1V1TA

Crystal structure of the pdz tandem of human syntenin in complex with tneykv peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
164
structure length
164
Chain Sequence
b'MDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYNTENIN 1
publication title The Binding of the Pdz Tandem of Syntenin to Target Proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 35
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
A PF17820 PDZ_6 PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1v1tA02
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 1v1tA01
1ZUBA 1N6FA 5B6LA 1L6OA 2HGAA 5E21A 4PQWA 4Z8JA 3HPMA 3GCNA 2VZ5A 2HE4A 1GM1A 2PDZA 5HEYA 2W7RA 3DJ3A 1Q3OA 2UZCA 2KL1A 3KHFA 2JIKA 2M0UA 3GDUA 4UU6A 2MX6A 2PA1A 2DLUA 5DTHA 3QIKA 2EDPA 4RI0A 3AXAA 2IWPA 2JWEA 3KZEA 2YTWA 1WHAA 5GLJA 1QAVA 1W9EA 4WYTA 2EV8A 4NMRA 3BPUA 3EGHC 3O46A 2KYLA 2L97A 4Q2OA 2OGPA 1X5QA 3QO6A 1UM1A 2EEIA 3GSLA 3PV5A 2VPHA 1WI2A 5HDYA 1QAVB 1UF1A 1TE0A 3TSVA 1QLCA 1WHDA 4Q2QA 1R6JA 2EGKA 5HEDA 3QJMA 1UHPA 2G2LA 1M5ZA 2H3LA 4Q6HA 1BFEA 1WIFA 4IC6A 2MHOA 2EAQA 2EEJA 3ZRTA 2LUIA 1I92A 4REYA 4GVDA 3DJ1A 5GNDA 1VJ6A 2JREA 3I4WA 1KWAA 1FC9A 3DIWA 4E34A 2W4FA 1RY4A 1UITA 2GZVA 2Q9VA 2R4HA 1WFGA 2QBWA 3GDVA 1N99A 1PDRA 1OBYA 4E35A 3JXTA 3MH6A 4OAJA 1N6EA 4K78A 2D8IA 3DJAA 2YT8A 3CC0A 1D5GA 2K20A 2LOBA 2OS6A 1X45A 4F8KA 2EEGA 4K6YA 1UEZA 1MFGA 1P1EA 2PNTA 4NMQA 2M10A 2KAWA 1V6BA 3NFLA 1FC7A 2V1WA 2VSVA 3HPKA 5A2PA 1QAUA 4JORA 4NMVA 5E6PB 2OMJA 4Q2PA 1X5NA 4YYXA 2AWWA 5E22A 2IWQA 3OTPA 2IWOA 4NMPA 1VCWA 4HOPA 5FB8C 3ID1A 2CSJA 1GQ5A 1N7FA 4N6XA 5F67A 2BYGA 3VQFA 3ID4A 2QKVA 2DKRA 1Z87A 3RL8A 5HFDA 4L8NA 3QJNA 4OEPA 4HOPB 2H3MA 3PV2A 1ZOKA 3GCOA 4G69A 5H3JA 2JOAA 3K50A 1VB7A 1XZ9A 2REYA 4EDJA 2KA9A 2PKUA 4NMSA 2DMZA 2KPLA 3SOEA 1WF8A 2Z9IA 4JL7A 4KFWA 1IU2A 2Q3GA 1LCYA 2YT7A 1G9OA 2RRMA 2PZDA 5I7ZA 1X5RA 1Y7NA 3L4FD 5E11A 1U3BA 3SFJA 1K32A 2L4SA 2KPKA 4FGMA 1N6DA 2KRGA 2AINA 5HFCA 4JOPA 1Z86A 4KFVA 2D90A 1TP3A 5G1DA 1TQ3A 1BE9A 3QE1A 1Y8TA 2D92A 1IU0A 1KEFA 1V62A 1U37A 5JXBA 4NXPA 1RGRA 2DAZA 2QT5A 2JILA 2CS5A 1OBXA 3B76A 5EZ0A 5HFEA 3SUZA 2QG1A 3RL7A 2M0ZA 3R0HA 3PV4A 2WL7A 1Q3PA 2H2CA 3MH4A 2V90A 1OBZA 3GJ9A 2DB5A 4K76A 2IWNA 2F0AA 5HETA 4NNLA 3FY5A 3SHUA 1SOZA 1NF3C 2Z17A 1UEWA 1WF7A 4MPAA 2DC2A 3LNYA 3QDOA 1IHJA 3CS0A 2KQFA 2EGOA 1B8QA 1SOTA 1X8SA 2EEHA 1KY9A 3R69A 3HVQC 1TP5A 2F5YA 2VWRA 2L4TA 4Z33A 2X7ZA 3I18A 2I0LA 4Q6SA 2AWXA 2DM8A 3PDVA 5HFFA 2KOMA 2OPGA 1RZXA 3I1EA 3TMHA 5HEBA 2R3YA 1OZIA 2VRFA 4NMTA 2EHRA 1N7TA 5EYZA 4Q2NA 2HE2A 3WKLA 2LA8A 1V1TA 3CBZA 3SHWA 1YBOA 3O5NA 4JOJA 4NXRA 1UJVA 2DLSA 3KZDA 4H11A 2OCSA 2KJKA 5HFBA 3STJA 1X6DA 3PDZA 1V5QA 3ID3A 4AMHA 5D13A 1FC6A 2KG2A 1NTEA 2FCFA 2LC7A 2DJTA 2KV8A 5F3XA 4XHVA 2KBSA 1W9QA 1FCFA 2EXGA 1WG6A 4NMOA 5HF4A 1VA8A 2CSSA 2YUBA 1W9OA 3TSWA 1UEQA 3E17A 2E7KA 3RLEA 4JOGA 4NNMA 2RCZA 1MFLA 1U39A 2M0TA 1P1DA 4JOFA 2EDZA 5HJ1A 3K1RA 1WI4A 4P2AB 