2DM8A

Solution structure of the eighth pdz domain of human inad-like protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
116
structure length
116
Chain Sequence
GSSGSSGPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords InaD-like protein
publication title Solution structure of the eighth PDZ domain of human InaD-like protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 10
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2dm8A00
1UJUA 1VA8A 1N7EA 2KJKA 2JOAA 3SHWA 2KJDA 4JOKA 3R68A 2D90A 2LC7A 2G5MB 4HOPB 1KWAA 3PV5A 5HEBA 3DJAA 1WF7A 3KZDA 1UEQA 4OAJA 3RLEA 4Q2OA 3PS4A 1FC7A 2EEGA 3FY5A 2AINA 2KOMA 2EEJA 1Q7XA 1QLCA 3STJA 5HFEA 1Q3PA 3MH7A 2EGKA 1UF1A 2V90A 3PV2A 3LNYA 2WL7A 2DB5A 3CYYA 1TQ3A 3NFLA 2RCZA 2PDZA 3GDSA 3SOEA 1UITA 2EXGA 4JL7A 2JWEA 2EJYA 2EEHA 4Q2NA 1P1EA 1IU0A 3HPKA 3TSWA 1VB7A 1WH1A 2KBSA 3TMHA 3B76A 2OS6A 2KAWA 4OEOA 4K78A 2R3YA 4GVCA 3KHFA 3NGHA 1GQ5A 1QAUA 1UEZA 1NTEA 1WJLA 3CC0A 2EDZA 2QG1A 1OZIA 1SOZA 1T2MA 2QT5A 4OEPA 5HFDA 1KY9A 2KJPA 3OU0A 3K50A 1N6FA 2I6VA 2IWOA 1WG6A 1MFGA 2M0UA 1X5RA 4WYTA 4NMVA 2O2TA 4JOHA 1V5LA 2QKUA 2LOBA 4NMTA 5E11A 3CH8A 2KOJA 3AXAA 1QAVA 3GDVA 4GHNA 5HJ1A 3QJMA 4E3BA 4E34A 3OTPA 2L4TA 2EDVA 3WKMA 2FNEA 3DJ3A 3JXTA 2IWNA 3RL8A 1IHJA 1OBXA 5EZ0A 3SFJA 1WHAA 2L4SA 3TSVA 2F0AA 1FC6A 4Z8JA 1X5QA 1LCYA 4JOGA 2KQFA 4RI0A 5G1EA 2DMZA 2R4HA 3LNXA 4NXRA 1UHPA 3VQGA 1D5GA 4FGMA 2I4SA 5HFFA 2RRMA 1B8QA 1X5NA 3GJ9A 4GVDA 2JXOA 1W9QA 5HDYA 2KRGA 4K75A 1NF3C 1UM7A 2AWXA 4NNMA 1VAEA 5HFCA 2AWUA 2DKRA 1VJ6A 1MC7A 1RY4A 5HEYA 2MHOA 3MH6A 2M0VA 1WI4A 1Z86A 1UEWA 2OSGA 3QGLA 1WF8A 5DTHA 3GDUA 4K6YA 2Z9IA 2DAZA 1UEPA 4K76A 2EHRA 2G2LA 2VPHA 1M5ZA 2YUBA 4O06A 3K82A 3L4FD 2OZFA 1UFXA 3QDOA 2EGNA 5HETA 2EV8A 2IWQA 1QAVB 4F8KA 3SUZA 4K72A 5FB8C 2OMJA 1Y7NA 3O46A 4JOJA 3PDZA 5JXBA 3R0HA 4P2AB 5G1DA 1V1TA 4Z33A 2VZ5A 3MH4A 4R2ZA 1TP5A 2L97A 