2KOMA

Solution structure of humar par-3b pdz2 (residues 451-549)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
101
structure length
101
Chain Sequence
GSYNTKKIGKRLNIQLKKGTEGLGFSITSRDVTIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTVSLLVFRQED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Partitioning defective 3 homolog
publication title Rapid, robotic, small-scale protein production for NMR screening and structure determination.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2komA00
4Q2QA 1IU2A 3CYYA 4MPAA 1OBXA 2D92A 2DAZA 3VQFA 2QG1A 2JXOA 2PNTA 2HE2A 4HOPB 4K75A 1L6OA 2EGKA 3GDSA 1PDRA 2DC2A 1WFVA 1MFGA 3DJ3A 2KJDA 1QAVB 4JOEA 1BFEA 2ZPLA 4N6XA 2V90A 1TQ3A 2Q9VA 1I16A 2EHRA 1OBYA 3VQGA 1N7FA 2I6VA 4RI0A 5HETA 1W9QA 3GGEA 3PS4A 2H2BA 3KZDA 5E22A 2OSGA 3DJ1A 2F0AA 1G9OA 2WL7A 4KFWA 4REYA 2YT7A 1WH1A 3R69A 2EXGA 5HJ1A 3SHWA 1X5NA 2AWXA 4JORA 5HFEA 1R6JA 4GVDA 2HE4A 4NMRA 2L97A 4K78A 4H11A 2OMJA 2M0TA 4R2ZA 4Q6HA 4E35A 1OZIA 2VWRA 2OCSA 3I1EA 1V5LA 4O06A 3O5NA 2EAQA 2YUBA 1NTEA 1SOZA 3I18A 3LNYA 4NXQA 1UM7A 1WI2A 3GCNA 1N6DA 1UHPA 4WYUA 3OU0A 5H3JA 1UJUA 2KJKA 2YTWA 4JOKA 2KAWA 2VPHA 3GCOA 2YT8A 5HEBA 1U38A 4LMMA 1Y8TA 4JOHA 5E6PB 1SOTA 2M0VA 4JL7A 1WIFA 4Q2PA 2KQFA 2K20A 3EGGC 3TSZA 2DKRA 2AWUA 1WFGA 4NXRA 1U37A 4JOPA 1P1EA 2M10A 1TE0A 1FCFA 5HEDA 2REYA 2PKTA 1N6EA 3B76A 2I0IA 1X45A 3R0HA 1TP3A 2JINA 2KJPA 4NNMA 2RCZA 3OTPA 3WKLA 4IC6A 1UFXA 1Q3OA 2EDVA 3QGLA 4Q2OA 4GVCA 4OAJA 2OQSA 2ENOA 1N7TA 1N7EA 2DB5A 3CS0A 1U39A 2W4FA 5HFCA 2L4TA 3MH7A 5G1DA 2Q3GA 4Q6SA 1VA8A 1RGRA 1IHJA 4UU5A 1N99A 3ID3A 3ID2A 3RL8A 2Z17A 2FNEA 1GM1A 5EZ0A 5HFBA 4NMQA 4Z8JA 2M0ZA 3ID4A 3KHFA 1UEPA 2KOHA 2JWEA 2VSPA 2HGAA 4KFVA 2KYLA 3QIKA 2KRGA 2FE5A 2JOAA 5HDYA 2LC6A 5HFDA 1N6FA 4UU6A 3RLEA 3HPMA 3K1RA 3NFKA 5DTHA 4NMOA 4P0CA 2F5YA 4EDJA 1VCWA 2E7KA 4WYTA 3CBZA 4L8NA 4PQWA 1XZ9A 2EEJA 2LC7A 1W9OA 5D13A 4P2AB 1MC7A 2FCFA 2K1ZA 1GQ5A 1UF1A 1ZUBA 2QKTA 1IU0A 1UEQA 2OGPA 5E11A 3E17A 2G5MB 4NMVA 2IWPA 2QBWA 3HPKA 1QLCA 2GZVA 3SHUA 3O46A 3CH8A 3K82A 2IWOA 2LOBA 4JOGA 1WI4A 5HEYA 1YBOA 4JOFA 3PV2A 4NNLA 3JXTA 4Z33A 4K72A 1D5GA 1VB7A 3PDZA 1QAUA 2H3LA 3NGHA 2FN5A 5GNDA 3QJNA 2Z9IA 1RZXA 5EYZA 1QAVA 5HF4A 2CSSA 1X5QA 3PDVA 1V6BA 3QDOA 2M0UA 1OBZA 2EJYA 3WKMA 1Z86A 2O2TA 2I1NA 2DLSA 1V62A 2KOJA 1TP5A 3KZEA 2JREA 3GDUA 3FY5A 1UITA 1U3BA 5E21A 2KPLA 2R4HA 5I7ZA 2AWWA 2AINA 2PA1A 1WHAA 4Q3HA 3QJMA 4OEOA 5F67A 5HF1A 3DJAA 3TSWA 4OEPA 3ID1A 2DM8A 4NMPA 2DLUA 2KV8A 2YUYA 3PV5A 1GQ4A 2UZCA 2VRFA 1UJVA 3GJ9A 1V5QA 2QKVA 2OPGA 2X7ZA 2VZ5A 1WG6A 2P3WA 3QO6A 2IWQA 2KG2A 4E3BA 2H2CA 2VSVA 2IWNA 2EDZA 2I4SA 5HFFA 4NXPA 5B6LA 5G1EA 2W7RA 4G69A 1UM1A 1M5ZA 1BE9A 3I4WA 1Q3PA 2D8IA 1KY9A 3DORA 5A2PA 1W9EA 1RY4A 4XHVA 2MHOA 1WF7A 2ZPMA 1K32A 2QT5A 2D90A 5FHTA 3GSLA 4Q2NA 5GLJA 3SOEA 3GDVA 4E34A 1UEWA 1WF8A 2EGOA 4K6YA 2RRMA 4FGMA 2OZFA 1MFLA 1X8SA 2CS5A 2LA8A 2EEGA 1I92A 2OS6A 3QE1A 4AMHA 