2DM8A

Solution structure of the eighth pdz domain of human inad-like protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
116
structure length
116
Chain Sequence
b'GSSGSSGPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein
publication title Solution structure of the eighth PDZ domain of human InaD-like protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2dm8A00
1TQ3A 5HF4A 2DM8A 1UJVA 3STJA 2VRFA 2G2LA 4NMRA 1WH1A 4NMSA 4WYTA 2KBSA 2FNEA 5E21A 1VJ6A 2PZDA 2UZCA 4P0CA 2EDZA 1WF7A 2QKTA 2KOMA 4KFWA 1P1EA 5F3XA 4JOFA 1NTEA 2R4HA 2EGNA 1D5GA 3TSWA 1V62A 1XZ9A 3SOEA 4NMQA 1Q7XA 4HOPA 2M0ZA 1TE0A 2EEGA 2WL7A 1Z87A 2VWRA 3B76A 4Q2QA 5JXBA 4NNLA 2I6VA 3CBYA 4UU6A 2YTWA 1Y8TA 2PA1A 2AWWA 1N7FA 3K50A 2LUIA 4K76A 3DIWA 4REYA 2OPGA 3HVQC 4P2AB 1VB7A 2QG1A 5FB8C 4G69A 4E35A 1FC6A 5HEBA 2CSSA 3K1RA 2DB5A 2R3YA 3DJ3A 2IWPA 2JWEA 2JILA 1N6EA 2LA8A 4H11A 2KG2A 5HFCA 1UJDA 3QO6A 3CH8A 3VQGA 3I18A 1I16A 3CBXA 1V5QA 4YYXA 2QT5A 1VAEA 1Y7NA 1RZXA 3CYYA 2VPHA 1U39A 5H3JA 1OZIA 1B8QA 1V6BA 4JORA 1WF8A 2EEIA 2EJYA 1X6DA 2M0UA 2VSPA 4Q3HA 5F67A 5G1EA 3QGLA 3EGGC 2I4SA 3PV4A 2D92A 4PQWA 2EEJA 1K32A 5HEDA 5HFFA 2L4TA 2ENOA 3SHUA 1WI4A 1GQ5A 2KJPA 1N6DA 1W9QA 2FE5A 2OS6A 5HFEA 3MH6A 3BPUA 3SUZA 1WIFA 2Q9VA 1OBXA 1L6OA 4E34A 2I1NA 2F0AA 3CC0A 2DAZA 1G9OA 3NGHA 2JOAA 3ID2A 5A2PA 5GLJA 2KRGA 3O46A 2QKUA 2I0LA 4IC6A 5HDYA 5G1DA 5E6PB 3I4WA 4GVCA 1FCFA 5D13A 3ID4A 1IHJA 3K82A 1IU0A 1ZUBA 3PS4A 4L8NA 2DLSA 1UEZA 5I7ZA 3PV2A 5GNDA 1QAVA 3ID1A 5HJ1A 2IWNA 3QJMA 4XHVA 3EGHC 4JOHA 2GZVA 2KYLA 1X45A 3AXAA 3GGEA 4K75A 2M0VA 2FN5A 1M5ZA 3DJAA 3KHFA 4AMHA 2LOBA 2KOJA 2H2BA 1RY4A 2I0IA 4NMPA 1PDRA 2FCFA 2M0TA 4JL7A 4K78A 1X5RA 2V90A 3QJNA 4KFVA 2DMZA 4NXPA 2RRMA 3LNYA 4E3BA 5E22A 2EDPA 3GJ9A 1X5NA 2E7KA 3E17A 2HGAA 3WKMA 5HFBA 3GDVA 2YUYA 1KY9A 1UM7A 3LNXA 4NMVA 1T2MA 2PKTA 1GM1A 2K20A 2YUBA 3O5NA 5E11A 5HF1A 2JIKA 1U37A 1WG6A 2EGKA 1WFGA 2LC7A 2Z17A 2KPLA 3QE1A 2Z9IA 2L97A 1U38A 3GSLA 4N6XA 5DTHA 3NFLA 4HOPB 5FHTA 1VCWA 2IWQA 2V1WA 1UFXA 3SHWA 4FGMA 3GDUA 2D90A 2MX6A 2KJKA 4Q6SA 4NMTA 1TP5A 1NF3C 1RGRA 2O2TA 2ZPMA 2QBWA 1X5QA 3RL7A 2G5MB 2I04A 4R2ZA 1UITA 3GCOA 1UJUA 1FC9A 4NXRA 4Q2OA 3PDZA 4OEPA 1N99A 2L4SA 2M10A 1I92A 2K1ZA 2DJTA 3NFKA 2KJDA 2DKRA 2PKUA 4O06A 5HFDA 5HEYA 3HPKA 3GDSA 1VA8A 2EDVA 1RGWA 2IWOA 3HPMA 5B6LA 1BFEA 1P1DA 3PV5A 4JOJA 4JOEA 3RL8A 3CBZA 4GVDA 2OMJA 2JINA 1X8SA 1UEWA 1WHDA 2PDZA 3FY5A 2KV8A 1MFGA 1ZOKA 2H3LA 1YBOA 2HE2A 4LMMA 2ZPLA 4NMOA 1BE9A 1Z86A 2JREA 2RCZA 3DORA 1W9EA 1WHAA 3MH4A 1WFVA 1MFLA 1OBYA 2D8IA 2P3WA 2KOHA 2HE4A 1UHPA 4JOKA 2EEHA 5EYZA 2EAQA 2Q3GA 3I1EA 2X7ZA 4Q6HA 4JOPA 1KWAA 1N6FA 1UF1A 2VZ5A 4OAJA 1GQ4A 1UM1A 1Q3OA 1WJLA 2KPKA 2W7RA 4Z33A 2BYGA 4UU5A 1TP3A 2EGOA 4YDPA 4EDJA 2LC6A 1FC7A 1V1TA 3R69A 2YT8A 3ZRTA 1IU2A 1KEFA 2YT7A 3OU0A 2KAWA 1UEQA 5HETA 2OZFA 3VQFA 4NNMA 1N7TA 2EHRA 3MH7A 1SOTA 4F8KA 2KQFA 1QAUA 2CSJA 1QLCA 1UEPA 1WI2A 