2FE5A 3I1EA 1L6OA 2LC6A 2M3MA 4YDPA 2K20A 3NFKA 2CSJA 1N99A 1MFLA 5GNDA 3TSZA 4NNLA 1RGRA 5D13A 1VCWA 2I0LA 3HVQC 4NMOA 3I18A 1U39A 2PKTA 3CBXA 4Q2QA 1PDRA 2KYLA 2CSSA 1SOTA 1N7FA 5HF1A 2Q3GA 3WKLA 3SHUA 3ID1A 3I4WA 3KZEA 5A2PA 1TP3A 2F5YA 4NMQA 2OPGA 5HF4A 1U38A 3HPMA 1K32A 2EDPA 1Z87A 2PA1A 4KFVA 2REYA 2JINA 1X45A 3DORA 1TE0A 2ZPLA 2W7RA 1BFEA 1OBYA 2KOHA 2X7ZA 2KG2A 2EAQA 2P3WA 3QE1A 3QJNA 2HGAA 1FC9A 2JREA 1YBOA 2DM8A 2UZCA 4KFWA 2HE4A 2IWPA 1W9OA 1IU2A 4MPAA 2OCSA 2PKUA 2D92A 1GM1A 5E22A 3GCOA 2CS5A 3GGEA 4NXQA 1BE9A 1WFVA 3QO6A 5B6LA 4H11A 4NXPA 2K1ZA 2PNTA 1N6DA 4LMMA 1V62A 2EGOA 5F67A 2Z17A 2DJTA 3RL7A 1UM1A 4IC6A 2I0IA 2QKTA 5I7ZA 2OQSA 2H3MA 1OBZA 2FCFA 2M0TA 2H3LA 1FCFA 2KV8A 3EGHC 1X6DA 3VQFA 4NMPA 1WIFA 1RGWA 2ZPMA 1ZOKA 2ENOA 3CBZA 2VSPA 3BPUA 2JIKA 5H3JA 2KPKA 2MX6A 2QKVA 1W9EA 2LA8A 2YTWA 2LUIA 4G69A 1Q3OA 4UU5A 4L8NA 5F3XA 2VRFA 2E7KA 1KEFA 2I04A 3DIWA 4NMSA 2H2BA 4E35A 2D8IA 1I16A 1P1DA 4JOFA 1Y8TA 2EEIA 1V6BA 2H2CA 1WHDA 3ID2A 1U3BA 1RZXA 3E17A 4AMHA 2OGPA 2KA9A 2PZDA 4HOPA 4JOEA 5EYZA 1V5QA 3ID3A 2FN5A 2DLUA 3QIKA 4EDJA 2KL1A 2M10A 2M0ZA 3ZRTA 2HE2A 1UJDA 1WI2A 2DC2A 1N7TA 5HEDA 4WYUA 1XZ9A 2JILA 2VSVA 2YUYA 1ZUBA 4NMRA 2AWWA 5GLJA 1GQ4A 3GCNA 2DLSA 1I92A 4XHVA 3PV4A 4JOPA 1N6EA 3CBYA 4Q6HA 1X8SA 5E6PB 3PDVA 4P0CA 5FHTA 4UU6A 2GZVA 1U37A 4Q2PA 1UJVA 2QBWA 5E1YA 5HFBA 1G9OA 5E21A 4YYXA 3CS0A 3O5NA 2I1NA 2V1WA 2Q9VA 3R69A 2BYGA 3DJ1A 3EGGC 4PQWA 3K1RA 2YT8A 4Q3HA 4JORA 3ID4A 1WFGA 4Q6SA 2YT7A 2W4FA 2KPLA 4REYA 2VWRA 1R6JA 4N6XA 3GSLA
chains in the Genus database with same CATH superfamily
1UJUA 1VA8A 1N7EA 2KJKA 2JOAA 3SHWA 2KJDA 4JOKA 2GEFA 3R68A 2D90A 2LC7A 2G5MB 4HOPB 1KWAA 3PV5A 5HEBA 3DJAA 1WF7A 3KZDA 1UEQA 4OAJA 3RLEA 4Q2OA 3PS4A 1FC7A 2EEGA 3FY5A 2AINA 2KOMA 2EEJA 1Q7XA 1QLCA 3STJA 5HFEA 1Q3PA 3MH7A 2EGKA 1UF1A 2V90A 3PV2A 3LNYA 2WL7A 2DB5A 3CYYA 1TQ3A 3NFLA 