3NFLA 1VJ6A 3K50A 5JXBA 3LNXA 2PDZA 1FC6A 1KWAA 1LCYA 3TSVA 2EDPA 3R68A 3MH6A 3DIWA 1NF3C 2EV8A 2R3YA 1WJLA 3EGHC 1T2MA 2DJTA 1WHDA 2LUIA 5FB8C 2DMZA 5E1YA 3CBXA 2KPKA 1KEFA 2QKUA 3MH4A 4HOPA 2EGNA 3PV4A 2BYGA 3ZRTA 3SUZA 4YDPA 4JOJA 3SFJA 1Y7NA 1FC9A 4NMSA 2V1WA 2EEIA 3CBYA 2KOMA 3RL7A 2KA9A 2PZDA 3TMHA 3BPUA 2M3MA 3L4FD 2CSJA 3STJA 4F8KA 2H3MA 1ZOKA 1B8QA 3CC0A 1VAEA 1X6DA 2G2LA 2JILA 2KBSA 2I0LA 1Q7XA 2JIKA 3AXAA 2EEHA 4YYXA 1UEZA 1Z87A 3HVQC 5F3XA 2MX6A 1FC7A 2I04A 1P1DA 2L4SA 4K76A 1RGWA 4GHNA 1V1TA 4NMTA 1X5RA 1UJDA 2KL1A 2PKUA
chains in the Genus database with same CATH superfamily
4Q2QA 1IU2A 3CYYA 4MPAA 1OBXA 2D92A 2DAZA 3VQFA 2QG1A 2JXOA 2PNTA 2HE2A 4HOPB 4K75A 1L6OA 2EGKA 3GDSA 1PDRA 2DC2A 1WFVA 1MFGA 3DJ3A 2KJDA 1QAVB 4JOEA 1BFEA 2ZPLA 3KDGA 4N6XA 2V90A 1TQ3A 2Q9VA 1I16A 2EHRA 1OBYA 3VQGA 1N7FA 2I6VA 4RI0A 3KDKA 5HETA 1W9QA 3GGEA 3PS4A 2H2BA 3KZDA 5E22A 2OSGA 3DJ1A 2F0AA 1G9OA 2WL7A 4KFWA 4REYA 2YT7A 1WH1A 3R69A 2EXGA 5HJ1A 3SHWA 1X5NA 2AWXA 4JORA 5HFEA 5ILBA 1R6JA 4GVDA 2HE4A 4NMRA 2L97A 4K78A 4H11A 2OMJA 2M0TA 4R2ZA 4Q6HA 4E35A 1OZIA 2VWRA 2OCSA 3I1EA 1V5LA 2JSNA 4O06A 3O5NA 2EAQA 2YUBA 1NTEA 1SOZA 3I18A 3LNYA 4NXQA 1UM7A 1WI2A 3GCNA 1N6DA 1UHPA 4WYUA 3OU0A 5H3JA 1UJUA 2KJKA 2YTWA 4JOKA 2KAWA 2VPHA 3GCOA 2YT8A 5HEBA 1U38A 4LMMA 1Y8TA 4JOHA 5E6PB 1SOTA 2M0VA 4JL7A 1WIFA 4Q2PA 2KQFA 2K20A 3EGGC 3TSZA 2DKRA 2AWUA 1WFGA 4NXRA 1U37A 4JOPA 1P1EA 2M10A 1TE0A 1FCFA 5HEDA 2REYA 2PKTA 1N6EA 3B76A 2I0IA 1X45A 3R0HA 1TP3A 2JINA 2KJPA 4NNMA 2RCZA 3OTPA 3WKLA 1X9ZA 4IC6A 1UFXA 1Q3OA 2EDVA 2GEFA 3QGLA 4Q2OA 4GVCA 4OAJA 2OQSA 2ENOA 1N7TA 1N7EA 2DB5A 3CS0A 1U39A 2W4FA 5HFCA 2L4TA 3MH7A 5G1DA 2Q3GA 4Q6SA 1VA8A 1RGRA 1IHJA 4UU5A 1N99A 3ID3A 3ID2A 3RL8A 2Z17A 2FNEA 1GM1A 5EZ0A 5HFBA 4NMQA 4Z8JA 2M0ZA 3ID4A 3KHFA 1UEPA 2KOHA 2JWEA 2VSPA 3NCVA 2HGAA 4KFVA 2KYLA 3QIKA 4JJ3A 2KRGA 2FE5A 2JOAA 5HDYA 2LC6A 5HFDA 1N6FA 4UU6A 3RLEA 3HPMA 3K1RA 3NFKA 5DTHA 4NMOA 4P0CA 2F5YA 4EDJA 1VCWA 2E7KA 4WYTA 4JJ0A 3CBZA 4L8NA 4PQWA 1XZ9A 2EEJA 2LC7A 1W9OA 5D13A 4P2AB 1MC7A 2FCFA 2K1ZA 1GQ5A 1UF1A 1ZUBA 2QKTA 1IU0A 1UEQA 2OGPA 5E11A 3E17A 2G5MB 4NMVA 2IWPA 2QBWA 3HPKA 1QLCA 2GZVA 3SHUA 3O46A 3CH8A 3K82A 2IWOA 2LOBA 4JOGA 1WI4A 5HEYA 1YBOA 4JOFA 3PV2A 4NNLA 3JXTA 4Z33A 4K72A 1D5GA 1VB7A 3PDZA 1QAUA 2H3LA 3NGHA 2FN5A 5GNDA 3QJNA 2Z9IA 1RZXA 5EYZA 1QAVA 5HF4A 2CSSA 1X5QA 3PDVA 1V6BA 3QDOA 2M0UA 1OBZA 2EJYA 3WKMA 1Z86A 2O2TA 2I1NA 2DLSA 1V62A 2KOJA 4FLNA 1TP5A 3KZEA 2JREA 3GDUA 3FY5A 1UITA 1U3BA 5E21A 2KPLA 2R4HA 5I7ZA 2AWWA 2AINA 2PA1A 1WHAA 4Q3HA 3QJMA 4OEOA 5F67A 5HF1A 3DJAA 3TSWA 4OEPA 3ID1A 2DM8A 4NMPA 2DLUA 2KV8A 2YUYA 3PV5A 1GQ4A 2UZCA 2VRFA 1UJVA 3GJ9A 1V5QA 2QKVA 2OPGA 2X7ZA 2VZ5A 1WG6A 2P3WA 3QO6A 2IWQA 2KG2A 4E3BA 2H2CA 2VSVA 2IWNA 2EDZA 2I4SA 5HFFA 4NXPA 5B6LA 5G1EA 5IL9A 2W7RA 4G69A 1UM1A 1M5ZA 1BE9A 3I4WA 1Q3PA 2D8IA 1KY9A 3DORA 5A2PA 1W9EA 1RY4A 4XHVA 2MHOA 1WF7A 2ZPMA 1K32A 2QT5A 