2M0VA 4LMMA 1UJDA 2ZPMA 3WKMA 3CYYA 3NGHA 1RGWA 4YDPA 1GQ4A 3CBXA 1N7EA 2EGNA 2OQSA 4GVCA 4P0CA 2PKTA 2FN5A 2KJPA 1UJUA 3GDSA 2I04A 2VSPA 4WYUA 2P3WA 5E1YA 1V5LA 2OZFA 2K1ZA 3OU0A 3MH7A 1UM7A 2I4SA 4E3BA 1MC7A 3ID2A 2JXOA 1WH1A 2FE5A 1I16A 3CBYA 2JINA 4UU5A 2I1NA 1WFVA 2G5MB 5G1EA 2EDVA 2I0IA 1VAEA 3PS4A 3QGLA 3R68A 4GHNA 2QKTA 4K72A 3TSZA 3VQGA 3DORA 1T2MA 4O06A 4Q3HA 4JOHA 1UFXA 3CH8A 2ENOA 2QKUA 1WJLA 4NXQA 3LNXA 3NFKA 1UEPA 2M3MA 1Q7XA 4JOKA 2I6VA 2O2TA 2AWUA 2ZPLA 4R2ZA 2FNEA 4JOEA 5HF1A 5FHTA 2OSGA 3EGGC 4K75A 2YUYA 2EJYA 3GGEA 4OEOA 1U38A 2KOJA 3K82A 2KOHA 2KJDA 2LC6A 2H2BA
chains in the Genus database with same CATH superfamily
1ZUBA 1N6FA 5B6LA 1L6OA 2HGAA 5E21A 4PQWA 5IL9A 4Z8JA 3HPMA 3GCNA 2VZ5A 2HE4A 1GM1A 2PDZA 5HEYA 3GABA 2W7RA 3DJ3A 1Q3OA 2UZCA 2KL1A 3KHFA 2JIKA 2M0UA 4JJ3A 2JSNA 3GDUA 4UU6A 2MX6A 2PA1A 2DLUA 5DTHA 3QIKA 2EDPA 4RI0A 3AXAA 2IWPA 2JWEA 3KZEA 4JJ0A 2YTWA 1WHAA 5GLJA 1QAVA 1W9EA 4WYTA 2EV8A 4NMRA 3BPUA 3EGHC 3O46A 2KYLA 2L97A 4Q2OA 2OGPA 1X5QA 3QO6A 1UM1A 2EEIA 3GSLA 3PV5A 2VPHA 1WI2A 3KDKA 1QAVB 1UF1A 1TE0A 5HDYA 3TSVA 1QLCA 1WHDA 4Q2QA 1R6JA 2EGKA 5HEDA 3QJMA 1UHPA 2G2LA 1M5ZA 2H3LA 4Q6HA 1BFEA 1WIFA 4IC6A 2MHOA 2EAQA 2EEJA 3ZRTA 2LUIA 1I92A 4REYA 4GVDA 3DJ1A 5GNDA 1VJ6A 2JREA 3I4WA 1KWAA 1FC9A 3DIWA 4E34A 2W4FA 1RY4A 1UITA 2GZVA 2Q9VA 2R4HA 1WFGA 2QBWA 3GDVA 1N99A 1PDRA 1OBYA 4E35A 3JXTA 3MH6A 4OAJA 1N6EA 4K78A 2D8IA 3DJAA 2YT8A 3CC0A 1D5GA 2K20A 2LOBA 2OS6A 1X45A 4F8KA 2EEGA 4K6YA 1UEZA 1MFGA 1P1EA 2PNTA 4NMQA 2M10A 2KAWA 1V6BA 3NFLA 1FC7A 2V1WA 2VSVA 3HPKA 5A2PA 1QAUA 4JORA 4NMVA 5E6PB 2OMJA 4Q2PA 1X5NA 4YYXA 2AWWA 5E22A 5B42A 2IWQA 3OTPA 2IWOA 4NMPA 1VCWA 4HOPA 5FB8C 3ID1A 2CSJA 1GQ5A 1N7FA 4N6XA 5F67A 2BYGA 3VQFA 3ID4A 2QKVA 2DKRA 1Z87A 3RL8A 5HFDA 4L8NA 3QJNA 4OEPA 4HOPB 2H3MA 4FLNA 3PV2A 1ZOKA 3GCOA 4G69A 5H3JA 2JOAA 3K50A 1VB7A 1XZ9A 2REYA 4EDJA 2KA9A 2PKUA 4NMSA 2DMZA 2KPLA 3SOEA 1WF8A 2Z9IA 4JL7A 4KFWA 1IU2A 2Q3GA 1LCYA 2YT7A 1G9OA 2RRMA 2PZDA 5I7ZA 1X5RA 1Y7NA 3L4FD 5E11A 1U3BA 3SFJA 1K32A 2L4SA 2KPKA 4FGMA 1N6DA 2KRGA 2AINA 5HFCA 4JOPA 1Z86A 4KFVA 2D90A 1TP3A 5G1DA 1TQ3A 1BE9A 3QE1A 1Y8TA 2D92A 5ILBA 1IU0A 1KEFA 1V62A 1U37A 5JXBA 4NXPA 1RGRA 2DAZA 2QT5A 2JILA 2CS5A 1OBXA 3B76A 5EZ0A 5HFEA 3SUZA 2QG1A 3RL7A 2M0ZA 3R0HA 3NCVA 3PV4A 2WL7A 1Q3PA 2H2CA 3MH4A 2V90A 1OBZA 3GJ9A 2DB5A 4K76A 2IWNA 2F0AA 5HETA 4NNLA 3FY5A 3SHUA 1SOZA 1NF3C 2Z17A 1UEWA 1WF7A 4MPAA 2DC2A 3LNYA 3QDOA 1IHJA 3CS0A 2KQFA 2EGOA 1B8QA 1SOTA 1X8SA 2EEHA 1KY9A 3R69A 3HVQC 1TP5A 2F5YA 2VWRA 2L4TA 4Z33A 2X7ZA 3I18A 2I0LA 4Q6SA 2AWXA 2DM8A 3PDVA 5HFFA 2KOMA 2OPGA 1RZXA 3I1EA 3TMHA 5HEBA 2R3YA 1OZIA 2VRFA 4NMTA 2GEFA 2EHRA 1N7TA 5EYZA 4Q2NA 2HE2A 3WKLA 2LA8A 1V1TA 3CBZA 3SHWA 1YBOA 3O5NA 4JOJA 4NXRA 1UJVA 2DLSA 3KZDA 4H11A 2OCSA 2KJKA 5HFBA 3STJA 1X6DA 3PDZA 1V5QA 3ID3A 4AMHA 5D13A 1X9ZA 1FC6A 2KG2A 1NTEA 2FCFA 2LC7A 2DJTA 2KV8A 5F3XA 4XHVA 2KBSA 1W9QA 1FCFA 2EXGA 1WG6A 