1WG6A 1WF7A 1OZIA 1UJDA 4FGMA 2EDPA 4WYTA 3GABA 5ILBA 3K1RA 5HFDA 2L4TA 4GVCA 5HDYA 2M0ZA 2V1WA 1NTEA 1N6FA 4JOEA 2CSJA 4UU5A 2I0LA 2LC6A 3KDGA 2JREA 5HF4A 1GM1A 4XHVA 1RZXA 1BFEA 2M3MA 1RGRA 4HOPA 2W7RA 2I04A 2W4FA 3GDVA 2OSGA 1UEQA 4Q6HA 1UEZA 3QDOA 2ENOA 3AXAA 4Q2OA 2D8IA 2EGOA 3NCVA 4NXRA 4O06A 3R68A 1X6DA 5HJ1A 2VWRA 1WI2A 3ZRTA 2HE2A 1ZOKA 3CBZA 2KPKA 1UF1A 2VSVA 4NMSA 4AMHA 1U38A 4K78A 1MFGA 2KRGA 2FN5A 2JWEA 2I6VA 5HFEA 2EGKA 1KY9A 1QAVB 4NMOA 1BE9A 1I16A 3WKMA 2EHRA 2DJTA 3PDZA 3SUZA 1UEPA 2F0AA 2YTWA 3NFLA 4EDJA 1V1TA 2V90A 3QJMA 3STJA 3DJAA 2IWQA 2MHOA 2FE5A 1V6BA 2QKUA 2OPGA 1QAUA 4P0CA 2IWNA 2H3LA 4JJ3A 5B42A 4KFWA 2EAQA 1VA8A 2FNEA 1YBOA 1UFXA 1QLCA 1WF8A 3PS4A 3GGEA 3JXTA 4YDPA 1WIFA 2AWXA 2IWOA 2LA8A 1IU2A 2DM8A 5IL9A 3ID4A 4OEOA 2OGPA 2PKTA 5GNDA 4REYA 1GQ5A 1V5LA 2EDVA 4Q2PA 3VQFA 2DC2A 1T2MA 1N6DA 3GJ9A 3SHWA 2JILA 1U39A 3DJ1A 4FLNA 5EYZA 4YYXA 1FC9A 5GLJA 4K75A 2AWWA 2Q3GA 2KOMA 1U37A 3B76A 1X8SA 1U3BA 2EXGA 2R4HA 1VAEA 3RLEA 2I0IA 4KFVA 3HVQC 3DJ3A 2OQSA 4LMMA 3HPKA 1VB7A 4JOPA 1N7EA 2VSPA 3ID1A 1V5QA 2M10A 2WL7A 2PDZA 3KHFA 2JXOA 1IU0A 2KPLA 4NNLA 3I4WA 3NGHA 2KBSA 3LNXA 1L6OA 1PDRA 4H11A 3LNYA 1W9EA 2KV8A 1SOTA 4GHNA 1X9ZA 2OZFA 3CBYA 1X5RA 2JIKA 2QBWA 2H3MA 2LUIA 1UEWA 2PZDA 3K50A 1OBYA 3R0HA 5H3JA 1WH1A 5HEBA 1W9QA 2P3WA 3RL8A 1VJ6A 1UM7A 2F5YA 4P2AB 3KZDA 2EV8A 4PQWA 4E34A 4JOJA 1UJVA 2KQFA 1TP5A 1VCWA 1UM1A 2KOJA 4OEPA 4Q2NA 2PKUA 1WHAA 3TSWA 5HFBA 1UJUA 2YT7A 1N7FA 2M0UA 2RCZA 1TP3A 3L4FD 3MH4A 4JOHA 2KAWA 5HETA 1FCFA 3GSLA 4JOGA 2RRMA 5F3XA 2Z17A 2D92A 1Q3PA 1SOZA 4NMRA 3KDKA 3O46A 4NMVA 4Z33A 2AINA 2YUYA 2KA9A 2PA1A 1X5NA 1WFGA 2EDZA 3HPMA 3GDSA 2EEJA 1IHJA 2DAZA 3OU0A 5E6PB 5E21A 1WFVA 3SHUA 2R3YA 3CBXA 2MX6A 1QAVA 5G1DA 1FC7A 2JOAA 3EGHC 2D90A 2KL1A 5I7ZA 3QE1A
chains in the Genus database with same CATH topology
2ZPLA 3QGLA 4NMTA 1P1DA 2QKTA 4OAJA 2KJPA 1X45A 2IWPA 5B6LA 5EZ0A 4JOFA 3SFJA 4NXPA 4NNMA 2O2TA 4IC6A 2OS6A 2BYGA 2KG2A 2REYA 2DLUA 4WYUA 5D13A 4Z8JA 2CSSA 3CYYA 1UITA 2EGNA 1NF3C 5E1YA 3R69A 2VPHA 1Q3OA 4NMQA 5HEYA 2JSNA 3GCOA 1K32A 1LCYA 4GVDA 2M0TA 2Z9IA 4F8KA 1Y7NA 5JXBA 2M0VA 3GDUA 3ID2A 2K1ZA 2OCSA 3GCNA 2HE4A 1R6JA 3TSZA 2QG1A 4MPAA 5E11A 4E35A 2DB5A 2X7ZA 3PV2A 4HOPB 5G1EA 4K6YA 3CS0A 1N7TA 2FCFA 1OBZA 3DORA 1Z86A 3TMHA 1TQ3A 2DKRA 1D5GA 2LC7A 1GQ4A 