2D90A 5FHTA 3GSLA 4Q2NA 5GLJA 3SOEA 3GDVA 4E34A 1UEWA 1WF8A 2EGOA 4K6YA 2RRMA 4FGMA 2OZFA 1MFLA 1X8SA 2CS5A 2LA8A 2EEGA 1I92A 2OS6A 3QE1A 4AMHA 3NFLA 1VJ6A 3K50A 5JXBA 3LNXA 2PDZA 1FC6A 1KWAA 1LCYA 3TSVA 2EDPA 3R68A 3MH6A 3DIWA 1NF3C 2EV8A 2R3YA 1WJLA 3EGHC 1T2MA 2DJTA 1WHDA 2LUIA 5FB8C 2DMZA 5E1YA 3CBXA 2KPKA 1KEFA 2QKUA 3MH4A 4HOPA 2EGNA 3PV4A 2BYGA 3ZRTA 3SUZA 4YDPA 4JOJA 5B42A 3SFJA 3GABA 1Y7NA 1FC9A 4NMSA 2V1WA 2EEIA 3CBYA 2KOMA 3RL7A 2KA9A 2PZDA 3TMHA 3BPUA 2M3MA 3L4FD 2CSJA 3STJA 4F8KA 2H3MA 1ZOKA 1B8QA 3CC0A 1VAEA 1X6DA 2G2LA 2JILA 2KBSA 2I0LA 1Q7XA 2JIKA 3AXAA 2EEHA 4YYXA 1UEZA 1Z87A 3HVQC 5F3XA 2MX6A 1FC7A 2I04A 1P1DA 2L4SA 4K76A 1RGWA 4GHNA 1V1TA 4NMTA 1X5RA 1UJDA 2KL1A 2PKUA
chains in the Genus database with same CATH topology
4Q2QA 1IU2A 3CYYA 4MPAA 1OBXA 2D92A 2DAZA 3VQFA 2QG1A 2JXOA 2PNTA 2HE2A 4HOPB 4K75A 1L6OA 2EGKA 3GDSA 1PDRA 2DC2A 1WFVA 1MFGA 3DJ3A 2KJDA 1QAVB 4JOEA 1BFEA 2ZPLA 3KDGA 4N6XA 2V90A 1TQ3A 2Q9VA 1I16A 2EHRA 1OBYA 3VQGA 1N7FA 2I6VA 4RI0A 3KDKA 5HETA 1W9QA 3GGEA 3PS4A 2H2BA 3KZDA 5E22A 2OSGA 3DJ1A 2F0AA 1G9OA 2WL7A 4KFWA 4REYA 2YT7A 1WH1A 3R69A 2EXGA 5HJ1A 3SHWA 1X5NA 2AWXA 4JORA 5HFEA 5ILBA 1R6JA 4GVDA 2HE4A 4NMRA 2L97A 4K78A 4H11A 2OMJA 2M0TA 4R2ZA 4Q6HA 4E35A 1OZIA 2VWRA 2OCSA 3I1EA 1V5LA 2JSNA 4O06A 3O5NA 2EAQA 2YUBA 1NTEA 1SOZA 3I18A 3LNYA 4NXQA 1UM7A 1WI2A 3GCNA 1N6DA 1UHPA 4WYUA 3OU0A 5H3JA 1UJUA 2KJKA 2YTWA 4JOKA 2KAWA 2VPHA 3GCOA 2YT8A 5HEBA 1U38A 4LMMA 1Y8TA 4JOHA 5E6PB 1SOTA 2M0VA 4JL7A 1WIFA 4Q2PA 2KQFA 2K20A 3EGGC 3TSZA 2DKRA 2AWUA 1WFGA 4NXRA 1U37A 4JOPA 1P1EA 2M10A 1TE0A 1FCFA 5HEDA 2REYA 2PKTA 1N6EA 3B76A 2I0IA 1X45A 3R0HA 1TP3A 2JINA 2KJPA 4NNMA 2RCZA 3OTPA 3WKLA 1X9ZA 4IC6A 1UFXA 1Q3OA 2EDVA 2GEFA 3QGLA 4Q2OA 4GVCA 4OAJA 2OQSA 2ENOA 1N7TA 1N7EA 2DB5A 3CS0A 1U39A 2W4FA 5HFCA 2L4TA 3MH7A 5G1DA 2Q3GA 4Q6SA 1VA8A 1RGRA 1IHJA 4UU5A 1N99A 3ID3A 3ID2A 3RL8A 2Z17A 2FNEA 1GM1A 5EZ0A 5HFBA 4NMQA 4Z8JA 2M0ZA 3ID4A 3KHFA 1UEPA 2KOHA 2JWEA 2VSPA 3NCVA 2HGAA 4KFVA 2KYLA 3QIKA 4JJ3A 2KRGA 2FE5A 2JOAA 5HDYA 2LC6A 5HFDA 1N6FA 4UU6A 3RLEA 3HPMA 3K1RA 3NFKA 5DTHA 4NMOA 4P0CA 2F5YA 4EDJA 1VCWA 2E7KA 4WYTA 4JJ0A 3CBZA 4L8NA 4PQWA 1XZ9A 2EEJA 2LC7A 1W9OA 5D13A 4P2AB 1MC7A 2FCFA 2K1ZA 1GQ5A 1UF1A 1ZUBA 2QKTA 1IU0A 1UEQA 2OGPA 5E11A 3E17A 2G5MB 4NMVA 2IWPA 2QBWA 3HPKA 1QLCA 2GZVA 3SHUA 3O46A 3CH8A 3K82A 2IWOA 2LOBA 4JOGA 1WI4A 5HEYA 1YBOA 4JOFA 3PV2A 4NNLA 3JXTA 4Z33A 4K72A 1D5GA 1VB7A 3PDZA 1QAUA 2H3LA 3NGHA 2FN5A 5GNDA 3QJNA 2Z9IA 1RZXA 5EYZA 1QAVA 5HF4A 2CSSA 1X5QA 3PDVA 1V6BA 3QDOA 2M0UA 1OBZA 2EJYA 3WKMA 1Z86A 2O2TA 2I1NA 2DLSA 1V62A 2KOJA 4FLNA 1TP5A 3KZEA 2JREA 3GDUA 3FY5A 1UITA 1U3BA 5E21A 2KPLA 2R4HA 5I7ZA 2AWWA 2AINA 2PA1A 1WHAA 4Q3HA 3QJMA 4OEOA 5F67A 5HF1A 3DJAA 3TSWA 4OEPA 3ID1A 2DM8A 4NMPA 2DLUA 2KV8A 2YUYA 3PV5A 1GQ4A 2UZCA 2VRFA 1UJVA 3GJ9A 1V5QA 2QKVA 2OPGA 2X7ZA 2VZ5A 1WG6A 2P3WA 3QO6A 2IWQA 2KG2A 4E3BA 2H2CA 2VSVA 2IWNA 