4NMOA 5HF4A 1VA8A 2CSSA 2YUBA 1W9OA 3TSWA 1UEQA 3E17A 2E7KA 3RLEA 4JOGA 4NNMA 2RCZA 1MFLA 1U39A 2M0TA 1P1DA 4JOFA 2EDZA 5HJ1A 3K1RA 1WI4A 4P2AB 2M0VA 4LMMA 1UJDA 2ZPMA 3WKMA 3CYYA 3NGHA 1RGWA 4YDPA 1GQ4A 3CBXA 1N7EA 2EGNA 2OQSA 4GVCA 4P0CA 2PKTA 2FN5A 2KJPA 1UJUA 3GDSA 2I04A 2VSPA 4WYUA 2P3WA 5E1YA 1V5LA 2OZFA 2K1ZA 3OU0A 3MH7A 1UM7A 2I4SA 4E3BA 1MC7A 3ID2A 2JXOA 1WH1A 2FE5A 1I16A 3CBYA 2JINA 4UU5A 2I1NA 1WFVA 2G5MB 5G1EA 2EDVA 2I0IA 1VAEA 3PS4A 3QGLA 3R68A 4GHNA 2QKTA 4K72A 3TSZA 3VQGA 3DORA 1T2MA 4O06A 4Q3HA 4JOHA 1UFXA 3CH8A 2ENOA 2QKUA 1WJLA 4NXQA 3LNXA 3NFKA 1UEPA 2M3MA 1Q7XA 4JOKA 2I6VA 2O2TA 2AWUA 2ZPLA 4R2ZA 2FNEA 4JOEA 5HF1A 5FHTA 2OSGA 3EGGC 4K75A 3KDGA 2YUYA 2EJYA 3GGEA 4OEOA 1U38A 2KOJA 3K82A 2KOHA 2KJDA 2LC6A 2H2BA
chains in the Genus database with same CATH topology
1ZUBA 1N6FA 5B6LA 1L6OA 2HGAA 5E21A 4PQWA 5IL9A 4Z8JA 3HPMA 3GCNA 2VZ5A 2HE4A 1GM1A 2PDZA 5HEYA 3GABA 2W7RA 3DJ3A 1Q3OA 2UZCA 2KL1A 3KHFA 2JIKA 2M0UA 4JJ3A 2JSNA 3GDUA 4UU6A 2MX6A 2PA1A 2DLUA 5DTHA 3QIKA 2EDPA 4RI0A 3AXAA 2IWPA 2JWEA 3KZEA 4JJ0A 2YTWA 1WHAA 5GLJA 1QAVA 1W9EA 4WYTA 2EV8A 4NMRA 3BPUA 3EGHC 3O46A 2KYLA 2L97A 4Q2OA 2OGPA 1X5QA 3QO6A 1UM1A 2EEIA 3GSLA 3PV5A 2VPHA 1WI2A 3KDKA 1QAVB 1UF1A 1TE0A 5HDYA 3TSVA 1QLCA 1WHDA 4Q2QA 1R6JA 2EGKA 5HEDA 3QJMA 1UHPA 2G2LA 1M5ZA 2H3LA 4Q6HA 1BFEA 1WIFA 4IC6A 2MHOA 2EAQA 2EEJA 3ZRTA 2LUIA 1I92A 4REYA 4GVDA 3DJ1A 5GNDA 1VJ6A 2JREA 3I4WA 1KWAA 1FC9A 3DIWA 4E34A 2W4FA 1RY4A 1UITA 2GZVA 2Q9VA 2R4HA 1WFGA 2QBWA 3GDVA 1N99A 1PDRA 1OBYA 4E35A 3JXTA 3MH6A 4OAJA 1N6EA 4K78A 2D8IA 3DJAA 2YT8A 3CC0A 1D5GA 2K20A 2LOBA 2OS6A 1X45A 4F8KA 2EEGA 4K6YA 1UEZA 1MFGA 1P1EA 2PNTA 4NMQA 2M10A 2KAWA 1V6BA 3NFLA 1FC7A 2V1WA 2VSVA 3HPKA 5A2PA 1QAUA 4JORA 4NMVA 5E6PB 2OMJA 4Q2PA 1X5NA 4YYXA 2AWWA 5E22A 5B42A 2IWQA 3OTPA 2IWOA 4NMPA 1VCWA 4HOPA 5FB8C 3ID1A 2CSJA 1GQ5A 1N7FA 4N6XA 5F67A 2BYGA 3VQFA 3ID4A 2QKVA 2DKRA 1Z87A 3RL8A 5HFDA 4L8NA 3QJNA 4OEPA 4HOPB 2H3MA 4FLNA 3PV2A 1ZOKA 3GCOA 4G69A 5H3JA 2JOAA 3K50A 1VB7A 1XZ9A 2REYA 4EDJA 2KA9A 2PKUA 4NMSA 2DMZA 2KPLA 3SOEA 1WF8A 2Z9IA 4JL7A 4KFWA 1IU2A 2Q3GA 1LCYA 2YT7A 1G9OA 2RRMA 2PZDA 5I7ZA 1X5RA 1Y7NA 3L4FD 5E11A 1U3BA 3SFJA 1K32A 2L4SA 2KPKA 4FGMA 1N6DA 2KRGA 2AINA 5HFCA 4JOPA 1Z86A 4KFVA 2D90A 1TP3A 5G1DA 1TQ3A 1BE9A 3QE1A 1Y8TA 2D92A 5ILBA 1IU0A 1KEFA 1V62A 1U37A 5JXBA 4NXPA 1RGRA 2DAZA 2QT5A 2JILA 2CS5A 1OBXA 3B76A 5EZ0A 5HFEA 3SUZA 2QG1A 3RL7A 2M0ZA 3R0HA 3NCVA 3PV4A 2WL7A 1Q3PA 2H2CA 3MH4A 2V90A 1OBZA 3GJ9A 2DB5A 4K76A 2IWNA 2F0AA 5HETA 4NNLA 3FY5A 3SHUA 1SOZA 1NF3C 2Z17A 1UEWA 1WF7A 4MPAA 2DC2A 3LNYA 3QDOA 1IHJA 3CS0A 2KQFA 2EGOA 1B8QA 1SOTA 1X8SA 2EEHA 1KY9A 3R69A 3HVQC 1TP5A 2F5YA 2VWRA 2L4TA 4Z33A 2X7ZA 3I18A 2I0LA 4Q6SA 2AWXA 2DM8A 3PDVA 5HFFA 2KOMA 2OPGA 1RZXA 3I1EA 3TMHA 5HEBA 2R3YA 1OZIA 2VRFA 4NMTA 2GEFA 2EHRA 1N7TA 5EYZA 4Q2NA 2HE2A 3WKLA 2LA8A 1V1TA 3CBZA 3SHWA 1YBOA 3O5NA 4JOJA 4NXRA 1UJVA 2DLSA 3KZDA 4H11A 