2KA9A 2H3MA 3RLEA 1Q3PA 3R68A 2DLUA 4GHNA 2EV8A 4JOGA 3TSZA 3TSVA 2REYA 4K6YA 4WYUA 1MC7A 3TMHA 2KL1A 1V5LA 2OSGA 5E1YA 2DC2A 2W4FA 2AINA 3R0HA 1QAVB 2AWUA 4OEOA 3L4FD 2OGPA 3PDVA 2M3MA 5EZ0A 2PNTA 3KZDA 4Q2PA 3CS0A 2VSVA 4RI0A 1N7EA 1SOZA 1W9OA 2OQSA 1R6JA 3QIKA 3OTPA 4Z8JA 2F5YA 1U3BA 2EXGA 3QDOA 2QKVA 2MHOA 2CS5A 4NXQA 3SFJA 3WKLA 4K72A 2OCSA 3KZEA 2AWXA 2H2CA 4MPAA 1LCYA 4Q2NA 1OBZA 3DJ1A 3GCNA 2JXOA 3JXTA 3ID3A
chains in the Genus database with same CATH superfamily
1TQ3A 5HF4A 2DM8A 1UJVA 3STJA 2VRFA 2G2LA 4NMRA 1WH1A 4NMSA 4WYTA 2KBSA 2FNEA 5E21A 1VJ6A 2PZDA 2UZCA 4P0CA 2EDZA 1WF7A 2QKTA 2KOMA 4KFWA 1P1EA 5F3XA 4JOFA 1NTEA 2R4HA 2EGNA 1D5GA 3TSWA 1V62A 1XZ9A 3SOEA 4NMQA 1Q7XA 4HOPA 2M0ZA 1TE0A 2EEGA 2WL7A 1Z87A 2VWRA 3B76A 4Q2QA 5JXBA 4NNLA 2I6VA 3CBYA 4UU6A 2YTWA 1Y8TA 2PA1A 2AWWA 1N7FA 3K50A 2LUIA 4K76A 3DIWA 4REYA 2OPGA 3HVQC 4P2AB 1VB7A 2QG1A 5FB8C 4G69A 4E35A 1FC6A 5HEBA 2CSSA 3K1RA 2DB5A 2R3YA 3DJ3A 2IWPA 2JWEA 2JILA 1N6EA 2LA8A 4H11A 2KG2A 5HFCA 1UJDA 3QO6A 3CH8A 3VQGA 3I18A 1I16A 3CBXA 1V5QA 4YYXA 2QT5A 1VAEA 1Y7NA 1RZXA 3CYYA 2VPHA 1U39A 5H3JA 1OZIA 1B8QA 1V6BA 4JORA 1WF8A 2EEIA 2EJYA 1X6DA 2M0UA 2VSPA 4Q3HA 5F67A 5G1EA 3QGLA 3EGGC 2I4SA 3PV4A 2D92A 4PQWA 2EEJA 1K32A 5HEDA 5HFFA 2L4TA 2ENOA 3SHUA 1WI4A 1GQ5A 2KJPA 1N6DA 1W9QA 2FE5A 2OS6A 5HFEA 3KDKA 3MH6A 3BPUA 3SUZA 1WIFA 2Q9VA 1OBXA 1L6OA 4E34A 2I1NA 2F0AA 3CC0A 2DAZA 1G9OA 3NGHA 2JOAA 3ID2A 5A2PA 5GLJA 2KRGA 3O46A 4FLNA 2QKUA 2I0LA 4IC6A 5HDYA 5G1DA 5E6PB 3I4WA 4GVCA 1FCFA 5D13A 3ID4A 1IHJA 3K82A 1IU0A 1ZUBA 3PS4A 4L8NA 2DLSA 1UEZA 5I7ZA 3PV2A 5GNDA 1QAVA 3ID1A 5HJ1A 2IWNA 3QJMA 3KDGA 4XHVA 3EGHC 4JOHA 2GZVA 2KYLA 1X45A 3AXAA 3GGEA 4K75A 2M0VA 2FN5A 1M5ZA 3DJAA 3KHFA 4AMHA 2LOBA 2KOJA 2H2BA 1RY4A 2I0IA 4NMPA 1PDRA 2FCFA 2M0TA 4JL7A 4K78A 1X5RA 2V90A 3QJNA 1X9ZA 4KFVA 2DMZA 4NXPA 2RRMA 3LNYA 4E3BA 5E22A 2EDPA 3GJ9A 1X5NA 2E7KA 3E17A 2HGAA 3WKMA 3NCVA 5HFBA 3GDVA 2YUYA 1KY9A 1UM7A 3LNXA 4NMVA 1T2MA 2PKTA 1GM1A 2K20A 2YUBA 3O5NA 5E11A 5HF1A 2JIKA 1U37A 1WG6A 2EGKA 1WFGA 2LC7A 2Z17A 2KPLA 3QE1A 2Z9IA 2L97A 1U38A 3GSLA 4N6XA 5DTHA 3NFLA 4HOPB 5FHTA 1VCWA 2IWQA 2GEFA 2V1WA 1UFXA 3SHWA 4FGMA 3GDUA 2D90A 2MX6A 2KJKA 4Q6SA 4NMTA 1TP5A 1NF3C 1RGRA 2O2TA 2ZPMA 2QBWA 1X5QA 3RL7A 2G5MB 2I04A 4R2ZA 1UITA 3GCOA 1UJUA 1FC9A 4NXRA 4Q2OA 3PDZA 4OEPA 1N99A 2L4SA 2M10A 1I92A 2K1ZA 3GABA 2DJTA 3NFKA 2KJDA 2DKRA 2PKUA 4O06A 5HFDA 5HEYA 3HPKA 3GDSA 1VA8A 2EDVA 1RGWA 2IWOA 3HPMA 5B6LA 1BFEA 1P1DA 3PV5A 4JOJA 4JOEA 3RL8A 3CBZA 4GVDA 2OMJA 2JINA 4JJ0A 1X8SA 1UEWA 1WHDA 2PDZA 3FY5A 2KV8A 4JJ3A 1MFGA 1ZOKA 2H3LA 1YBOA 2HE2A 4LMMA 2ZPLA 4NMOA 1BE9A 1Z86A 2JREA 2RCZA 3DORA 1W9EA 1WHAA 3MH4A 1WFVA 1MFLA 1OBYA 2D8IA 2P3WA 2KOHA 2HE4A 1UHPA 5B42A 4JOKA 2EEHA 5EYZA 2EAQA 2Q3GA 3I1EA 2X7ZA 4Q6HA 4JOPA 1KWAA 1N6FA 1UF1A 2VZ5A 4OAJA 1GQ4A 1UM1A 1Q3OA 1WJLA 2KPKA 2W7RA 4Z33A 2BYGA 4UU5A 1TP3A 2EGOA 4YDPA 4EDJA 