2EDZA 2I4SA 5HFFA 4NXPA 5B6LA 5G1EA 5IL9A 2W7RA 4G69A 1UM1A 1M5ZA 1BE9A 3I4WA 1Q3PA 2D8IA 1KY9A 3DORA 5A2PA 1W9EA 1RY4A 4XHVA 2MHOA 1WF7A 2ZPMA 1K32A 2QT5A 2D90A 5FHTA 3GSLA 4Q2NA 5GLJA 3SOEA 3GDVA 4E34A 1UEWA 1WF8A 2EGOA 4K6YA 2RRMA 4FGMA 2OZFA 1MFLA 1X8SA 2CS5A 2LA8A 2EEGA 1I92A 2OS6A 3QE1A 4AMHA 3NFLA 1VJ6A 3K50A 5JXBA 3LNXA 2PDZA 1FC6A 1KWAA 1LCYA 3TSVA 2EDPA 3R68A 3MH6A 3DIWA 1NF3C 2EV8A 2R3YA 1WJLA 3EGHC 1T2MA 2DJTA 1WHDA 2LUIA 5FB8C 2DMZA 5E1YA 3CBXA 2KPKA 1KEFA 2QKUA 3MH4A 4HOPA 2EGNA 3PV4A 2BYGA 3ZRTA 3SUZA 4YDPA 4JOJA 5B42A 3SFJA 3GABA 1Y7NA 1FC9A 4NMSA 2V1WA 2EEIA 3CBYA 2KOMA 3RL7A 2KA9A 2PZDA 3TMHA 3BPUA 2M3MA 3L4FD 2CSJA 3STJA 4F8KA 2H3MA 1ZOKA 1B8QA 3CC0A 1VAEA 1X6DA 2G2LA 2JILA 2KBSA 2I0LA 1Q7XA 2JIKA 3AXAA 2EEHA 4YYXA 1UEZA 1Z87A 3HVQC 5F3XA 2MX6A 1FC7A 2I04A 1P1DA 2L4SA 4K76A 1RGWA 4GHNA 1V1TA 4NMTA 1X5RA 1UJDA 2KL1A 2PKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q2Q A;  1IU2 A;  3CYY A;  4MPA A;  1OBX A;  2D92 A;  2DAZ A;  3VQF A;  2QG1 A;  2JXO A;  2PNT A;  2HE2 A;  4HOP B;  4K75 A;  1L6O A;  2EGK A;  3GDS A;  1PDR A;  2DC2 A;  1WFV A;  1MFG A;  3DJ3 A;  2KJD A;  1QAV B;  4JOE A;  1BFE A;  2ZPL A;  4N6X A;  2V90 A;  1TQ3 A;  2Q9V A;  1I16 A;  2EHR A;  1OBY A;  3VQG A;  1N7F A;  2I6V A;  4RI0 A;  5HET A;  1W9Q A;  3GGE A;  3PS4 A;  2H2B A;  3KZD A;  5E22 A;  2OSG A;  3DJ1 A;  2F0A A;  1G9O A;  2WL7 A;  4KFW A;  4REY A;  2YT7 A;  1WH1 A;  3R69 A;  2EXG A;  5HJ1 A;  3SHW A;  1X5N A;  2AWX A;  4JOR A;  5HFE A;  1R6J A;  4GVD A;  2HE4 A;  4NMR A;  2L97 A;  4K78 A;  4H11 A;  2OMJ A;  2M0T A;  4R2Z A;  4Q6H A;  4E35 A;  1OZI A;  2VWR A;  2OCS A;  3I1E A;  1V5L A;  4O06 A;  3O5N A;  2EAQ A;  2YUB A;  1NTE A;  1SOZ A;  3I18 A;  3LNY A;  4NXQ A;  1UM7 A;  1WI2 A;  3GCN A;  1N6D A;  1UHP A;  4WYU A;  3OU0 A;  5H3J A;  1UJU A;  2KJK A;  2YTW A;  4JOK A;  2KAW A;  2VPH A;  3GCO A;  2YT8 A;  5HEB A;  1U38 A;  4LMM A;  1Y8T A;  4JOH A;  5E6P B;  1SOT A;  2M0V A;  4JL7 A;  1WIF A;  4Q2P A;  2KQF A;  2K20 A;  3EGG C;  3TSZ A;  2DKR A;  2AWU A;  1WFG A;  4NXR A;  1U37 A;  4JOP A;  1P1E A;  2M10 A;  1TE0 A;  1FCF A;  5HED A;  2REY A;  2PKT A;  1N6E A;  3B76 A;  2I0I A;  1X45 A;  3R0H A;  1TP3 A;  2JIN A;  2KJP A;  4NNM A;  2RCZ A;  3OTP A;  3WKL A;  4IC6 A;  1UFX A;  1Q3O A;  2EDV A;  3QGL A;  4Q2O A;  4GVC A;  4OAJ A;  2OQS A;  2ENO A;  1N7T A;  1N7E A;  2DB5 A;  3CS0 A;  1U39 A;  2W4F A;  5HFC A;  2L4T A;  3MH7 A;  5G1D A;  2Q3G A;  4Q6S A;  1VA8 A;  1RGR A;  1IHJ A;  4UU5 A;  1N99 A;  3ID3 A;  3ID2 A;  3RL8 A;  2Z17 A;  2FNE A;  1GM1 A;  5EZ0 A;  5HFB A;  4NMQ A;  4Z8J A;  2M0Z A;  3ID4 A;  3KHF A;  1UEP A;  2KOH A;  2JWE A;  2VSP A;  2HGA A;  4KFV A;  2KYL A;  3QIK A;  2KRG A;  2FE5 A;  2JOA A;  5HDY A;  2LC6 A;  5HFD A;  1N6F A;  4UU6 A;  3RLE A;  3HPM A;  3K1R A;  3NFK A;  5DTH A;  4NMO A;  4P0C A;  2F5Y A;  4EDJ A;  1VCW A;  2E7K A;  4WYT A;  3CBZ A;  4L8N A;  4PQW A;  1XZ9 A;  2EEJ A;  2LC7 A;  1W9O A;  5D13 A;  4P2A B;  1MC7 A;  2FCF A;  2K1Z A;  1GQ5 A;  1UF1 A;  1ZUB A;  2QKT A;  1IU0 A;  1UEQ A;  2OGP A;  5E11 A;  3E17 A;  2G5M B;  4NMV A;  2IWP A;  2QBW A;  3HPK A;  1QLC A;  2GZV A;  3SHU A;  3O46 A;  3CH8 A;  3K82 A;  2IWO A;  2LOB A;  4JOG A;  1WI4 A;  5HEY A;  1YBO A;  4JOF A;  3PV2 A;  4NNL A;  3JXT A;  4Z33 A;  4K72 A;  1D5G A;  1VB7 A;  3PDZ A;  1QAU A;  2H3L A;  3NGH A;  2FN5 A;  5GND A;  3QJN A;  2Z9I A;  1RZX A;  5EYZ A;  1QAV A;  5HF4 A;  2CSS A;  1X5Q A;  3PDV A;  1V6B A;  3QDO A;  2M0U A;  1OBZ A;  2EJY A;  3WKM A;  1Z86 A;  2O2T A;  2I1N A;  2DLS A;  1V62 A;  2KOJ A;  1TP5 A;  3KZE A;  2JRE A;  3GDU A;  3FY5 A;  1UIT A;  1U3B A;  5E21 A;  2KPL A;  2R4H A;  5I7Z A;  2AWW A;  2AIN A;  2PA1 A;  1WHA A;  4Q3H A;  3QJM A;  4OEO A;  5F67 A;  5HF1 A;  3DJA A;  3TSW A;  4OEP A;  3ID1 A;  2DM8 A;  4NMP A;  2DLU A;  2KV8 A;  2YUY A;  3PV5 A;  1GQ4 A;  2UZC A;  2VRF A;  1UJV A;  3GJ9 A;  1V5Q A;  2QKV A;  2OPG A;  2X7Z A;  2VZ5 A;  1WG6 A;  2P3W A;  3QO6 A;  2IWQ A;  2KG2 A;  4E3B A;  2H2C A;  2VSV A;  2IWN A;  2EDZ A;  2I4S A;  5HFF A;  4NXP A;  5B6L A;  5G1E A;  2W7R A;  4G69 A;  1UM1 A;  1M5Z A;  1BE9 A;  3I4W A;  1Q3P A;  2D8I A;  1KY9 A;  3DOR A;  5A2P A;  1W9E A;  1RY4 A;  4XHV A;  2MHO A;  1WF7 A;  2ZPM A;  1K32 A;  2QT5 A;  2D90 A;  5FHT A;  3GSL A;  4Q2N A;  5GLJ A;  3SOE A;  3GDV A;  4E34 A;  1UEW A;  1WF8 A;  2EGO A;  4K6Y A;  2RRM A;  4FGM A;  2OZF A;  1MFL A;  1X8S A;  2CS5 A;  2LA8 A;  2EEG A;  1I92 A;  2OS6 A;  3QE1 A;  4AMH A;  3NFL A;  1VJ6 A;  3K50 A;  5JXB A;  3LNX A;  2PDZ A;  1FC6 A;  1KWA A;  1LCY A;  3TSV A;  2EDP A;  3R68 A;  3MH6 A;  3DIW A;  1NF3 C;  2EV8 A;  2R3Y A;  1WJL A;  3EGH C;  1T2M A;  2DJT A;  1WHD A;  2LUI A;  5FB8 C;  2DMZ A;  5E1Y A;  3CBX A;  2KPK A;  1KEF A;  2QKU A;  3MH4 A;  4HOP A;  2EGN A;  3PV4 A;  2BYG A;  3ZRT A;  3SUZ A;  4YDP A;  4JOJ A;  3SFJ A;  1Y7N A;  1FC9 A;  4NMS A;  2V1W A;  2EEI A;  3CBY A;  2KOM A;  3RL7 A;  2KA9 A;  2PZD A;  3TMH A;  3BPU A;  2M3M A;  3L4F D;  2CSJ A;  3STJ A;  4F8K A;  2H3M A;  1ZOK A;  1B8Q A;  3CC0 A;  1VAE A;  1X6D A;  2G2L A;  2JIL A;  2KBS A;  2I0L A;  1Q7X A;  2JIK A;  3AXA A;  2EEH A;  4YYX A;  1UEZ A;  1Z87 A;  3HVQ C;  5F3X A;  2MX6 A;  1FC7 A;  2I04 A;  1P1D A;  2L4S A;  4K76 A;  1RGW A;  4GHN A;  1V1T A;  4NMT A;  1X5R A;  1UJD A;  2KL1 A;  2PKU A; 
#chains in the Genus database with same CATH topology