2OCSA 2KJKA 5HFBA 3STJA 1X6DA 3PDZA 1V5QA 3ID3A 4AMHA 5D13A 1X9ZA 1FC6A 2KG2A 1NTEA 2FCFA 2LC7A 2DJTA 2KV8A 5F3XA 4XHVA 2KBSA 1W9QA 1FCFA 2EXGA 1WG6A 4NMOA 5HF4A 1VA8A 2CSSA 2YUBA 1W9OA 3TSWA 1UEQA 3E17A 2E7KA 3RLEA 4JOGA 4NNMA 2RCZA 1MFLA 1U39A 2M0TA 1P1DA 4JOFA 2EDZA 5HJ1A 3K1RA 1WI4A 4P2AB 2M0VA 4LMMA 1UJDA 2ZPMA 3WKMA 3CYYA 3NGHA 1RGWA 4YDPA 1GQ4A 3CBXA 1N7EA 2EGNA 2OQSA 4GVCA 4P0CA 2PKTA 2FN5A 2KJPA 1UJUA 3GDSA 2I04A 2VSPA 4WYUA 2P3WA 5E1YA 1V5LA 2OZFA 2K1ZA 3OU0A 3MH7A 1UM7A 2I4SA 4E3BA 1MC7A 3ID2A 2JXOA 1WH1A 2FE5A 1I16A 3CBYA 2JINA 4UU5A 2I1NA 1WFVA 2G5MB 5G1EA 2EDVA 2I0IA 1VAEA 3PS4A 3QGLA 3R68A 4GHNA 2QKTA 4K72A 3TSZA 3VQGA 3DORA 1T2MA 4O06A 4Q3HA 4JOHA 1UFXA 3CH8A 2ENOA 2QKUA 1WJLA 4NXQA 3LNXA 3NFKA 1UEPA 2M3MA 1Q7XA 4JOKA 2I6VA 2O2TA 2AWUA 2ZPLA 4R2ZA 2FNEA 4JOEA 5HF1A 5FHTA 2OSGA 3EGGC 4K75A 3KDGA 2YUYA 2EJYA 3GGEA 4OEOA 1U38A 2KOJA 3K82A 2KOHA 2KJDA 2LC6A 2H2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUB A;  1N6F A;  5B6L A;  1L6O A;  2HGA A;  5E21 A;  4PQW A;  4Z8J A;  3HPM A;  3GCN A;  2VZ5 A;  2HE4 A;  1GM1 A;  2PDZ A;  5HEY A;  2W7R A;  3DJ3 A;  1Q3O A;  2UZC A;  2KL1 A;  3KHF A;  2JIK A;  2M0U A;  3GDU A;  4UU6 A;  2MX6 A;  2PA1 A;  2DLU A;  5DTH A;  3QIK A;  2EDP A;  4RI0 A;  3AXA A;  2IWP A;  2JWE A;  3KZE A;  2YTW A;  1WHA A;  5GLJ A;  1QAV A;  1W9E A;  4WYT A;  2EV8 A;  4NMR A;  3BPU A;  3EGH C;  3O46 A;  2KYL A;  2L97 A;  4Q2O A;  2OGP A;  1X5Q A;  3QO6 A;  1UM1 A;  2EEI A;  3GSL A;  3PV5 A;  2VPH A;  1WI2 A;  5HDY A;  1QAV B;  1UF1 A;  1TE0 A;  3TSV A;  1QLC A;  1WHD A;  4Q2Q A;  1R6J A;  2EGK A;  5HED A;  3QJM A;  1UHP A;  2G2L A;  1M5Z A;  2H3L A;  4Q6H A;  1BFE A;  1WIF A;  4IC6 A;  2MHO A;  2EAQ A;  2EEJ A;  3ZRT A;  2LUI A;  1I92 A;  4REY A;  4GVD A;  3DJ1 A;  5GND A;  1VJ6 A;  2JRE A;  3I4W A;  1KWA A;  1FC9 A;  3DIW A;  4E34 A;  2W4F A;  1RY4 A;  1UIT A;  2GZV A;  2Q9V A;  2R4H A;  1WFG A;  2QBW A;  3GDV A;  1N99 A;  1PDR A;  1OBY A;  4E35 A;  3JXT A;  3MH6 A;  4OAJ A;  1N6E A;  4K78 A;  2D8I A;  3DJA A;  2YT8 A;  3CC0 A;  1D5G A;  2K20 A;  2LOB A;  2OS6 A;  1X45 A;  4F8K A;  2EEG A;  4K6Y A;  1UEZ A;  1MFG A;  1P1E A;  2PNT A;  4NMQ A;  2M10 A;  2KAW A;  1V6B A;  3NFL A;  1FC7 A;  2V1W A;  2VSV A;  3HPK A;  5A2P A;  1QAU A;  4JOR A;  4NMV A;  5E6P B;  2OMJ A;  4Q2P A;  1X5N A;  4YYX A;  2AWW A;  5E22 A;  2IWQ A;  3OTP A;  2IWO A;  4NMP A;  1VCW A;  4HOP A;  5FB8 C;  3ID1 A;  2CSJ A;  1GQ5 A;  1N7F A;  4N6X A;  5F67 A;  2BYG A;  3VQF A;  3ID4 A;  2QKV A;  2DKR A;  1Z87 A;  3RL8 A;  5HFD A;  4L8N A;  3QJN A;  4OEP A;  4HOP B;  2H3M A;  3PV2 A;  1ZOK A;  3GCO A;  4G69 A;  5H3J A;  2JOA A;  3K50 A;  1VB7 A;  1XZ9 A;  2REY A;  4EDJ A;  2KA9 A;  2PKU A;  4NMS A;  2DMZ A;  2KPL A;  3SOE A;  1WF8 A;  2Z9I A;  4JL7 A;  4KFW A;  1IU2 A;  2Q3G A;  1LCY A;  2YT7 A;  1G9O A;  2RRM A;  2PZD A;  5I7Z A;  1X5R A;  1Y7N A;  3L4F D;  5E11 A;  