2LC6A 1FC7A 1V1TA 3R69A 2YT8A 3ZRTA 1IU2A 1KEFA 2YT7A 3OU0A 2KAWA 1UEQA 5HETA 2OZFA 3VQFA 4NNMA 1N7TA 2EHRA 3MH7A 1SOTA 4F8KA 2KQFA 1QAUA 2CSJA 1QLCA 1UEPA 1WI2A 2KA9A 2H3MA 3RLEA 1Q3PA 3R68A 2DLUA 4GHNA 2EV8A 4JOGA 3TSZA 3TSVA 2REYA 4K6YA 4WYUA 1MC7A 3TMHA 2KL1A 1V5LA 2OSGA 5E1YA 2DC2A 2W4FA 2AINA 3R0HA 1QAVB 2AWUA 4OEOA 3L4FD 2OGPA 3PDVA 2M3MA 5EZ0A 5IL9A 2PNTA 2JSNA 3KZDA 4Q2PA 3CS0A 5ILBA 2VSVA 4RI0A 1N7EA 1SOZA 1W9OA 2OQSA 1R6JA 3QIKA 3OTPA 4Z8JA 2F5YA 1U3BA 2EXGA 3QDOA 2QKVA 2MHOA 2CS5A 4NXQA 3SFJA 3WKLA 4K72A 2OCSA 3KZEA 2AWXA 2H2CA 4MPAA 1LCYA 4Q2NA 1OBZA 3DJ1A 3GCNA 2JXOA 3JXTA 3ID3A
chains in the Genus database with same CATH topology
1TQ3A 5HF4A 2DM8A 1UJVA 3STJA 2VRFA 2G2LA 4NMRA 1WH1A 4NMSA 4WYTA 2KBSA 2FNEA 5E21A 1VJ6A 2PZDA 2UZCA 4P0CA 2EDZA 1WF7A 2QKTA 2KOMA 4KFWA 1P1EA 5F3XA 4JOFA 1NTEA 2R4HA 2EGNA 1D5GA 3TSWA 1V62A 1XZ9A 3SOEA 4NMQA 1Q7XA 4HOPA 2M0ZA 1TE0A 2EEGA 2WL7A 1Z87A 2VWRA 3B76A 4Q2QA 5JXBA 4NNLA 2I6VA 3CBYA 4UU6A 2YTWA 1Y8TA 2PA1A 2AWWA 1N7FA 3K50A 2LUIA 4K76A 3DIWA 4REYA 2OPGA 3HVQC 4P2AB 1VB7A 2QG1A 5FB8C 4G69A 4E35A 1FC6A 5HEBA 2CSSA 3K1RA 2DB5A 2R3YA 3DJ3A 2IWPA 2JWEA 2JILA 1N6EA 2LA8A 4H11A 2KG2A 5HFCA 1UJDA 3QO6A 3CH8A 3VQGA 3I18A 1I16A 3CBXA 1V5QA 4YYXA 2QT5A 1VAEA 1Y7NA 1RZXA 3CYYA 2VPHA 1U39A 5H3JA 1OZIA 1B8QA 1V6BA 4JORA 1WF8A 2EEIA 2EJYA 1X6DA 2M0UA 2VSPA 4Q3HA 5F67A 5G1EA 3QGLA 3EGGC 2I4SA 3PV4A 2D92A 4PQWA 2EEJA 1K32A 5HEDA 5HFFA 2L4TA 2ENOA 3SHUA 1WI4A 1GQ5A 2KJPA 1N6DA 1W9QA 2FE5A 2OS6A 5HFEA 3KDKA 3MH6A 3BPUA 3SUZA 1WIFA 2Q9VA 1OBXA 1L6OA 4E34A 2I1NA 2F0AA 3CC0A 2DAZA 1G9OA 3NGHA 2JOAA 3ID2A 5A2PA 5GLJA 2KRGA 3O46A 4FLNA 2QKUA 2I0LA 4IC6A 5HDYA 5G1DA 5E6PB 3I4WA 4GVCA 1FCFA 5D13A 3ID4A 1IHJA 3K82A 1IU0A 1ZUBA 3PS4A 4L8NA 2DLSA 1UEZA 5I7ZA 3PV2A 5GNDA 1QAVA 3ID1A 5HJ1A 2IWNA 3QJMA 3KDGA 4XHVA 3EGHC 4JOHA 2GZVA 2KYLA 1X45A 3AXAA 3GGEA 4K75A 2M0VA 2FN5A 1M5ZA 3DJAA 3KHFA 4AMHA 2LOBA 2KOJA 2H2BA 1RY4A 2I0IA 4NMPA 1PDRA 2FCFA 2M0TA 4JL7A 4K78A 1X5RA 2V90A 3QJNA 1X9ZA 4KFVA 2DMZA 4NXPA 2RRMA 3LNYA 4E3BA 5E22A 2EDPA 3GJ9A 1X5NA 2E7KA 3E17A 2HGAA 3WKMA 3NCVA 5HFBA 3GDVA 2YUYA 1KY9A 1UM7A 3LNXA 4NMVA 1T2MA 2PKTA 1GM1A 2K20A 2YUBA 3O5NA 5E11A 5HF1A 2JIKA 1U37A 1WG6A 2EGKA 1WFGA 2LC7A 2Z17A 2KPLA 3QE1A 2Z9IA 2L97A 1U38A 3GSLA 4N6XA 5DTHA 3NFLA 4HOPB 5FHTA 1VCWA 2IWQA 2GEFA 2V1WA 1UFXA 3SHWA 4FGMA 3GDUA 2D90A 2MX6A 2KJKA 4Q6SA 4NMTA 1TP5A 1NF3C 1RGRA 2O2TA 2ZPMA 2QBWA 1X5QA 3RL7A 2G5MB 2I04A 4R2ZA 1UITA 3GCOA 1UJUA 1FC9A 4NXRA 4Q2OA 3PDZA 4OEPA 1N99A 2L4SA 2M10A 1I92A 2K1ZA 3GABA 2DJTA 3NFKA 2KJDA 2DKRA 2PKUA 4O06A 5HFDA 5HEYA 3HPKA 3GDSA 1VA8A 2EDVA 1RGWA 2IWOA 3HPMA 5B6LA 1BFEA 1P1DA 3PV5A 4JOJA 4JOEA 3RL8A 3CBZA 4GVDA 2OMJA 2JINA 4JJ0A 1X8SA 1UEWA 1WHDA 2PDZA 3FY5A 2KV8A 4JJ3A 1MFGA 1ZOKA 2H3LA 1YBOA 2HE2A 4LMMA 2ZPLA 4NMOA 1BE9A 1Z86A 2JREA 2RCZA 3DORA 1W9EA 1WHAA 3MH4A 1WFVA 1MFLA 1OBYA 2D8IA 2P3WA 2KOHA 2HE4A 1UHPA 