 4Q2Q A;  1IU2 A;  3CYY A;  4MPA A;  1OBX A;  2D92 A;  2DAZ A;  3VQF A;  2QG1 A;  2JXO A;  2PNT A;  2HE2 A;  4HOP B;  4K75 A;  1L6O A;  2EGK A;  3GDS A;  1PDR A;  2DC2 A;  1WFV A;  1MFG A;  3DJ3 A;  2KJD A;  1QAV B;  4JOE A;  1BFE A;  2ZPL A;  3KDG A;  4N6X A;  2V90 A;  1TQ3 A;  2Q9V A;  1I16 A;  2EHR A;  1OBY A;  3VQG A;  1N7F A;  2I6V A;  4RI0 A;  3KDK A;  5HET A;  1W9Q A;  3GGE A;  3PS4 A;  2H2B A;  3KZD A;  5E22 A;  2OSG A;  3DJ1 A;  2F0A A;  1G9O A;  2WL7 A;  4KFW A;  4REY A;  2YT7 A;  1WH1 A;  3R69 A;  2EXG A;  5HJ1 A;  3SHW A;  1X5N A;  2AWX A;  4JOR A;  5HFE A;  5ILB A;  1R6J A;  4GVD A;  2HE4 A;  4NMR A;  2L97 A;  4K78 A;  4H11 A;  2OMJ A;  2M0T A;  4R2Z A;  4Q6H A;  4E35 A;  1OZI A;  2VWR A;  2OCS A;  3I1E A;  1V5L A;  2JSN A;  4O06 A;  3O5N A;  2EAQ A;  2YUB A;  1NTE A;  1SOZ A;  3I18 A;  3LNY A;  4NXQ A;  1UM7 A;  1WI2 A;  3GCN A;  1N6D A;  1UHP A;  4WYU A;  3OU0 A;  5H3J A;  1UJU A;  2KJK A;  2YTW A;  4JOK A;  2KAW A;  2VPH A;  3GCO A;  2YT8 A;  5HEB A;  1U38 A;  4LMM A;  1Y8T A;  4JOH A;  5E6P B;  1SOT A;  2M0V A;  4JL7 A;  1WIF A;  4Q2P A;  2KQF A;  2K20 A;  3EGG C;  3TSZ A;  2DKR A;  2AWU A;  1WFG A;  4NXR A;  1U37 A;  4JOP A;  1P1E A;  2M10 A;  1TE0 A;  1FCF A;  5HED A;  2REY A;  2PKT A;  1N6E A;  3B76 A;  2I0I A;  1X45 A;  3R0H A;  1TP3 A;  2JIN A;  2KJP A;  4NNM A;  2RCZ A;  3OTP A;  3WKL A;  1X9Z A;  4IC6 A;  1UFX A;  1Q3O A;  2EDV A;  2GEF A;  3QGL A;  4Q2O A;  4GVC A;  4OAJ A;  2OQS A;  2ENO A;  1N7T A;  1N7E A;  2DB5 A;  3CS0 A;  1U39 A;  2W4F A;  5HFC A;  2L4T A;  3MH7 A;  5G1D A;  2Q3G A;  4Q6S A;  1VA8 A;  1RGR A;  1IHJ A;  4UU5 A;  1N99 A;  3ID3 A;  3ID2 A;  3RL8 A;  2Z17 A;  2FNE A;  1GM1 A;  5EZ0 A;  5HFB A;  4NMQ A;  4Z8J A;  2M0Z A;  3ID4 A;  3KHF A;  1UEP A;  2KOH A;  2JWE A;  2VSP A;  3NCV A;  2HGA A;  4KFV A;  2KYL A;  3QIK A;  4JJ3 A;  2KRG A;  2FE5 A;  2JOA A;  5HDY A;  2LC6 A;  5HFD A;  1N6F A;  4UU6 A;  3RLE A;  3HPM A;  3K1R A;  3NFK A;  5DTH A;  4NMO A;  4P0C A;  2F5Y A;  4EDJ A;  1VCW A;  2E7K A;  4WYT A;  4JJ0 A;  3CBZ A;  4L8N A;  4PQW A;  1XZ9 A;  2EEJ A;  2LC7 A;  1W9O A;  5D13 A;  4P2A B;  1MC7 A;  2FCF A;  2K1Z A;  1GQ5 A;  1UF1 A;  1ZUB A;  2QKT A;  1IU0 A;  1UEQ A;  2OGP A;  5E11 A;  3E17 A;  2G5M B;  4NMV A;  2IWP A;  2QBW A;  3HPK A;  1QLC A;  2GZV A;  3SHU A;  3O46 A;  3CH8 A;  3K82 A;  2IWO A;  2LOB A;  4JOG A;  1WI4 A;  5HEY A;  1YBO A;  4JOF A;  3PV2 A;  4NNL A;  3JXT A;  4Z33 A;  4K72 A;  1D5G A;  1VB7 A;  3PDZ A;  1QAU A;  2H3L A;  3NGH A;  2FN5 A;  5GND A;  3QJN A;  2Z9I A;  1RZX A;  5EYZ A;  1QAV A;  5HF4 A;  2CSS A;  1X5Q A;  3PDV A;  1V6B A;  3QDO A;  2M0U A;  1OBZ A;  2EJY A;  3WKM A;  1Z86 A;  2O2T A;  2I1N A;  2DLS A;  1V62 A;  2KOJ A;  4FLN A;  1TP5 A;  3KZE A;  2JRE A;  3GDU A;  3FY5 A;  1UIT A;  1U3B A;  5E21 A;  2KPL A;  2R4H A;  5I7Z A;  2AWW A;  2AIN A;  2PA1 A;  1WHA A;  4Q3H A;  3QJM A;  4OEO A;  5F67 A;  5HF1 A;  3DJA A;  3TSW A;  4OEP A;  3ID1 A;  2DM8 A;  4NMP A;  2DLU A;  2KV8 A;  2YUY A;  3PV5 A;  1GQ4 A;  2UZC A;  2VRF A;  1UJV A;  3GJ9 A;  1V5Q A;  2QKV A;  2OPG A;  2X7Z A;  2VZ5 A;  1WG6 A;  2P3W A;  3QO6 A;  2IWQ A;  2KG2 A;  4E3B A;  2H2C A;  2VSV A;  2IWN A;  2EDZ A;  2I4S A;  5HFF A;  4NXP A;  5B6L A;  5G1E A;  5IL9 A;  2W7R A;  4G69 A;  1UM1 A;  1M5Z A;  1BE9 A;  3I4W A;  1Q3P A;  2D8I