1U3B A;  3SFJ A;  1K32 A;  2L4S A;  2KPK A;  4FGM A;  1N6D A;  2KRG A;  2AIN A;  5HFC A;  4JOP A;  1Z86 A;  4KFV A;  2D90 A;  1TP3 A;  5G1D A;  1TQ3 A;  1BE9 A;  3QE1 A;  1Y8T A;  2D92 A;  1IU0 A;  1KEF A;  1V62 A;  1U37 A;  5JXB A;  4NXP A;  1RGR A;  2DAZ A;  2QT5 A;  2JIL A;  2CS5 A;  1OBX A;  3B76 A;  5EZ0 A;  5HFE A;  3SUZ A;  2QG1 A;  3RL7 A;  2M0Z A;  3R0H A;  3PV4 A;  2WL7 A;  1Q3P A;  2H2C A;  3MH4 A;  2V90 A;  1OBZ A;  3GJ9 A;  2DB5 A;  4K76 A;  2IWN A;  2F0A A;  5HET A;  4NNL A;  3FY5 A;  3SHU A;  1SOZ A;  1NF3 C;  2Z17 A;  1UEW A;  1WF7 A;  4MPA A;  2DC2 A;  3LNY A;  3QDO A;  1IHJ A;  3CS0 A;  2KQF A;  2EGO A;  1B8Q A;  1SOT A;  1X8S A;  2EEH A;  1KY9 A;  3R69 A;  3HVQ C;  1TP5 A;  2F5Y A;  2VWR A;  2L4T A;  4Z33 A;  2X7Z A;  3I18 A;  2I0L A;  4Q6S A;  2AWX A;  2DM8 A;  3PDV A;  5HFF A;  2KOM A;  2OPG A;  1RZX A;  3I1E A;  3TMH A;  5HEB A;  2R3Y A;  1OZI A;  2VRF A;  4NMT A;  2EHR A;  1N7T A;  5EYZ A;  4Q2N A;  2HE2 A;  3WKL A;  2LA8 A;  1V1T A;  3CBZ A;  3SHW A;  1YBO A;  3O5N A;  4JOJ A;  4NXR A;  1UJV A;  2DLS A;  3KZD A;  4H11 A;  2OCS A;  2KJK A;  5HFB A;  3STJ A;  1X6D A;  3PDZ A;  1V5Q A;  3ID3 A;  4AMH A;  5D13 A;  1FC6 A;  2KG2 A;  1NTE A;  2FCF A;  2LC7 A;  2DJT A;  2KV8 A;  5F3X A;  4XHV A;  2KBS A;  1W9Q A;  1FCF A;  2EXG A;  1WG6 A;  4NMO A;  5HF4 A;  1VA8 A;  2CSS A;  2YUB A;  1W9O A;  3TSW A;  1UEQ A;  3E17 A;  2E7K A;  3RLE A;  4JOG A;  4NNM A;  2RCZ A;  1MFL A;  1U39 A;  2M0T A;  1P1D A;  4JOF A;  2EDZ A;  5HJ1 A;  3K1R A;  1WI4 A;  4P2A B;  2M0V A;  4LMM A;  1UJD A;  2ZPM A;  3WKM A;  3CYY A;  3NGH A;  1RGW A;  4YDP A;  1GQ4 A;  3CBX A;  1N7E A;  2EGN A;  2OQS A;  4GVC A;  4P0C A;  2PKT A;  2FN5 A;  2KJP A;  1UJU A;  3GDS A;  2I04 A;  2VSP A;  4WYU A;  2P3W A;  5E1Y A;  1V5L A;  2OZF A;  2K1Z A;  3OU0 A;  3MH7 A;  1UM7 A;  2I4S A;  4E3B A;  1MC7 A;  3ID2 A;  2JXO A;  1WH1 A;  2FE5 A;  1I16 A;  3CBY A;  2JIN A;  4UU5 A;  2I1N A;  1WFV A;  2G5M B;  5G1E A;  2EDV A;  2I0I A;  1VAE A;  3PS4 A;  3QGL A;  3R68 A;  4GHN A;  2QKT A;  4K72 A;  3TSZ A;  3VQG A;  3DOR A;  1T2M A;  4O06 A;  4Q3H A;  4JOH A;  1UFX A;  3CH8 A;  2ENO A;  2QKU A;  1WJL A;  4NXQ A;  3LNX A;  3NFK A;  1UEP A;  2M3M A;  1Q7X A;  4JOK A;  2I6V A;  2O2T A;  2AWU A;  2ZPL A;  4R2Z A;  2FNE A;  4JOE A;  5HF1 A;  5FHT A;  2OSG A;  3EGG C;  4K75 A;  2YUY A;  2EJY A;  3GGE A;  4OEO A;  1U38 A;  2KOJ A;  3K82 A;  2KOH A;  2KJD A;  2LC6 A;  2H2B A; 
#chains in the Genus database with same CATH topology
 1ZUB A;  1N6F A;  5B6L A;  1L6O A;  2HGA A;  5E21 A;  4PQW A;  5IL9 A;  4Z8J A;  3HPM A;  3GCN A;  2VZ5 A;  2HE4 A;  1GM1 A;  2PDZ A;  5HEY A;  3GAB A;  2W7R A;  3DJ3 A;  1Q3O A;  2UZC A;  2KL1 A;  3KHF A;  2JIK A;  2M0U A;  4JJ3 A;  2JSN A;  3GDU A;  4UU6 A;  2MX6 A;  2PA1 A;  2DLU A;  5DTH A;  3QIK A;  2EDP A;  4RI0 A;  3AXA A;  2IWP A;  2JWE A;  3KZE A;  4JJ0 A;  2YTW A;  1WHA A;  5GLJ A;  1QAV A;  1W9E A;  4WYT A;  2EV8 A;  4NMR A;  3BPU A;  3EGH C;  3O46 A;  2KYL A;  2L97 A;  4Q2O A;  2OGP A;  1X5Q A;  3QO6 A;  1UM1 A;  2EEI A;  3GSL A;  3PV5 A;  2VPH A;  1WI2 A;  3KDK A;  1QAV B;  1UF1 A;  1TE0 A;  5HDY A;  3TSV A;  1QLC A;  1WHD A;  4Q2Q A;  1R6J A;  2EGK A;  5HED A;  3QJM A;  1UHP A;  2G2L A;  1M5Z A;  2H3L A;  4Q6H A;  1BFE A;  1WIF A;  4IC6 A;  2MHO A;  2EAQ A;  2EEJ A;  3ZRT A;  2LUI A;  1I92 A;  4REY A;  4GVD A;  3DJ1 A;  5GND A;  1VJ6 A;  2JRE A;  3I4W A;  1KWA A;  1FC9 A;  3DIW A;  4E34 A;  2W4F A;  1RY4 A;  1UIT A;  2GZV A;  2Q9V A;  2R4H A;  1WFG A;  2QBW A;  3GDV A;  1N99 A;  1PDR A;  1OBY A;  4E35 A;  3JXT A;  3MH6 A;  4OAJ A;  1N6E A;  4K78 A;  2D8I A;  3DJA A;  2YT8 A;  3CC0 A;  1D5G A;  2K20 A;  2LOB A;  2OS6 A;  1X45 A;  4F8K A;  2EEG A;  4K6Y A;  1UEZ A;  1MFG A;  1P1E A;  2PNT A;  4NMQ A;  2M10 A;  2KAW A;  1V6B A;  3NFL A;  1FC7 A;  2V1W A;  2VSV A;  3HPK A;  5A2P A;  1QAU A;  4JOR A;  4NMV A;  5E6P B;  2OMJ A;  4Q2P A;  1X5N A;  4YYX A;  2AWW A;  5E22 A;  5B42 A;  2IWQ A;  3OTP A;  2IWO A;  4NMP A;  1VCW A;  4HOP A;  5FB8 C;  3ID1 A;  2CSJ A;  1GQ5 A;  1N7F A;  4N6X A;  5F67 A;  2BYG A;  3VQF A;  3ID4 A;  2QKV A;  2DKR A;  1Z87 A;  3RL8 A;  5HFD A;  4L8N A;  3QJN A;  4OEP A;  4HOP B;  2H3M A;  4FLN A;  3PV2 A;  1ZOK A;  3GCO A;  4G69 A;  5H3J A;  2JOA A;  3K50 A;  1VB7 A;  1XZ9 A;  2REY A;  4EDJ A;  2KA9 A;  2PKU A;  4NMS A;  2DMZ A;  2KPL A;  3SOE A;  1WF8 A;  2Z9I A;  4JL7 A;  4KFW A;  1IU2 A;  2Q3G A;  1LCY A;  2YT7 A;  1G9O A;  2RRM A;  2PZD A;  5I7Z A;  1X5R A;  1Y7N A;  3L4F D;  5E11 A;  1U3B A;  3SFJ A;  1K32 A;  2L4S A;  2KPK A;  4FGM A;  1N6D A;  2KRG A;  2AIN A;  5HFC A;  4JOP A;  1Z86 A;  4KFV A;  2D90 A;  1TP3 A;  5G1D A;  1TQ3 A;  1BE9 A;  3QE1 A;  1Y8T A;  2D92 A;  5ILB A;  1IU0 A;  1KEF A;  1V62 A;  1U37 A;  5JXB A;  4NXP A;  1RGR A;  2DAZ A;  2QT5 A;  2JIL A;  2CS5 A;  1OBX A;  3B76 A;  5EZ0 A;  5HFE A;  3SUZ A;  2QG1 A;  3RL7 A;  2M0Z A;  3R0H A;  3NCV A;  3PV4 A;  2WL7 A;  1Q3P A;  2H2C A;  3MH4 A;  2V90 A;  1OBZ A;  3GJ9 A;  2DB5 A;  4K76 A;  2IWN A;  2F0A A;  5HET A;  4NNL A;  3FY5 A;  3SHU A;  1SOZ A;  1NF3 C;  2Z17 A;  1UEW A;  1WF7 A;  4MPA A;  2DC2 A;  3LNY A;  3QDO A;  1IHJ A;  3CS0 A;  2KQF A;  2EGO A;  1B8Q A;  1SOT A;  1X8S A;  2EEH A;  1KY9 A;  3R69 A;  3HVQ C;  1TP5 A;  2F5Y A;  2VWR A;  2L4T A;  4Z33 A;  2X7Z A;  3I18 A;  2I0L A;  4Q6S A;  2AWX A;  2DM8 A;  3PDV A;  5HFF A;  2KOM A;  2OPG A;  1RZX A;  3I1E A;  3TMH A;  5HEB A;  2R3Y A;  1OZI A;  2VRF A;  4NMT A;  2GEF A;  2EHR A;  1N7T A;  5EYZ A;  4Q2N A;  2HE2 A;  3WKL A;  2LA8 A;  1V1T A;  3CBZ A;  3SHW A;  1YBO A;  3O5N A;  4JOJ A;  4NXR A;  1UJV A;  2DLS A;  3KZD A;  4H11 A;  2OCS A;  2KJK A;  5HFB A;  3STJ A;  1X6D A;  3PDZ A;  1V5Q A;  3ID3 A;  4AMH A;  5D13 A;  1X9Z A;  1FC6 A;  2KG2 A;  1NTE A;  2FCF A;  2LC7 A;  2DJT A;  2KV8 A;  5F3X A;  