5B42A 4JOKA 2EEHA 5EYZA 2EAQA 2Q3GA 3I1EA 2X7ZA 4Q6HA 4JOPA 1KWAA 1N6FA 1UF1A 2VZ5A 4OAJA 1GQ4A 1UM1A 1Q3OA 1WJLA 2KPKA 2W7RA 4Z33A 2BYGA 4UU5A 1TP3A 2EGOA 4YDPA 4EDJA 2LC6A 1FC7A 1V1TA 3R69A 2YT8A 3ZRTA 1IU2A 1KEFA 2YT7A 3OU0A 2KAWA 1UEQA 5HETA 2OZFA 3VQFA 4NNMA 1N7TA 2EHRA 3MH7A 1SOTA 4F8KA 2KQFA 1QAUA 2CSJA 1QLCA 1UEPA 1WI2A 2KA9A 2H3MA 3RLEA 1Q3PA 3R68A 2DLUA 4GHNA 2EV8A 4JOGA 3TSZA 3TSVA 2REYA 4K6YA 4WYUA 1MC7A 3TMHA 2KL1A 1V5LA 2OSGA 5E1YA 2DC2A 2W4FA 2AINA 3R0HA 1QAVB 2AWUA 4OEOA 3L4FD 2OGPA 3PDVA 2M3MA 5EZ0A 5IL9A 2PNTA 2JSNA 3KZDA 4Q2PA 3CS0A 5ILBA 2VSVA 4RI0A 1N7EA 1SOZA 1W9OA 2OQSA 1R6JA 3QIKA 3OTPA 4Z8JA 2F5YA 1U3BA 2EXGA 3QDOA 2QKVA 2MHOA 2CS5A 4NXQA 3SFJA 3WKLA 4K72A 2OCSA 3KZEA 2AWXA 2H2CA 4MPAA 1LCYA 4Q2NA 1OBZA 3DJ1A 3GCNA 2JXOA 3JXTA 3ID3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TQ3 A;  5HF4 A;  2DM8 A;  1UJV A;  3STJ A;  2VRF A;  2G2L A;  4NMR A;  1WH1 A;  4NMS A;  4WYT A;  2KBS A;  2FNE A;  5E21 A;  1VJ6 A;  2PZD A;  2UZC A;  4P0C A;  2EDZ A;  1WF7 A;  2QKT A;  2KOM A;  4KFW A;  1P1E A;  5F3X A;  4JOF A;  1NTE A;  2R4H A;  2EGN A;  1D5G A;  3TSW A;  1V62 A;  1XZ9 A;  3SOE A;  4NMQ A;  1Q7X A;  4HOP A;  2M0Z A;  1TE0 A;  2EEG A;  2WL7 A;  1Z87 A;  2VWR A;  3B76 A;  4Q2Q A;  5JXB A;  4NNL A;  2I6V A;  3CBY A;  4UU6 A;  2YTW A;  1Y8T A;  2PA1 A;  2AWW A;  1N7F A;  3K50 A;  2LUI A;  4K76 A;  3DIW A;  4REY A;  2OPG A;  3HVQ C;  4P2A B;  1VB7 A;  2QG1 A;  5FB8 C;  4G69 A;  4E35 A;  1FC6 A;  5HEB A;  2CSS A;  3K1R A;  2DB5 A;  2R3Y A;  3DJ3 A;  2IWP A;  2JWE A;  2JIL A;  1N6E A;  2LA8 A;  4H11 A;  2KG2 A;  5HFC A;  1UJD A;  3QO6 A;  3CH8 A;  3VQG A;  3I18 A;  1I16 A;  3CBX A;  1V5Q A;  4YYX A;  2QT5 A;  1VAE A;  1Y7N A;  1RZX A;  3CYY A;  2VPH A;  1U39 A;  5H3J A;  1OZI A;  1B8Q A;  1V6B A;  4JOR A;  1WF8 A;  2EEI A;  2EJY A;  1X6D A;  2M0U A;  2VSP A;  4Q3H A;  5F67 A;  5G1E A;  3QGL A;  3EGG C;  2I4S A;  3PV4 A;  2D92 A;  4PQW A;  2EEJ A;  1K32 A;  5HED A;  5HFF A;  2L4T A;  2ENO A;  3SHU A;  1WI4 A;  1GQ5 A;  2KJP A;  1N6D A;  1W9Q A;  2FE5 A;  2OS6 A;  5HFE A;  3MH6 A;  3BPU A;  3SUZ A;  1WIF A;  2Q9V A;  1OBX A;  1L6O A;  4E34 A;  2I1N A;  2F0A A;  3CC0 A;  2DAZ A;  1G9O A;  3NGH A;  2JOA A;  3ID2 A;  5A2P A;  5GLJ A;  2KRG A;  3O46 A;  2QKU A;  2I0L A;  4IC6 A;  5HDY A;  5G1D A;  5E6P B;  3I4W A;  4GVC A;  1FCF A;  5D13 A;  3ID4 A;  1IHJ A;  3K82 A;  1IU0 A;  1ZUB A;  3PS4 A;  4L8N A;  2DLS A;  1UEZ A;  5I7Z A;  3PV2 A;  5GND A;  1QAV A;  3ID1 A;  5HJ1 A;  2IWN A;  3QJM A;  4XHV A;  3EGH C;  4JOH A;  2GZV A;  2KYL A;  1X45 A;  3AXA A;  3GGE A;  4K75 A;  2M0V A;  2FN5 A;  1M5Z A;  3DJA A;  3KHF A;  4AMH A;  2LOB A;  2KOJ A;  2H2B A;  1RY4 A;  2I0I A;  4NMP A;  1PDR A;  2FCF A;  2M0T A;  4JL7 A;  4K78 A;  1X5R A;  2V90 A;  3QJN A;  4KFV A;  2DMZ A;  4NXP A;  2RRM A;  3LNY A;  4E3B A;  5E22 A;  2EDP A;  3GJ9 A;  1X5N