A;  1KY9 A;  3DOR A;  5A2P A;  1W9E A;  1RY4 A;  4XHV A;  2MHO A;  1WF7 A;  2ZPM A;  1K32 A;  2QT5 A;  2D90 A;  5FHT A;  3GSL A;  4Q2N A;  5GLJ A;  3SOE A;  3GDV A;  4E34 A;  1UEW A;  1WF8 A;  2EGO A;  4K6Y A;  2RRM A;  4FGM A;  2OZF A;  1MFL A;  1X8S A;  2CS5 A;  2LA8 A;  2EEG A;  1I92 A;  2OS6 A;  3QE1 A;  4AMH A;  3NFL A;  1VJ6 A;  3K50 A;  5JXB A;  3LNX A;  2PDZ A;  1FC6 A;  1KWA A;  1LCY A;  3TSV A;  2EDP A;  3R68 A;  3MH6 A;  3DIW A;  1NF3 C;  2EV8 A;  2R3Y A;  1WJL A;  3EGH C;  1T2M A;  2DJT A;  1WHD A;  2LUI A;  5FB8 C;  2DMZ A;  5E1Y A;  3CBX A;  2KPK A;  1KEF A;  2QKU A;  3MH4 A;  4HOP A;  2EGN A;  3PV4 A;  2BYG A;  3ZRT A;  3SUZ A;  4YDP A;  4JOJ A;  5B42 A;  3SFJ A;  3GAB A;  1Y7N A;  1FC9 A;  4NMS A;  2V1W A;  2EEI A;  3CBY A;  2KOM A;  3RL7 A;  2KA9 A;  2PZD A;  3TMH A;  3BPU A;  2M3M A;  3L4F D;  2CSJ A;  3STJ A;  4F8K A;  2H3M A;  1ZOK A;  1B8Q A;  3CC0 A;  1VAE A;  1X6D A;  2G2L A;  2JIL A;  2KBS A;  2I0L A;  1Q7X A;  2JIK A;  3AXA A;  2EEH A;  4YYX A;  1UEZ A;  1Z87 A;  3HVQ C;  5F3X A;  2MX6 A;  1FC7 A;  2I04 A;  1P1D A;  2L4S A;  4K76 A;  1RGW A;  4GHN A;  1V1T A;  4NMT A;  1X5R A;  1UJD A;  2KL1 A;  2PKU A; 
#chains in the Genus database with same CATH homology
 4Q2Q A;  1IU2 A;  3CYY A;  4MPA A;  1OBX A;  2D92 A;  2DAZ A;  3VQF A;  2QG1 A;  2JXO A;  2PNT A;  2HE2 A;  4HOP B;  4K75 A;  1L6O A;  2EGK A;  3GDS A;  1PDR A;  2DC2 A;  1WFV A;  1MFG A;  3DJ3 A;  2KJD A;  1QAV B;  4JOE A;  1BFE A;  2ZPL A;  3KDG A;  4N6X A;  2V90 A;  1TQ3 A;  2Q9V A;  1I16 A;  2EHR A;  1OBY A;  3VQG A;  1N7F A;  2I6V A;  4RI0 A;  3KDK A;  5HET A;  1W9Q A;  3GGE A;  3PS4 A;  2H2B A;  3KZD A;  5E22 A;  2OSG A;  3DJ1 A;  2F0A A;  1G9O A;  2WL7 A;  4KFW A;  4REY A;  2YT7 A;  1WH1 A;  3R69 A;  2EXG A;  5HJ1 A;  3SHW A;  1X5N A;  2AWX A;  4JOR A;  5HFE A;  5ILB A;  1R6J A;  4GVD A;  2HE4 A;  4NMR A;  2L97 A;  4K78 A;  4H11 A;  2OMJ A;  2M0T A;  4R2Z A;  4Q6H A;  4E35 A;  1OZI A;  2VWR A;  2OCS A;  3I1E A;  1V5L A;  2JSN A;  4O06 A;  3O5N A;  2EAQ A;  2YUB A;  1NTE A;  1SOZ A;  3I18 A;  3LNY A;  4NXQ A;  1UM7 A;  1WI2 A;  3GCN A;  1N6D A;  1UHP A;  4WYU A;  3OU0 A;  5H3J A;  1UJU A;  2KJK A;  2YTW A;  4JOK A;  2KAW A;  2VPH A;  3GCO A;  2YT8 A;  5HEB A;  1U38 A;  4LMM A;  1Y8T A;  4JOH A;  5E6P B;  1SOT A;  2M0V A;  4JL7 A;  1WIF A;  4Q2P A;  2KQF A;  2K20 A;  3EGG C;  3TSZ A;  2DKR A;  2AWU A;  1WFG A;  4NXR A;  1U37 A;  4JOP A;  1P1E A;  2M10 A;  1TE0 A;  1FCF A;  5HED A;  2REY A;  2PKT A;  1N6E A;  3B76 A;  2I0I A;  1X45 A;  3R0H A;  1TP3 A;  2JIN A;  2KJP A;  4NNM A;  2RCZ A;  3OTP A;  3WKL A;  1X9Z A;  4IC6 A;  1UFX A;  1Q3O A;  2EDV A;  2GEF A;  3QGL A;  4Q2O A;  4GVC A;  4OAJ A;  2OQS A;  2ENO A;  1N7T A;  1N7E A;  2DB5 A;  3CS0 A;  1U39 A;  2W4F A;  5HFC A;  2L4T A;  3MH7 A;  5G1D A;  2Q3G A;  4Q6S A;  1VA8 A;  1RGR A;  1IHJ A;  4UU5 A;  1N99 A;  3ID3 A;  3ID2 A;  