4XHV A;  2KBS A;  1W9Q A;  1FCF A;  2EXG A;  1WG6 A;  4NMO A;  5HF4 A;  1VA8 A;  2CSS A;  2YUB A;  1W9O A;  3TSW A;  1UEQ A;  3E17 A;  2E7K A;  3RLE A;  4JOG A;  4NNM A;  2RCZ A;  1MFL A;  1U39 A;  2M0T A;  1P1D A;  4JOF A;  2EDZ A;  5HJ1 A;  3K1R A;  1WI4 A;  4P2A B;  2M0V A;  4LMM A;  1UJD A;  2ZPM A;  3WKM A;  3CYY A;  3NGH A;  1RGW A;  4YDP A;  1GQ4 A;  3CBX A;  1N7E A;  2EGN A;  2OQS A;  4GVC A;  4P0C A;  2PKT A;  2FN5 A;  2KJP A;  1UJU A;  3GDS A;  2I04 A;  2VSP A;  4WYU A;  2P3W A;  5E1Y A;  1V5L A;  2OZF A;  2K1Z A;  3OU0 A;  3MH7 A;  1UM7 A;  2I4S A;  4E3B A;  1MC7 A;  3ID2 A;  2JXO A;  1WH1 A;  2FE5 A;  1I16 A;  3CBY A;  2JIN A;  4UU5 A;  2I1N A;  1WFV A;  2G5M B;  5G1E A;  2EDV A;  2I0I A;  1VAE A;  3PS4 A;  3QGL A;  3R68 A;  4GHN A;  2QKT A;  4K72 A;  3TSZ A;  3VQG A;  3DOR A;  1T2M A;  4O06 A;  4Q3H A;  4JOH A;  1UFX A;  3CH8 A;  2ENO A;  2QKU A;  1WJL A;  4NXQ A;  3LNX A;  3NFK A;  1UEP A;  2M3M A;  1Q7X A;  4JOK A;  2I6V A;  2O2T A;  2AWU A;  2ZPL A;  4R2Z A;  2FNE A;  4JOE A;  5HF1 A;  5FHT A;  2OSG A;  3EGG C;  4K75 A;  3KDG A;  2YUY A;  2EJY A;  3GGE A;  4OEO A;  1U38 A;  2KOJ A;  3K82 A;  2KOH A;  2KJD A;  2LC6 A;  2H2B A; 
#chains in the Genus database with same CATH homology
 1ZUB A;  1N6F A;  5B6L A;  1L6O A;  2HGA A;  5E21 A;  4PQW A;  5IL9 A;  4Z8J A;  3HPM A;  3GCN A;  2VZ5 A;  2HE4 A;  1GM1 A;  2PDZ A;  5HEY A;  3GAB A;  2W7R A;  3DJ3 A;  1Q3O A;  2UZC A;  2KL1 A;  3KHF A;  2JIK A;  2M0U A;  4JJ3 A;  2JSN A;  3GDU A;  4UU6 A;  2MX6 A;  2PA1 A;  2DLU A;  5DTH A;  3QIK A;  2EDP A;  4RI0 A;  3AXA A;  2IWP A;  2JWE A;  3KZE A;  4JJ0 A;  2YTW A;  1WHA A;  5GLJ A;  1QAV A;  1W9E A;  4WYT A;  2EV8 A;  4NMR A;  3BPU A;  3EGH C;  3O46 A;  2KYL A;  2L97 A;  4Q2O A;  2OGP A;  1X5Q A;  3QO6 A;  1UM1 A;  2EEI A;  3GSL A;  3PV5 A;  2VPH A;  1WI2 A;  3KDK A;  1QAV B;  1UF1 A;  1TE0 A;  5HDY A;  3TSV A;  1QLC A;  1WHD A;  4Q2Q A;  1R6J A;  2EGK A;  5HED A;  3QJM A;  1UHP A;  2G2L A;  1M5Z A;  2H3L A;  4Q6H A;  1BFE A;  1WIF A;  4IC6 A;  2MHO A;  2EAQ A;  2EEJ A;  3ZRT A;  2LUI A;  1I92 A;  4REY A;  4GVD A;  3DJ1 A;  5GND A;  1VJ6 A;  2JRE A;  3I4W A;  1KWA A;  1FC9 A;  3DIW A;  4E34 A;  2W4F A;  1RY4 A;  1UIT A;  2GZV A;  2Q9V A;  2R4H A;  1WFG A;  2QBW A;  3GDV A;  1N99 A;  1PDR A;  1OBY A;  4E35 A;  3JXT A;  3MH6 A;  4OAJ A;  1N6E A;  4K78 A;  2D8I A;  3DJA A;  2YT8 A;  3CC0 A;  1D5G A;  2K20 A;  2LOB A;  2OS6 A;  1X45 A;  4F8K A;  2EEG A;  4K6Y A;  1UEZ A;  1MFG A;  1P1E A;  2PNT A;  4NMQ A;  2M10 A;  2KAW A;  1V6B A;  3NFL A;  1FC7 A;  2V1W A;  2VSV A;  3HPK A;  5A2P A;  1QAU A;  4JOR A;  4NMV A;  5E6P B;  2OMJ A;  4Q2P A;  1X5N A;  4YYX A;  2AWW A;  5E22 A;  5B42 A;  2IWQ A;  3OTP A;  2IWO A;  4NMP A;  1VCW A;  4HOP A;  5FB8 C;  3ID1 A;  2CSJ A;  1GQ5 A;  1N7F A;  4N6X A;  5F67 A;  2BYG A;  3VQF A;  3ID4 A;  2QKV A;  2DKR A;  1Z87 A;  3RL8 A;  5HFD A;  