2VRFA 4NMPA 3PV4A 3CH8A 3QJNA 3O5NA 4K76A 5HEDA 2EJYA 2ZPMA 2EEIA 4G69A 2E7KA 2GEFA 4UU6A 5A2PA 2KJKA 2KYLA 4Q2QA 2I4SA 4RI0A 4R2ZA 3MH7A 2GZVA 5DTHA 3QO6A 1RGWA 1WI4A 4JL7A 3EGGC 1OBXA 3I18A 1N99A 1WHDA 2KOHA 4Q6SA 4N6XA 2PNTA 2YT8A 2I1NA 3RL7A 3WKLA 3MH6A 2EEGA 4NXQA 1WJLA 3VQGA 5FB8C 4JOKA 3OTPA 2Q9VA 1P1EA 2UZCA 2H2CA 1KWAA 3BPUA 2QKVA 4JJ0A 1X5QA 2QT5A 2YUBA 1I92A 3ID3A 2L97A 1UHPA 5E22A 1Z87A 4Q3HA 2K20A 3KZEA 3I1EA 1ZUBA 2L4SA 5HFFA 3NFKA 2CS5A 2G5MB 1Y8TA 2DLSA 1FC6A 3E17A 4K72A 1MFLA 1W9OA 3CC0A 3PV5A 1G9OA 3TSVA 3DIWA 3QIKA 2AWUA 2DMZA 4JORA 1RY4A 5HF1A 1TE0A 2H2BA 2LOBA 5HFCA 1B8QA 1V62A 2HGAA 4L8NA 1Q7XA 3FY5A 2OMJA 2EEHA 1KEFA 1XZ9A 2JINA 1M5ZA 1N6EA 1MC7A 5FHTA 5F67A 4E3BA 2KJDA 2VZ5A 3K82A 2G2LA 3PDVA 3SOEA 1WG6A 1WF7A 1OZIA 1UJDA 4FGMA 2EDPA 4WYTA 3GABA 5ILBA 3K1RA 5HFDA 2L4TA 4GVCA 5HDYA 2M0ZA 2V1WA 1NTEA 1N6FA 4JOEA 2CSJA 4UU5A 2I0LA 2LC6A 3KDGA 2JREA 5HF4A 1GM1A 4XHVA 1RZXA 1BFEA 2M3MA 1RGRA 4HOPA 2W7RA 2I04A 2W4FA 3GDVA 2OSGA 1UEQA 4Q6HA 1UEZA 3QDOA 2ENOA 3AXAA 4Q2OA 2D8IA 2EGOA 3NCVA 4NXRA 4O06A 3R68A 1X6DA 5HJ1A 2VWRA 1WI2A 3ZRTA 2HE2A 1ZOKA 3CBZA 2KPKA 1UF1A 2VSVA 4NMSA 4AMHA 1U38A 4K78A 1MFGA 2KRGA 2FN5A 2JWEA 2I6VA 5HFEA 2EGKA 1KY9A 1QAVB 4NMOA 1BE9A 1I16A 3WKMA 2EHRA 2DJTA 3PDZA 3SUZA 1UEPA 2F0AA 2YTWA 3NFLA 4EDJA 1V1TA 2V90A 3QJMA 3STJA 3DJAA 2IWQA 2MHOA 2FE5A 1V6BA 2QKUA 2OPGA 1QAUA 4P0CA 2IWNA 2H3LA 4JJ3A 5B42A 4KFWA 2EAQA 1VA8A 2FNEA 1YBOA 1UFXA 1QLCA 1WF8A 3PS4A 3GGEA 3JXTA 4YDPA 1WIFA 2AWXA 2IWOA 2LA8A 1IU2A 2DM8A 5IL9A 3ID4A 4OEOA 2OGPA 2PKTA 5GNDA 4REYA 1GQ5A 1V5LA 2EDVA 4Q2PA 3VQFA 2DC2A 1T2MA 1N6DA 3GJ9A 3SHWA 2JILA 1U39A 3DJ1A 4FLNA 5EYZA 4YYXA 1FC9A 5GLJA 4K75A 2AWWA 2Q3GA 2KOMA 1U37A 3B76A 1X8SA 1U3BA 2EXGA 2R4HA 1VAEA 3RLEA 2I0IA 4KFVA 3HVQC 3DJ3A 2OQSA 4LMMA 3HPKA 1VB7A 4JOPA 1N7EA 2VSPA 3ID1A 1V5QA 2M10A 2WL7A 2PDZA 3KHFA 2JXOA 1IU0A 2KPLA 4NNLA 3I4WA 3NGHA 2KBSA 3LNXA 1L6OA 1PDRA 4H11A 3LNYA 1W9EA 2KV8A 1SOTA 4GHNA 1X9ZA 2OZFA 3CBYA 1X5RA 2JIKA 2QBWA 2H3MA 2LUIA 1UEWA 2PZDA 3K50A 1OBYA 3R0HA 5H3JA 1WH1A 5HEBA 1W9QA 2P3WA 3RL8A 1VJ6A 1UM7A 2F5YA 4P2AB 3KZDA 2EV8A 4PQWA 4E34A 4JOJA 1UJVA 2KQFA 1TP5A 1VCWA 1UM1A 2KOJA 4OEPA 4Q2NA 2PKUA 1WHAA 3TSWA 5HFBA 1UJUA 2YT7A 1N7FA 2M0UA 2RCZA 1TP3A 3L4FD 3MH4A 4JOHA 2KAWA 5HETA 1FCFA 3GSLA 4JOGA 2RRMA 5F3XA 2Z17A 2D92A 