A;  2E7K A;  3E17 A;  2HGA A;  3WKM A;  5HFB A;  3GDV A;  2YUY A;  1KY9 A;  1UM7 A;  3LNX A;  4NMV A;  1T2M A;  2PKT A;  1GM1 A;  2K20 A;  2YUB A;  3O5N A;  5E11 A;  5HF1 A;  2JIK A;  1U37 A;  1WG6 A;  2EGK A;  1WFG A;  2LC7 A;  2Z17 A;  2KPL A;  3QE1 A;  2Z9I A;  2L97 A;  1U38 A;  3GSL A;  4N6X A;  5DTH A;  3NFL A;  4HOP B;  5FHT A;  1VCW A;  2IWQ A;  2V1W A;  1UFX A;  3SHW A;  4FGM A;  3GDU A;  2D90 A;  2MX6 A;  2KJK A;  4Q6S A;  4NMT A;  1TP5 A;  1NF3 C;  1RGR A;  2O2T A;  2ZPM A;  2QBW A;  1X5Q A;  3RL7 A;  2G5M B;  2I04 A;  4R2Z A;  1UIT A;  3GCO A;  1UJU A;  1FC9 A;  4NXR A;  4Q2O A;  3PDZ A;  4OEP A;  1N99 A;  2L4S A;  2M10 A;  1I92 A;  2K1Z A;  2DJT A;  3NFK A;  2KJD A;  2DKR A;  2PKU A;  4O06 A;  5HFD A;  5HEY A;  3HPK A;  3GDS A;  1VA8 A;  2EDV A;  1RGW A;  2IWO A;  3HPM A;  5B6L A;  1BFE A;  1P1D A;  3PV5 A;  4JOJ A;  4JOE A;  3RL8 A;  3CBZ A;  4GVD A;  2OMJ A;  2JIN A;  1X8S A;  1UEW A;  1WHD A;  2PDZ A;  3FY5 A;  2KV8 A;  1MFG A;  1ZOK A;  2H3L A;  1YBO A;  2HE2 A;  4LMM A;  2ZPL A;  4NMO A;  1BE9 A;  1Z86 A;  2JRE A;  2RCZ A;  3DOR A;  1W9E A;  1WHA A;  3MH4 A;  1WFV A;  1MFL A;  1OBY A;  2D8I A;  2P3W A;  2KOH A;  2HE4 A;  1UHP A;  4JOK A;  2EEH A;  5EYZ A;  2EAQ A;  2Q3G A;  3I1E A;  2X7Z A;  4Q6H A;  4JOP A;  1KWA A;  1N6F A;  1UF1 A;  2VZ5 A;  4OAJ A;  1GQ4 A;  1UM1 A;  1Q3O A;  1WJL A;  2KPK A;  2W7R A;  4Z33 A;  2BYG A;  4UU5 A;  1TP3 A;  2EGO A;  4YDP A;  4EDJ A;  2LC6 A;  1FC7 A;  1V1T A;  3R69 A;  2YT8 A;  3ZRT A;  1IU2 A;  1KEF A;  2YT7 A;  3OU0 A;  2KAW A;  1UEQ A;  5HET A;  2OZF A;  3VQF A;  4NNM A;  1N7T A;  2EHR A;  3MH7 A;  1SOT A;  4F8K A;  2KQF A;  1QAU A;  2CSJ A;  1QLC A;  1UEP A;  1WI2 A;  2KA9 A;  2H3M A;  3RLE A;  1Q3P A;  3R68 A;  2DLU A;  4GHN A;  2EV8 A;  4JOG A;  3TSZ A;  3TSV A;  2REY A;  4K6Y A;  4WYU A;  1MC7 A;  3TMH A;  2KL1 A;  1V5L A;  2OSG A;  5E1Y A;  2DC2 A;  2W4F A;  2AIN A;  3R0H A;  1QAV B;  2AWU A;  4OEO A;  3L4F D;  2OGP A;  3PDV A;  2M3M A;  5EZ0 A;  2PNT A;  3KZD A;  4Q2P A;  3CS0 A;  2VSV A;  4RI0 A;  1N7E A;  1SOZ A;  1W9O A;  2OQS A;  1R6J A;  3QIK A;  3OTP A;  4Z8J A;  2F5Y A;  1U3B A;  2EXG A;  3QDO A;  2QKV A;  2MHO A;  2CS5 A;  4NXQ A;  3SFJ A;  3WKL A;  4K72 A;  2OCS A;  3KZE A;  2AWX A;  2H2C A;  4MPA A;  1LCY A;  4Q2N A;  1OBZ A;  3DJ1 A;  3GCN A;  2JXO A;  3JXT A;  3ID3 A; 
#chains in the Genus database with same CATH topology
 1TQ3 A;  5HF4 A;  2DM8 A;  1UJV A;  3STJ A;  2VRF A;  2G2L A;  4NMR A;  1WH1 A;  4NMS A;  4WYT A;  2KBS A;  2FNE A;  5E21 A;  1VJ6 A;  2PZD A;  2UZC A;  4P0C A;  2EDZ A;  1WF7 A;  2QKT A;  2KOM A;  4KFW A;  1P1E A;  5F3X A;  4JOF A;  1NTE A;  2R4H A;  2EGN A;  1D5G A;  3TSW A;  1V62 A;  1XZ9 A;  3SOE A;  4NMQ A;  1Q7X A;  4HOP A;  2M0Z A;  1TE0 A;  2EEG A;  2WL7 A;  1Z87 A;  2VWR A;  3B76 A;  4Q2Q A;  5JXB A;  4NNL A;  2I6V A;  3CBY A;  4UU6 A;  2YTW A;  1Y8T