4L8N A;  3QJN A;  4OEP A;  4HOP B;  2H3M A;  4FLN A;  3PV2 A;  1ZOK A;  3GCO A;  4G69 A;  5H3J A;  2JOA A;  3K50 A;  1VB7 A;  1XZ9 A;  2REY A;  4EDJ A;  2KA9 A;  2PKU A;  4NMS A;  2DMZ A;  2KPL A;  3SOE A;  1WF8 A;  2Z9I A;  4JL7 A;  4KFW A;  1IU2 A;  2Q3G A;  1LCY A;  2YT7 A;  1G9O A;  2RRM A;  2PZD A;  5I7Z A;  1X5R A;  1Y7N A;  3L4F D;  5E11 A;  1U3B A;  3SFJ A;  1K32 A;  2L4S A;  2KPK A;  4FGM A;  1N6D A;  2KRG A;  2AIN A;  5HFC A;  4JOP A;  1Z86 A;  4KFV A;  2D90 A;  1TP3 A;  5G1D A;  1TQ3 A;  1BE9 A;  3QE1 A;  1Y8T A;  2D92 A;  5ILB A;  1IU0 A;  1KEF A;  1V62 A;  1U37 A;  5JXB A;  4NXP A;  1RGR A;  2DAZ A;  2QT5 A;  2JIL A;  2CS5 A;  1OBX A;  3B76 A;  5EZ0 A;  5HFE A;  3SUZ A;  2QG1 A;  3RL7 A;  2M0Z A;  3R0H A;  3NCV A;  3PV4 A;  2WL7 A;  1Q3P A;  2H2C A;  3MH4 A;  2V90 A;  1OBZ A;  3GJ9 A;  2DB5 A;  4K76 A;  2IWN A;  2F0A A;  5HET A;  4NNL A;  3FY5 A;  3SHU A;  1SOZ A;  1NF3 C;  2Z17 A;  1UEW A;  1WF7 A;  4MPA A;  2DC2 A;  3LNY A;  3QDO A;  1IHJ A;  3CS0 A;  2KQF A;  2EGO A;  1B8Q A;  1SOT A;  1X8S A;  2EEH A;  1KY9 A;  3R69 A;  3HVQ C;  1TP5 A;  2F5Y A;  2VWR A;  2L4T A;  4Z33 A;  2X7Z A;  3I18 A;  2I0L A;  4Q6S A;  2AWX A;  2DM8 A;  3PDV A;  5HFF A;  2KOM A;  2OPG A;  1RZX A;  3I1E A;  3TMH A;  5HEB A;  2R3Y A;  1OZI A;  2VRF A;  4NMT A;  2GEF A;  2EHR A;  1N7T A;  5EYZ A;  4Q2N A;  2HE2 A;  3WKL A;  2LA8 A;  1V1T A;  3CBZ A;  3SHW A;  1YBO A;  3O5N A;  4JOJ A;  4NXR A;  1UJV A;  2DLS A;  3KZD A;  4H11 A;  2OCS A;  2KJK A;  5HFB A;  3STJ A;  1X6D A;  3PDZ A;  1V5Q A;  3ID3 A;  4AMH A;  5D13 A;  1X9Z A;  1FC6 A;  2KG2 A;  1NTE A;  2FCF A;  2LC7 A;  2DJT A;  2KV8 A;  5F3X A;  4XHV A;  2KBS A;  1W9Q A;  1FCF A;  2EXG A;  1WG6 A;  4NMO A;  5HF4 A;  1VA8 A;  2CSS A;  2YUB A;  1W9O A;  3TSW A;  1UEQ A;  3E17 A;  2E7K A;  3RLE A;  4JOG A;  4NNM A;  2RCZ A;  1MFL A;  1U39 A;  2M0T A;  1P1D A;  4JOF A;  2EDZ A;  5HJ1 A;  3K1R A;  1WI4 A;  4P2A B;  2M0V A;  4LMM A;  1UJD A;  2ZPM A;  3WKM A;  3CYY A;  3NGH A;  1RGW A;  4YDP A;  1GQ4 A;  3CBX A;  1N7E A;  2EGN A;  2OQS A;  4GVC A;  4P0C A;  2PKT A;  2FN5 A;  2KJP A;  1UJU A;  3GDS A;  2I04 A;  2VSP A;  4WYU A;  2P3W A;  5E1Y A;  1V5L A;  2OZF A;  2K1Z A;  3OU0 A;  3MH7 A;  1UM7 A;  2I4S A;  4E3B A;  1MC7 A;  3ID2 A;  2JXO A;  1WH1 A;  2FE5 A;  1I16 A;  3CBY A;  2JIN A;  4UU5 A;  2I1N A;  1WFV A;  2G5M B;  5G1E A;  2EDV A;  2I0I A;  1VAE A;  3PS4 A;  3QGL A;  3R68 A;  4GHN A;  2QKT A;  4K72 A;  3TSZ A;  3VQG A;  3DOR A;  1T2M A;  4O06 A;  4Q3H A;  4JOH A;  1UFX A;  3CH8 A;  2ENO A;  2QKU A;  1WJL A;  4NXQ A;  3LNX A;  3NFK A;  1UEP A;  2M3M A;  1Q7X A;  4JOK A;  2I6V A;  2O2T A;  2AWU A;  2ZPL A;  4R2Z A;  2FNE A;  4JOE A;  5HF1 A;  5FHT A;  2OSG A;  3EGG C;  4K75 A;  3KDG A;  2YUY A;  2EJY A;  3GGE A;  4OEO A;  1U38 A;  2KOJ A;  3K82 A;  2KOH A;  2KJD A;  2LC6 A;  2H2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...