1Q3PA 1SOZA 4NMRA 3KDKA 3O46A 4NMVA 4Z33A 2AINA 2YUYA 2KA9A 2PA1A 1X5NA 1WFGA 2EDZA 3HPMA 3GDSA 2EEJA 1IHJA 2DAZA 3OU0A 5E6PB 5E21A 1WFVA 3SHUA 2R3YA 3CBXA 2MX6A 1QAVA 5G1DA 1FC7A 2JOAA 3EGHC 2D90A 2KL1A 5I7ZA 3QE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPL A;  3QGL A;  4NMT A;  1P1D A;  2QKT A;  4OAJ A;  2KJP A;  1X45 A;  2IWP A;  5B6L A;  5EZ0 A;  4JOF A;  3SFJ A;  4NXP A;  4NNM A;  2O2T A;  4IC6 A;  2OS6 A;  2BYG A;  2KG2 A;  2REY A;  2DLU A;  4WYU A;  5D13 A;  4Z8J A;  2CSS A;  3CYY A;  1UIT A;  2EGN A;  1NF3 C;  5E1Y A;  3R69 A;  2VPH A;  1Q3O A;  4NMQ A;  5HEY A;  3GCO A;  1K32 A;  1LCY A;  4GVD A;  2M0T A;  2Z9I A;  4F8K A;  1Y7N A;  5JXB A;  2M0V A;  3GDU A;  3ID2 A;  2K1Z A;  2OCS A;  3GCN A;  2HE4 A;  1R6J A;  3TSZ A;  2QG1 A;  4MPA A;  5E11 A;  4E35 A;  2DB5 A;  2X7Z A;  3PV2 A;  4HOP B;  5G1E A;  4K6Y A;  3CS0 A;  1N7T A;  2FCF A;  1OBZ A;  3DOR A;  1Z86 A;  3TMH A;  1TQ3 A;  2DKR A;  1D5G A;  2LC7 A;  1GQ4 A;  2VRF A;  4NMP A;  3PV4 A;  3CH8 A;  3QJN A;  3O5N A;  4K76 A;  5HED A;  2EJY A;  2ZPM A;  2EEI A;  4G69 A;  2E7K A;  4UU6 A;  5A2P A;  2KJK A;  2KYL A;  4Q2Q A;  2I4S A;  4RI0 A;  4R2Z A;  3MH7 A;  2GZV A;  5DTH A;  3QO6 A;  1RGW A;  1WI4 A;  4JL7 A;  3EGG C;  1OBX A;  3I18 A;  1N99 A;  1WHD A;  2KOH A;  4Q6S A;  4N6X A;  2PNT A;  2YT8 A;  2I1N A;  3RL7 A;  3WKL A;  3MH6 A;  2EEG A;  4NXQ A;  1WJL A;  3VQG A;  5FB8 C;  4JOK A;  3OTP A;  2Q9V A;  1P1E A;  2UZC A;  2H2C A;  1KWA A;  3BPU A;  2QKV A;  1X5Q A;  2QT5 A;  2YUB A;  1I92 A;  3ID3 A;  2L97 A;  1UHP A;  5E22 A;  1Z87 A;  4Q3H A;  2K20 A;  3KZE A;  3I1E A;  1ZUB A;  2L4S A;  5HFF A;  3NFK A;  2CS5 A;  2G5M B;  1Y8T A;  2DLS A;  1FC6 A;  3E17 A;  4K72 A;  1MFL A;  1W9O A;  3CC0 A;  3PV5 A;  1G9O A;  3TSV A;  3DIW A;  3QIK A;  2AWU A;  2DMZ A;  4JOR A;  1RY4 A;  5HF1 A;  1TE0 A;  2H2B A;  2LOB A;  5HFC A;  1B8Q A;  1V62 A;  2HGA A;  4L8N A;  1Q7X A;  3FY5 A;  2OMJ A;  2EEH A;  1KEF A;  1XZ9 A;  2JIN A;  1M5Z A;  1N6E A;  1MC7 A;  5FHT A;  5F67 A;  4E3B A;  2KJD A;  2VZ5 A;  3K82 A;  2G2L A;  3PDV A;  3SOE A;  1WG6 A;  1WF7 A;  1OZI A;  1UJD A;  4FGM A;  2EDP A;  4WYT A;  3K1R A;  5HFD A;  2L4T A;  4GVC A;  5HDY A;  2M0Z A;  2V1W A;  1NTE A;  1N6F A;  4JOE A;  2CSJ A;  4UU5 A;  2I0L A;  2LC6 A;  2JRE A;  5HF4 A;  1GM1 