A;  2PA1 A;  2AWW A;  1N7F A;  3K50 A;  2LUI A;  4K76 A;  3DIW A;  4REY A;  2OPG A;  3HVQ C;  4P2A B;  1VB7 A;  2QG1 A;  5FB8 C;  4G69 A;  4E35 A;  1FC6 A;  5HEB A;  2CSS A;  3K1R A;  2DB5 A;  2R3Y A;  3DJ3 A;  2IWP A;  2JWE A;  2JIL A;  1N6E A;  2LA8 A;  4H11 A;  2KG2 A;  5HFC A;  1UJD A;  3QO6 A;  3CH8 A;  3VQG A;  3I18 A;  1I16 A;  3CBX A;  1V5Q A;  4YYX A;  2QT5 A;  1VAE A;  1Y7N A;  1RZX A;  3CYY A;  2VPH A;  1U39 A;  5H3J A;  1OZI A;  1B8Q A;  1V6B A;  4JOR A;  1WF8 A;  2EEI A;  2EJY A;  1X6D A;  2M0U A;  2VSP A;  4Q3H A;  5F67 A;  5G1E A;  3QGL A;  3EGG C;  2I4S A;  3PV4 A;  2D92 A;  4PQW A;  2EEJ A;  1K32 A;  5HED A;  5HFF A;  2L4T A;  2ENO A;  3SHU A;  1WI4 A;  1GQ5 A;  2KJP A;  1N6D A;  1W9Q A;  2FE5 A;  2OS6 A;  5HFE A;  3KDK A;  3MH6 A;  3BPU A;  3SUZ A;  1WIF A;  2Q9V A;  1OBX A;  1L6O A;  4E34 A;  2I1N A;  2F0A A;  3CC0 A;  2DAZ A;  1G9O A;  3NGH A;  2JOA A;  3ID2 A;  5A2P A;  5GLJ A;  2KRG A;  3O46 A;  4FLN A;  2QKU A;  2I0L A;  4IC6 A;  5HDY A;  5G1D A;  5E6P B;  3I4W A;  4GVC A;  1FCF A;  5D13 A;  3ID4 A;  1IHJ A;  3K82 A;  1IU0 A;  1ZUB A;  3PS4 A;  4L8N A;  2DLS A;  1UEZ A;  5I7Z A;  3PV2 A;  5GND A;  1QAV A;  3ID1 A;  5HJ1 A;  2IWN A;  3QJM A;  3KDG A;  4XHV A;  3EGH C;  4JOH A;  2GZV A;  2KYL A;  1X45 A;  3AXA A;  3GGE A;  4K75 A;  2M0V A;  2FN5 A;  1M5Z A;  3DJA A;  3KHF A;  4AMH A;  2LOB A;  2KOJ A;  2H2B A;  1RY4 A;  2I0I A;  4NMP A;  1PDR A;  2FCF A;  2M0T A;  4JL7 A;  4K78 A;  1X5R A;  2V90 A;  3QJN A;  1X9Z A;  4KFV A;  2DMZ A;  4NXP A;  2RRM A;  3LNY A;  4E3B A;  5E22 A;  2EDP A;  3GJ9 A;  1X5N A;  2E7K A;  3E17 A;  2HGA A;  3WKM A;  3NCV A;  5HFB A;  3GDV A;  2YUY A;  1KY9 A;  1UM7 A;  3LNX A;  4NMV A;  1T2M A;  2PKT A;  1GM1 A;  2K20 A;  2YUB A;  3O5N A;  5E11 A;  5HF1 A;  2JIK A;  1U37 A;  1WG6 A;  2EGK A;  1WFG A;  2LC7 A;  2Z17 A;  2KPL A;  3QE1 A;  2Z9I A;  2L97 A;  1U38 A;  3GSL A;  4N6X A;  5DTH A;  3NFL A;  4HOP B;  5FHT A;  1VCW A;  2IWQ A;  2GEF A;  2V1W A;  1UFX A;  3SHW A;  4FGM A;  3GDU A;  2D90 A;  2MX6 A;  2KJK A;  4Q6S A;  4NMT A;  1TP5 A;  1NF3 C;  1RGR A;  2O2T A;  2ZPM A;  2QBW A;  1X5Q A;  3RL7 A;  2G5M B;  2I04 A;  4R2Z A;  1UIT A;  3GCO A;  1UJU A;  1FC9 A;  4NXR A;  4Q2O A;  3PDZ A;  4OEP A;  1N99 A;  2L4S A;  2M10 A;  1I92 A;  2K1Z A;  3GAB A;  2DJT A;  3NFK A;  2KJD A;  2DKR A;  2PKU A;  4O06 A;  5HFD A;  5HEY A;  3HPK A;  3GDS A;  1VA8 A;  2EDV A;  1RGW A;  2IWO A;  3HPM A;  5B6L A;  1BFE A;  1P1D A;  3PV5 A;  4JOJ A;  4JOE A;  3RL8 A;  3CBZ A;  4GVD A;  2OMJ A;  2JIN A;  4JJ0 A;  1X8S A;  1UEW A;  1WHD A;  2PDZ A;  3FY5 A;  2KV8 A;  4JJ3 A;  1MFG A;  1ZOK A;  2H3L A;  1YBO A;  2HE2 A;  4LMM A;  2ZPL A;  4NMO A;  1BE9 A;  1Z86 A;  2JRE A;  2RCZ A;  3DOR A;  1W9E A;  1WHA A;  3MH4 A;  1WFV A;  1MFL A;  1OBY A;  2D8I A;  2P3W A;  2KOH A;  2HE4 A;  1UHP A;  5B42 A;  4JOK A;  2EEH A;  5EYZ A;  2EAQ A;  2Q3G A;  3I1E A;  2X7Z A;  4Q6H A;  4JOP A;  1KWA A;  1N6F A;  1UF1 A;  2VZ5 A;  4OAJ A;  1GQ4 A;  1UM1 A;  1Q3O A;  1WJL A;  2KPK A;  2W7R A;  4Z33 A;  2BYG A;  4UU5 A;  1TP3 A;  2EGO A;  4YDP A;  4EDJ A;  2LC6 A;  1FC7 A;  1V1T A;  3R69 A;  2YT8 A;  3ZRT A;  1IU2 A;  1KEF A;  2YT7 A;  3OU0 A;  2KAW A;  1UEQ A;  5HET A;  2OZF A;  3VQF A;  4NNM A;  1N7T A;  2EHR A;  3MH7 A;  1SOT A;  4F8K A;  2KQF A;  1QAU A;  2CSJ A;  1QLC A;  1UEP A;  1WI2 A;  2KA9 A;  2H3M A;  3RLE A;  1Q3P A;  3R68 A;  2DLU A;  4GHN A;  2EV8 A;  4JOG A;  3TSZ A;  3TSV A;  2REY A;  4K6Y A;  4WYU A;  1MC7 A;  3TMH A;  2KL1 A;  1V5L A;  2OSG A;  5E1Y A;  2DC2 A;  2W4F A;  2AIN A;  3R0H A;  1QAV B;  2AWU A;  4OEO A;  3L4F D;  2OGP A;  3PDV A;  2M3M A;  5EZ0 A;  5IL9 A;  2PNT A;  2JSN A;  3KZD A;  4Q2P A;  3CS0 A;  5ILB A;  2VSV A;  4RI0 A;  1N7E A;  1SOZ A;  1W9O A;  2OQS A;  1R6J A;  3QIK A;  3OTP A;  4Z8J A;  2F5Y A;  1U3B A;  2EXG A;  3QDO A;  2QKV A;  2MHO A;  2CS5 A;  4NXQ A;  3SFJ A;  3WKL A;  4K72 A;  2OCS A;  3KZE A;  2AWX A;  2H2C A;  4MPA A;  1LCY A;  4Q2N A;  1OBZ A;  3DJ1 A;  3GCN A;  2JXO A;  3JXT A;  3ID3 A; 
#chains in the Genus database with same CATH homology
 1TQ3 A;  5HF4 A;  2DM8 A;  1UJV A;  3STJ A;  2VRF A;  2G2L A;  4NMR A;  1WH1 A;  4NMS A;  4WYT A;  2KBS A;  2FNE A;  5E21 A;  1VJ6 A;  2PZD A;  2UZC A;  4P0C A;  2EDZ A;  1WF7 A;  2QKT A;  2KOM A;  4KFW A;  1P1E A;  5F3X A;  4JOF A;  1NTE A;  2R4H A;  2EGN A;  1D5G A;  3TSW A;  1V62 A;  1XZ9 A;  3SOE A;  4NMQ A;  1Q7X A;  4HOP A;  2M0Z A;  1TE0 A;  2EEG A;  2WL7 A;  1Z87 A;  2VWR A;  3B76 A;  4Q2Q A;  5JXB A;  4NNL A;  2I6V A;  3CBY A;  4UU6 A;  2YTW A;  1Y8T A;  2PA1 A;  2AWW A;  1N7F A;  3K50 A;  2LUI A;  4K76 A;  3DIW A;  4REY A;  2OPG A;  3HVQ C;  4P2A B;  1VB7 A;  2QG1 A;  5FB8 C;  4G69 A;  4E35 A;  1FC6 A;  5HEB A;  2CSS A;  3K1R A;  2DB5 A;  2R3Y A;  3DJ3 A;  2IWP A;  2JWE A;  2JIL A;  1N6E A;  2LA8 A;  4H11 A;  2KG2 A;  5HFC A;  1UJD A;  3QO6 A;  3CH8 A;  3VQG A;  3I18 A;  1I16 A;  3CBX A;  1V5Q A;  4YYX A;  2QT5 A;  1VAE A;  1Y7N A;  1RZX A;  3CYY A;  2VPH A;  1U39 A;  5H3J A;  1OZI A;  1B8Q A;  1V6B A;  4JOR A;  1WF8 A;  2EEI A;  2EJY A;  1X6D A;  2M0U A;  2VSP A;  4Q3H A;  5F67 A;  5G1E A;  3QGL A;  3EGG C;  2I4S A;  3PV4 A;  2D92 A;  4PQW A;  2EEJ A;  1K32 A;  5HED A;  5HFF A;  2L4T A;  2ENO A;  3SHU A;  1WI4 A;  1GQ5 A;  2KJP A;  1N6D A;  1W9Q A;  2FE5 A;  2OS6 A;  5HFE A;  3KDK A;  3MH6 A;  3BPU A;  3SUZ A;  1WIF A;  2Q9V A;  1OBX A;  1L6O A;  4E34 A;  2I1N A;  2F0A A;  3CC0 A;  2DAZ A;  1G9O A;  3NGH A;  2JOA A;  3ID2 A;  5A2P A;  5GLJ A;  2KRG A;  3O46 A;  4FLN A;  2QKU A;  2I0L A;  4IC6 A;  5HDY A;  5G1D A;  5E6P B;  3I4W A;  4GVC A;  1FCF A;  5D13 A;  3ID4 A;  1IHJ A;  3K82 A;  1IU0 A;  1ZUB A;  3PS4 A;  4L8N A;  2DLS A;  1UEZ A;  5I7Z A;  3PV2 A;  5GND A;  1QAV A;  3ID1 A;  5HJ1 A;  