3RL8 A;  2Z17 A;  2FNE A;  1GM1 A;  5EZ0 A;  5HFB A;  4NMQ A;  4Z8J A;  2M0Z A;  3ID4 A;  3KHF A;  1UEP A;  2KOH A;  2JWE A;  2VSP A;  3NCV A;  2HGA A;  4KFV A;  2KYL A;  3QIK A;  4JJ3 A;  2KRG A;  2FE5 A;  2JOA A;  5HDY A;  2LC6 A;  5HFD A;  1N6F A;  4UU6 A;  3RLE A;  3HPM A;  3K1R A;  3NFK A;  5DTH A;  4NMO A;  4P0C A;  2F5Y A;  4EDJ A;  1VCW A;  2E7K A;  4WYT A;  4JJ0 A;  3CBZ A;  4L8N A;  4PQW A;  1XZ9 A;  2EEJ A;  2LC7 A;  1W9O A;  5D13 A;  4P2A B;  1MC7 A;  2FCF A;  2K1Z A;  1GQ5 A;  1UF1 A;  1ZUB A;  2QKT A;  1IU0 A;  1UEQ A;  2OGP A;  5E11 A;  3E17 A;  2G5M B;  4NMV A;  2IWP A;  2QBW A;  3HPK A;  1QLC A;  2GZV A;  3SHU A;  3O46 A;  3CH8 A;  3K82 A;  2IWO A;  2LOB A;  4JOG A;  1WI4 A;  5HEY A;  1YBO A;  4JOF A;  3PV2 A;  4NNL A;  3JXT A;  4Z33 A;  4K72 A;  1D5G A;  1VB7 A;  3PDZ A;  1QAU A;  2H3L A;  3NGH A;  2FN5 A;  5GND A;  3QJN A;  2Z9I A;  1RZX A;  5EYZ A;  1QAV A;  5HF4 A;  2CSS A;  1X5Q A;  3PDV A;  1V6B A;  3QDO A;  2M0U A;  1OBZ A;  2EJY A;  3WKM A;  1Z86 A;  2O2T A;  2I1N A;  2DLS A;  1V62 A;  2KOJ A;  4FLN A;  1TP5 A;  3KZE A;  2JRE A;  3GDU A;  3FY5 A;  1UIT A;  1U3B A;  5E21 A;  2KPL A;  2R4H A;  5I7Z A;  2AWW A;  2AIN A;  2PA1 A;  1WHA A;  4Q3H A;  3QJM A;  4OEO A;  5F67 A;  5HF1 A;  3DJA A;  3TSW A;  4OEP A;  3ID1 A;  2DM8 A;  4NMP A;  2DLU A;  2KV8 A;  2YUY A;  3PV5 A;  1GQ4 A;  2UZC A;  2VRF A;  1UJV A;  3GJ9 A;  1V5Q A;  2QKV A;  2OPG A;  2X7Z A;  2VZ5 A;  1WG6 A;  2P3W A;  3QO6 A;  2IWQ A;  2KG2 A;  4E3B A;  2H2C A;  2VSV A;  2IWN A;  2EDZ A;  2I4S A;  5HFF A;  4NXP A;  5B6L A;  5G1E A;  5IL9 A;  2W7R A;  4G69 A;  1UM1 A;  1M5Z A;  1BE9 A;  3I4W A;  1Q3P A;  2D8I A;  1KY9 A;  3DOR A;  5A2P A;  1W9E A;  1RY4 A;  4XHV A;  2MHO A;  1WF7 A;  2ZPM A;  1K32 A;  2QT5 A;  2D90 A;  5FHT A;  3GSL A;  4Q2N A;  5GLJ A;  3SOE A;  3GDV A;  4E34 A;  1UEW A;  1WF8 A;  2EGO A;  4K6Y A;  2RRM A;  4FGM A;  2OZF A;  1MFL A;  1X8S A;  2CS5 A;  2LA8 A;  2EEG A;  1I92 A;  2OS6 A;  3QE1 A;  4AMH A;  3NFL A;  1VJ6 A;  3K50 A;  5JXB A;  3LNX A;  2PDZ A;  1FC6 A;  1KWA A;  1LCY A;  3TSV A;  2EDP A;  3R68 A;  3MH6 A;  3DIW A;  1NF3 C;  2EV8 A;  2R3Y A;  1WJL A;  3EGH C;  1T2M A;  2DJT A;  1WHD A;  2LUI A;  5FB8 C;  2DMZ A;  5E1Y A;  3CBX A;  2KPK A;  1KEF A;  2QKU A;  3MH4 A;  4HOP A;  2EGN A;  3PV4 A;  2BYG A;  3ZRT A;  3SUZ A;  4YDP A;  4JOJ A;  5B42 A;  3SFJ A;  3GAB A;  1Y7N A;  1FC9 A;  4NMS A;  2V1W A;  2EEI A;  3CBY A;  2KOM A;  3RL7 A;  2KA9 A;  2PZD A;  3TMH A;  3BPU A;  2M3M A;  3L4F D;  2CSJ A;  3STJ A;  4F8K A;  2H3M A;  1ZOK A;  1B8Q A;  3CC0 A;  1VAE A;  1X6D A;  2G2L A;  2JIL A;  2KBS A;  2I0L A;  1Q7X A;  2JIK A;  3AXA A;  2EEH A;  4YYX A;  1UEZ A;  1Z87 A;  3HVQ C;  5F3X A;  2MX6 A;  1FC7 A;  2I04 A;  1P1D A;  2L4S A;  4K76 A;  1RGW A;  4GHN A;  1V1T A;  4NMT A;  1X5R A;  1UJD A;  2KL1 A;  2PKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...