A;  4XHV A;  1RZX A;  1BFE A;  2M3M A;  1RGR A;  4HOP A;  2W7R A;  2I04 A;  2W4F A;  3GDV A;  2OSG A;  1UEQ A;  4Q6H A;  1UEZ A;  3QDO A;  2ENO A;  3AXA A;  4Q2O A;  2D8I A;  2EGO A;  4NXR A;  4O06 A;  3R68 A;  1X6D A;  5HJ1 A;  2VWR A;  1WI2 A;  3ZRT A;  2HE2 A;  1ZOK A;  3CBZ A;  2KPK A;  1UF1 A;  2VSV A;  4NMS A;  4AMH A;  1U38 A;  4K78 A;  1MFG A;  2KRG A;  2FN5 A;  2JWE A;  2I6V A;  5HFE A;  2EGK A;  1KY9 A;  1QAV B;  4NMO A;  1BE9 A;  1I16 A;  3WKM A;  2EHR A;  2DJT A;  3PDZ A;  3SUZ A;  1UEP A;  2F0A A;  2YTW A;  3NFL A;  4EDJ A;  1V1T A;  2V90 A;  3QJM A;  3STJ A;  3DJA A;  2IWQ A;  2MHO A;  2FE5 A;  1V6B A;  2QKU A;  2OPG A;  1QAU A;  4P0C A;  2IWN A;  2H3L A;  4KFW A;  2EAQ A;  1VA8 A;  2FNE A;  1YBO A;  1UFX A;  1QLC A;  1WF8 A;  3PS4 A;  3GGE A;  3JXT A;  4YDP A;  1WIF A;  2AWX A;  2IWO A;  2LA8 A;  1IU2 A;  2DM8 A;  3ID4 A;  4OEO A;  2OGP A;  2PKT A;  5GND A;  4REY A;  1GQ5 A;  1V5L A;  2EDV A;  4Q2P A;  3VQF A;  2DC2 A;  1T2M A;  1N6D A;  3GJ9 A;  3SHW A;  2JIL A;  1U39 A;  3DJ1 A;  5EYZ A;  4YYX A;  1FC9 A;  5GLJ A;  4K75 A;  2AWW A;  2Q3G A;  2KOM A;  1U37 A;  3B76 A;  1X8S A;  1U3B A;  2EXG A;  2R4H A;  1VAE A;  3RLE A;  2I0I A;  4KFV A;  3HVQ C;  3DJ3 A;  2OQS A;  4LMM A;  3HPK A;  1VB7 A;  4JOP A;  1N7E A;  2VSP A;  3ID1 A;  1V5Q A;  2M10 A;  2WL7 A;  2PDZ A;  3KHF A;  2JXO A;  1IU0 A;  2KPL A;  4NNL A;  3I4W A;  3NGH A;  2KBS A;  3LNX A;  1L6O A;  1PDR A;  4H11 A;  3LNY A;  1W9E A;  2KV8 A;  1SOT A;  4GHN A;  2OZF A;  3CBY A;  1X5R A;  2JIK A;  2QBW A;  2H3M A;  2LUI A;  1UEW A;  2PZD A;  3K50 A;  1OBY A;  3R0H A;  5H3J A;  1WH1 A;  5HEB A;  1W9Q A;  2P3W A;  3RL8 A;  1VJ6 A;  1UM7 A;  2F5Y A;  4P2A B;  3KZD A;  2EV8 A;  4PQW A;  4E34 A;  4JOJ A;  1UJV A;  2KQF A;  1TP5 A;  1VCW A;  1UM1 A;  2KOJ A;  4OEP A;  4Q2N A;  2PKU A;  1WHA A;  3TSW A;  5HFB A;  1UJU A;  2YT7 A;  1N7F A;  2M0U A;  2RCZ A;  1TP3 A;  3L4F D;  3MH4 A;  4JOH A;  2KAW A;  5HET A;  1FCF A;  3GSL A;  4JOG A;  2RRM A;  5F3X A;  2Z17 A;  2D92 A;  1Q3P A;  1SOZ A;  4NMR A;  4NMV A;  3O46 A;  4Z33 A;  2AIN A;  2YUY A;  2KA9 A;  2PA1 A;  1X5N A;  1WFG A;  2EDZ A;  3HPM A;  3GDS A;  2EEJ A;  1IHJ A;  2DAZ A;  3OU0 A;  5E6P B;  5E21 A;  1WFV A;  3SHU A;  2R3Y A;  3CBX A;  2MX6 A;  1QAV A;  5G1D A;  1FC7 A;  2JOA A;  3EGH C;  2D90 A;  2KL1 A;  5I7Z A;  3QE1 A; 