2IWN A;  3QJM A;  3KDG A;  4XHV A;  3EGH C;  4JOH A;  2GZV A;  2KYL A;  1X45 A;  3AXA A;  3GGE A;  4K75 A;  2M0V A;  2FN5 A;  1M5Z A;  3DJA A;  3KHF A;  4AMH A;  2LOB A;  2KOJ A;  2H2B A;  1RY4 A;  2I0I A;  4NMP A;  1PDR A;  2FCF A;  2M0T A;  4JL7 A;  4K78 A;  1X5R A;  2V90 A;  3QJN A;  1X9Z A;  4KFV A;  2DMZ A;  4NXP A;  2RRM A;  3LNY A;  4E3B A;  5E22 A;  2EDP A;  3GJ9 A;  1X5N A;  2E7K A;  3E17 A;  2HGA A;  3WKM A;  3NCV A;  5HFB A;  3GDV A;  2YUY A;  1KY9 A;  1UM7 A;  3LNX A;  4NMV A;  1T2M A;  2PKT A;  1GM1 A;  2K20 A;  2YUB A;  3O5N A;  5E11 A;  5HF1 A;  2JIK A;  1U37 A;  1WG6 A;  2EGK A;  1WFG A;  2LC7 A;  2Z17 A;  2KPL A;  3QE1 A;  2Z9I A;  2L97 A;  1U38 A;  3GSL A;  4N6X A;  5DTH A;  3NFL A;  4HOP B;  5FHT A;  1VCW A;  2IWQ A;  2GEF A;  2V1W A;  1UFX A;  3SHW A;  4FGM A;  3GDU A;  2D90 A;  2MX6 A;  2KJK A;  4Q6S A;  4NMT A;  1TP5 A;  1NF3 C;  1RGR A;  2O2T A;  2ZPM A;  2QBW A;  1X5Q A;  3RL7 A;  2G5M B;  2I04 A;  4R2Z A;  1UIT A;  3GCO A;  1UJU A;  1FC9 A;  4NXR A;  4Q2O A;  3PDZ A;  4OEP A;  1N99 A;  2L4S A;  2M10 A;  1I92 A;  2K1Z A;  3GAB A;  2DJT A;  3NFK A;  2KJD A;  2DKR A;  2PKU A;  4O06 A;  5HFD A;  5HEY A;  3HPK A;  3GDS A;  1VA8 A;  2EDV A;  1RGW A;  2IWO A;  3HPM A;  5B6L A;  1BFE A;  1P1D A;  3PV5 A;  4JOJ A;  4JOE A;  3RL8 A;  3CBZ A;  4GVD A;  2OMJ A;  2JIN A;  4JJ0 A;  1X8S A;  1UEW A;  1WHD A;  2PDZ A;  3FY5 A;  2KV8 A;  4JJ3 A;  1MFG A;  1ZOK A;  2H3L A;  1YBO A;  2HE2 A;  4LMM A;  2ZPL A;  4NMO A;  1BE9 A;  1Z86 A;  2JRE A;  2RCZ A;  3DOR A;  1W9E A;  1WHA A;  3MH4 A;  1WFV A;  1MFL A;  1OBY A;  2D8I A;  2P3W A;  2KOH A;  2HE4 A;  1UHP A;  5B42 A;  4JOK A;  2EEH A;  5EYZ A;  2EAQ A;  2Q3G A;  3I1E A;  2X7Z A;  4Q6H A;  4JOP A;  1KWA A;  1N6F A;  1UF1 A;  2VZ5 A;  4OAJ A;  1GQ4 A;  1UM1 A;  1Q3O A;  1WJL A;  2KPK A;  2W7R A;  4Z33 A;  2BYG A;  4UU5 A;  1TP3 A;  2EGO A;  4YDP A;  4EDJ A;  2LC6 A;  1FC7 A;  1V1T A;  3R69 A;  2YT8 A;  3ZRT A;  1IU2 A;  1KEF A;  2YT7 A;  3OU0 A;  2KAW A;  1UEQ A;  5HET A;  2OZF A;  3VQF A;  4NNM A;  1N7T A;  2EHR A;  3MH7 A;  1SOT A;  4F8K A;  2KQF A;  1QAU A;  2CSJ A;  1QLC A;  1UEP A;  1WI2 A;  2KA9 A;  2H3M A;  3RLE A;  1Q3P A;  3R68 A;  2DLU A;  4GHN A;  2EV8 A;  4JOG A;  3TSZ A;  3TSV A;  2REY A;  4K6Y A;  4WYU A;  1MC7 A;  3TMH A;  2KL1 A;  1V5L A;  2OSG A;  5E1Y A;  2DC2 A;  2W4F A;  2AIN A;  3R0H A;  1QAV B;  2AWU A;  4OEO A;  3L4F D;  2OGP A;  3PDV A;  2M3M A;  5EZ0 A;  5IL9 A;  2PNT A;  2JSN A;  3KZD A;  4Q2P A;  3CS0 A;  5ILB A;  2VSV A;  4RI0 A;  1N7E A;  1SOZ A;  1W9O A;  2OQS A;  1R6J A;  3QIK A;  3OTP A;  4Z8J A;  2F5Y A;  1U3B A;  2EXG A;  3QDO A;  2QKV A;  2MHO A;  2CS5 A;  4NXQ A;  3SFJ A;  3WKL A;  4K72 A;  2OCS A;  3KZE A;  2AWX A;  2H2C A;  4MPA A;  1LCY A;  4Q2N A;  1OBZ A;  3DJ1 A;  3GCN A;  2JXO A;  3JXT A;  3ID3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...