#chains in the Genus database with same CATH topology
 2ZPL A;  3QGL A;  4NMT A;  1P1D A;  2QKT A;  4OAJ A;  2KJP A;  1X45 A;  2IWP A;  5B6L A;  5EZ0 A;  4JOF A;  3SFJ A;  4NXP A;  4NNM A;  2O2T A;  4IC6 A;  2OS6 A;  2BYG A;  2KG2 A;  2REY A;  2DLU A;  4WYU A;  5D13 A;  4Z8J A;  2CSS A;  3CYY A;  1UIT A;  2EGN A;  1NF3 C;  5E1Y A;  3R69 A;  2VPH A;  1Q3O A;  4NMQ A;  5HEY A;  2JSN A;  3GCO A;  1K32 A;  1LCY A;  4GVD A;  2M0T A;  2Z9I A;  4F8K A;  1Y7N A;  5JXB A;  2M0V A;  3GDU A;  3ID2 A;  2K1Z A;  2OCS A;  3GCN A;  2HE4 A;  1R6J A;  3TSZ A;  2QG1 A;  4MPA A;  5E11 A;  4E35 A;  2DB5 A;  2X7Z A;  3PV2 A;  4HOP B;  5G1E A;  4K6Y A;  3CS0 A;  1N7T A;  2FCF A;  1OBZ A;  3DOR A;  1Z86 A;  3TMH A;  1TQ3 A;  2DKR A;  1D5G A;  2LC7 A;  1GQ4 A;  2VRF A;  4NMP A;  3PV4 A;  3CH8 A;  3QJN A;  3O5N A;  4K76 A;  5HED A;  2EJY A;  2ZPM A;  2EEI A;  4G69 A;  2E7K A;  2GEF A;  4UU6 A;  5A2P A;  2KJK A;  2KYL A;  4Q2Q A;  2I4S A;  4RI0 A;  4R2Z A;  3MH7 A;  2GZV A;  5DTH A;  3QO6 A;  1RGW A;  1WI4 A;  4JL7 A;  3EGG C;  1OBX A;  3I18 A;  1N99 A;  1WHD A;  2KOH A;  4Q6S A;  4N6X A;  2PNT A;  2YT8 A;  2I1N A;  3RL7 A;  3WKL A;  3MH6 A;  2EEG A;  4NXQ A;  1WJL A;  3VQG A;  5FB8 C;  4JOK A;  3OTP A;  2Q9V A;  1P1E A;  2UZC A;  2H2C A;  1KWA A;  3BPU A;  2QKV A;  4JJ0 A;  1X5Q A;  2QT5 A;  2YUB A;  1I92 A;  3ID3 A;  2L97 A;  1UHP A;  5E22 A;  1Z87 A;  4Q3H A;  2K20 A;  3KZE A;  3I1E A;  1ZUB A;  2L4S A;  5HFF A;  3NFK A;  2CS5 A;  2G5M B;  1Y8T A;  2DLS A;  1FC6 A;  3E17 A;  4K72 A;  1MFL A;  1W9O A;  3CC0 A;  3PV5 A;  1G9O A;  3TSV A;  3DIW A;  3QIK A;  2AWU A;  2DMZ A;  4JOR A;  1RY4 A;  5HF1 A;  1TE0 A;  2H2B A;  2LOB A;  5HFC A;  1B8Q A;  1V62 A;  2HGA A;  4L8N A;  1Q7X A;  3FY5 A;  2OMJ A;  2EEH A;  1KEF A;  1XZ9 A;  2JIN A;  1M5Z A;  1N6E A;  1MC7 A;  5FHT A;  5F67 A;  4E3B A;  2KJD A;  2VZ5 A;  3K82 A;  2G2L A;  3PDV A;  3SOE A;  1WG6 A;  1WF7 A;  1OZI A;  1UJD A;  4FGM A;  2EDP A;  4WYT A;  3GAB A;  5ILB A;  3K1R A;  5HFD A;  2L4T A;  4GVC A;  5HDY A;  2M0Z A;  2V1W A;  1NTE A;  1N6F A;  4JOE A;  2CSJ A;  4UU5 A;  2I0L A;  2LC6 A;  3KDG A;  2JRE A;  5HF4 A;  1GM1 A;  4XHV A;  1RZX A;  1BFE A;  2M3M A;  1RGR A;  4HOP A;  2W7R A;  2I04 A;  2W4F A;  3GDV A;  2OSG A;  1UEQ A;  4Q6H A;  1UEZ A;  3QDO A;  2ENO A;  3AXA A;  4Q2O A;  2D8I A;  2EGO A;  3NCV A;  4NXR A;  4O06 A;  3R68 A;  1X6D A;  5HJ1 A;  2VWR A;  1WI2 A;  3ZRT A;  2HE2 A;  1ZOK A;  3CBZ A;  2KPK A;  1UF1 A;  2VSV A;  4NMS A;  4AMH A;  1U38 A;  4K78 A;  1MFG A;  2KRG A;  2FN5 A;  2JWE A;  2I6V A;  5HFE A;  2EGK A;  1KY9 A;  1QAV B;  4NMO A;  1BE9 A;  1I16 A;  3WKM A;  2EHR A;  2DJT A;  3PDZ A;  3SUZ A;  1UEP A;  2F0A A;  2YTW A;  3NFL A;  4EDJ A;  1V1T A;  2V90 A;  3QJM A;  3STJ A;  3DJA A;  2IWQ A;  2MHO A;  2FE5 A;  1V6B A;  2QKU A;  2OPG A;  1QAU A;  4P0C A;  2IWN A;  2H3L A;  4JJ3 A;  5B42 A;  4KFW A;  2EAQ A;  1VA8 A;  2FNE A;  1YBO A;  1UFX A;  1QLC A;  1WF8 A;  3PS4 A;  3GGE A;  3JXT A;  4YDP A;  1WIF A;  2AWX A;  2IWO A;  2LA8 A;  1IU2 A;  2DM8 A;  5IL9 A;  3ID4 A;  4OEO A;  2OGP A;  2PKT A;  5GND A;  4REY A;  1GQ5 A;  1V5L A;  2EDV A;  4Q2P A;  3VQF A;  2DC2 A;  1T2M A;  1N6D A;  3GJ9 A;  3SHW A;  2JIL A;  1U39 A;  3DJ1 A;  4FLN A;  5EYZ A;  4YYX A;  1FC9 A;  5GLJ A;  4K75 A;  2AWW A;  2Q3G A;  2KOM A;  1U37 A;  3B76 A;  1X8S A;  1U3B A;  2EXG A;  2R4H A;  1VAE A;  3RLE A;  2I0I A;  4KFV A;  3HVQ C;  3DJ3 A;  2OQS A;  4LMM A;  3HPK A;  1VB7 A;  4JOP A;  1N7E A;  2VSP A;  3ID1 A;  1V5Q A;  2M10 A;  2WL7 A;  2PDZ A;  3KHF A;  2JXO A;  1IU0 A;  2KPL A;  4NNL A;  3I4W A;  3NGH A;  2KBS A;  3LNX A;  1L6O A;  1PDR A;  4H11 A;  3LNY A;  1W9E A;  2KV8 A;  1SOT A;  4GHN A;  1X9Z A;  2OZF A;  3CBY A;  1X5R A;  2JIK A;  2QBW A;  2H3M A;  2LUI A;  1UEW A;  2PZD A;  3K50 A;  1OBY A;  3R0H A;  5H3J A;  1WH1 A;  5HEB A;  1W9Q A;  2P3W A;  3RL8 A;  1VJ6 A;  1UM7 A;  2F5Y A;  4P2A B;  3KZD A;  2EV8 A;  4PQW A;  4E34 A;  4JOJ A;  1UJV A;  2KQF A;  1TP5 A;  1VCW A;  1UM1 A;  2KOJ A;  4OEP A;  4Q2N A;  2PKU A;  1WHA A;  3TSW A;  5HFB A;  1UJU A;  2YT7 A;  1N7F A;  2M0U A;  2RCZ A;  1TP3 A;  3L4F D;  3MH4 A;  4JOH A;  2KAW A;  5HET A;  1FCF A;  3GSL A;  4JOG A;  2RRM A;  5F3X A;  2Z17 A;  2D92 A;  1Q3P A;  1SOZ A;  4NMR A;  3KDK A;  3O46 A;  4NMV A;  4Z33 A;  2AIN A;  2YUY A;  2KA9 A;  2PA1 A;  1X5N A;  1WFG A;  2EDZ A;  3HPM A;  3GDS A;  2EEJ A;  1IHJ A;  2DAZ A;  3OU0 A;  5E6P B;  5E21 A;  1WFV A;  3SHU A;  2R3Y A;  3CBX A;  2MX6 A;  1QAV A;  5G1D A;  1FC7 A;  2JOA A;  3EGH C;  2D90 A;  2KL1 A;  5I7Z A;  3QE1 A; 
#chains in the Genus database with same CATH homology
 2ZPL A;  3QGL A;  4NMT A;  1P1D A;  2QKT A;  4OAJ A;  2KJP A;  1X45 A;  2IWP A;  5B6L A;  5EZ0 A;  4JOF A;  3SFJ A;  4NXP A;  4NNM A;  2O2T A;  4IC6 A;  2OS6 A;  2BYG A;  2KG2 A;  2REY A;  2DLU A;  4WYU A;  5D13 A;  4Z8J A;  2CSS A;  3CYY A;  1UIT A;  2EGN A;  1NF3 C;  5E1Y A;  3R69 A;  2VPH A;  1Q3O A;  4NMQ A;  5HEY A;  2JSN A;  3GCO A;  1K32 A;  1LCY A;  4GVD A;  2M0T A;  2Z9I A;  4F8K A;  1Y7N A;  5JXB A;  2M0V A;  3GDU A;  3ID2 A;  2K1Z A;  2OCS A;  3GCN A;  2HE4 A;  1R6J A;  3TSZ A;  2QG1 A;  4MPA A;  5E11 A;  4E35 A;  2DB5 A;  2X7Z A;  3PV2 A;  4HOP B;  5G1E A;  4K6Y A;  3CS0 A;  1N7T A;  2FCF A;  1OBZ A;  3DOR A;  1Z86 A;  3TMH A;  1TQ3 A;  2DKR A;  1D5G A;  2LC7 A;  1GQ4 A;  2VRF A;  4NMP A;  3PV4 A;  3CH8 A;  3QJN A;  3O5N A;  4K76 A;  5HED A;  2EJY A;  2ZPM A;  2EEI A;  4G69 A;  2E7K A;  2GEF A;  4UU6 A;  5A2P A;  2KJK A;  2KYL A;  4Q2Q A;  2I4S A;  4RI0 A;  4R2Z A;  3MH7 A;  2GZV A;  5DTH A;  3QO6 A;  1RGW A;  1WI4 A;  4JL7 A;  3EGG C;  1OBX A;  3I18 A;  1N99 A;  1WHD A;  2KOH A;  4Q6S A;  4N6X A;  2PNT A;  2YT8 A;  2I1N A;  3RL7 A;  3WKL A;  3MH6 A;  2EEG A;  4NXQ A;  1WJL A;  3VQG A;  5FB8 C;  4JOK A;  3OTP A;  2Q9V A;  1P1E A;  2UZC A;  2H2C A;  1KWA A;  3BPU A;  2QKV A;  4JJ0 A;  1X5Q A;  2QT5 A;  2YUB A;  1I92 A;  3ID3 A;  2L97 A;  1UHP A;  5E22 A;  1Z87 A;  4Q3H A;  2K20 A;  3KZE A;  3I1E A;  1ZUB A;  2L4S A;  5HFF A;  3NFK A;  2CS5 A;  2G5M B;  1Y8T A;  2DLS A;  1FC6 A;  3E17 A;  4K72 A;  1MFL A;  1W9O A;  3CC0 A;  3PV5 A;  1G9O A;  3TSV A;  3DIW A;  3QIK A;  2AWU A;  2DMZ A;  4JOR A;  1RY4 A;  5HF1 A;  1TE0 A;  2H2B A;  2LOB A;  5HFC A;  1B8Q A;  1V62 A;  2HGA A;  4L8N A;  1Q7X A;  3FY5 A;  2OMJ A;  2EEH A;  1KEF A;  1XZ9 A;  2JIN A;  1M5Z A;  1N6E A;  1MC7 A;  5FHT A;  5F67 A;  4E3B A;  2KJD A;  2VZ5 A;  3K82 A;  2G2L A;  3PDV A;  3SOE A;  1WG6 A;  1WF7 A;  1OZI A;  1UJD A;  4FGM A;  2EDP A;  4WYT A;  3GAB A;  5ILB A;  3K1R A;  5HFD A;  2L4T A;  4GVC A;  5HDY A;  2M0Z A;  2V1W A;  1NTE A;  1N6F A;  4JOE A;  2CSJ A;  4UU5 A;  2I0L A;  2LC6 A;  3KDG A;  2JRE A;  5HF4 A;  1GM1 A;  4XHV A;  1RZX A;  1BFE A;  2M3M A;  1RGR A;  4HOP A;  2W7R A;  2I04 A;  2W4F A;  3GDV A;  2OSG A;  1UEQ A;  4Q6H A;  1UEZ A;  3QDO A;  2ENO A;  3AXA A;  4Q2O A;  2D8I A;  2EGO A;  3NCV A;  4NXR A;  4O06 A;  3R68 A;  1X6D A;  5HJ1 A;  2VWR A;  1WI2 A;  3ZRT A;  2HE2 A;  1ZOK A;  3CBZ A;  2KPK A;  1UF1 A;  2VSV A;  4NMS A;  4AMH A;  1U38 A;  4K78 A;  1MFG A;  2KRG A;  2FN5 A;  2JWE A;  2I6V A;  5HFE A;  2EGK A;  1KY9 A;  1QAV B;  4NMO A;  1BE9 A;  1I16 A;  3WKM A;  2EHR A;  2DJT A;  3PDZ A;  3SUZ A;  1UEP A;  2F0A A;  2YTW A;  3NFL A;  4EDJ A;  1V1T A;  2V90 A;  3QJM A;  3STJ A;  3DJA A;  2IWQ A;  2MHO A;  2FE5 A;  1V6B A;  2QKU A;  2OPG A;  1QAU A;  4P0C A;  2IWN A;  2H3L A;  4JJ3 A;  5B42 A;  4KFW A;  2EAQ A;  1VA8 A;  2FNE A;  1YBO A;  1UFX A;  1QLC A;  1WF8 A;  3PS4 A;  3GGE A;  3JXT A;  4YDP A;  1WIF A;  2AWX A;  2IWO A;  2LA8 A;  1IU2 A;  2DM8 A;  5IL9 A;  3ID4 A;  4OEO A;  2OGP A;  2PKT A;  5GND A;  4REY A;  1GQ5 A;  1V5L A;  2EDV A;  4Q2P A;  3VQF A;  2DC2 A;  1T2M A;  1N6D A;  3GJ9 A;  3SHW A;  2JIL A;  1U39 A;  3DJ1 A;  4FLN A;  5EYZ A;  4YYX A;  1FC9 A;  5GLJ A;  4K75 A;  2AWW A;  2Q3G A;  2KOM A;  1U37 A;  3B76 A;  1X8S A;  1U3B A;  2EXG A;  2R4H A;  1VAE A;  3RLE A;  2I0I A;  4KFV A;  3HVQ C;  3DJ3 A;  2OQS A;  4LMM A;  3HPK A;  1VB7 A;  4JOP A;  1N7E A;  2VSP A;  3ID1 A;  1V5Q A;  2M10 A;  2WL7 A;  2PDZ A;  3KHF A;  2JXO A;  1IU0 A;  2KPL A;  4NNL A;  3I4W A;  3NGH A;  2KBS A;  3LNX A;  1L6O A;  1PDR A;  4H11 A;  3LNY A;  1W9E A;  2KV8 A;  1SOT A;  4GHN A;  1X9Z A;  2OZF A;  3CBY A;  1X5R A;  2JIK A;  2QBW A;  2H3M A;  2LUI A;  1UEW A;  2PZD A;  3K50 A;  1OBY A;  3R0H A;  5H3J A;  1WH1 A;  5HEB A;  1W9Q A;  2P3W A;  3RL8 A;  1VJ6 A;  1UM7 A;  2F5Y A;  4P2A B;  3KZD A;  2EV8 A;  4PQW A;  4E34 A;  4JOJ A;  1UJV A;  2KQF A;  1TP5 A;  1VCW A;  1UM1 A;  2KOJ A;  4OEP A;  4Q2N A;  2PKU A;  1WHA A;  3TSW A;  5HFB A;  1UJU A;  2YT7 A;  1N7F A;  2M0U A;  2RCZ A;  1TP3 A;  3L4F D;  3MH4 A;  4JOH A;  2KAW A;  5HET A;  1FCF A;  3GSL A;  4JOG A;  2RRM A;  5F3X A;  2Z17 A;  2D92 A;  1Q3P A;  1SOZ A;  4NMR A;  3KDK A;  3O46 A;  4NMV A;  4Z33 A;  2AIN A;  2YUY A;  2KA9 A;  2PA1 A;  1X5N A;  1WFG A;  2EDZ A;  3HPM A;  3GDS A;  2EEJ A;  1IHJ A;  2DAZ A;  3OU0 A;  5E6P B;  5E21 A;  1WFV A;  3SHU A;  2R3Y A;  3CBX A;  2MX6 A;  1QAV A;  5G1D A;  1FC7 A;  2JOA A;  3EGH C;  2D90 A;  2KL1 A;  5I7Z A;  3QE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...