2RCZA 2PDZA 3GDSA 3SOEA 1UITA 2EXGA 4JL7A 2JWEA 2EJYA 5ILBA 2EEHA 4Q2NA 1P1EA 1IU0A 3HPKA 3TSWA 1VB7A 1WH1A 2KBSA 3TMHA 3B76A 2OS6A 2KAWA 4OEOA 4K78A 2R3YA 4GVCA 3KHFA 3NGHA 1GQ5A 1QAUA 1UEZA 5B42A 1NTEA 1WJLA 3CC0A 2EDZA 2QG1A 1OZIA 1SOZA 1T2MA 2QT5A 4OEPA 5HFDA 1KY9A 2KJPA 3OU0A 3K50A 1N6FA 2I6VA 2IWOA 1WG6A 1MFGA 2M0UA 1X5RA 4WYTA 4NMVA 2O2TA 4JOHA 1V5LA 2QKUA 2LOBA 4NMTA 5E11A 3CH8A 2KOJA 3AXAA 1QAVA 3GDVA 4GHNA 5HJ1A 3QJMA 4E3BA 4E34A 3OTPA 2L4TA 2EDVA 3WKMA 2FNEA 3DJ3A 3JXTA 2IWNA 3RL8A 1IHJA 1OBXA 5EZ0A 3SFJA 1WHAA 2L4SA 3TSVA 2F0AA 1FC6A 4Z8JA 1X5QA 2JSNA 1LCYA 4JOGA 2KQFA 4JJ3A 4RI0A 5G1EA 2DMZA 2R4HA 3LNXA 4NXRA 1UHPA 3VQGA 1D5GA 4FGMA 2I4SA 5HFFA 2RRMA 1B8QA 1X5NA 3GJ9A 4GVDA 3KDGA 2JXOA 1W9QA 5HDYA 2KRGA 4K75A 1NF3C 1UM7A 2AWXA 4NNMA 1VAEA 5HFCA 2AWUA 2DKRA 1X9ZA 1VJ6A 1MC7A 1RY4A 5HEYA 2MHOA 3MH6A 2M0VA 1WI4A 1Z86A 1UEWA 2OSGA 3QGLA 1WF8A 3NCVA 5DTHA 3GDUA 4K6YA 2Z9IA 2DAZA 1UEPA 4K76A 2EHRA 2G2LA 2VPHA 1M5ZA 2YUBA 4O06A 3K82A 3L4FD 2OZFA 1UFXA 3QDOA 2EGNA 5HETA 2EV8A 2IWQA 1QAVB 4F8KA 3SUZA 4K72A 5FB8C 2OMJA 1Y7NA 3O46A 4JOJA 3PDZA 5JXBA 3R0HA 4P2AB 5G1DA 1V1TA 4Z33A 2VZ5A 3MH4A 4R2ZA 1TP5A 2L97A 2FE5A 3I1EA 1L6OA 2LC6A 2M3MA 4YDPA 2K20A 3NFKA 2CSJA 5IL9A 1N99A 1MFLA 5GNDA 3TSZA 4NNLA 1RGRA 5D13A 1VCWA 2I0LA 3HVQC 4NMOA 3I18A 1U39A 3KDKA 2PKTA 3CBXA 4Q2QA 1PDRA 2KYLA 2CSSA 1SOTA 1N7FA 5HF1A 2Q3GA 3WKLA 3SHUA 3ID1A 3I4WA 3KZEA 5A2PA 1TP3A 2F5YA 4NMQA 2OPGA 5HF4A 1U38A 3HPMA 1K32A 2EDPA 1Z87A 2PA1A 4KFVA 2REYA 2JINA 1X45A 3DORA 1TE0A 2ZPLA 2W7RA 1BFEA 1OBYA 2KOHA 2X7ZA 2KG2A 2EAQA 2P3WA 3QE1A 3QJNA 2HGAA 1FC9A 2JREA 1YBOA 2DM8A 2UZCA 4KFWA 2HE4A 2IWPA 1W9OA 1IU2A 4MPAA 2OCSA 2PKUA 2D92A 1GM1A 5E22A 3GCOA 2CS5A 3GGEA 4NXQA 1BE9A 1WFVA 3QO6A 5B6LA 4H11A 4NXPA 2K1ZA 2PNTA 1N6DA 4LMMA 1V62A 2EGOA 5F67A 2Z17A 2DJTA 3RL7A 4FLNA 1UM1A 4IC6A 2I0IA 2QKTA 5I7ZA 2OQSA 2H3MA 1OBZA 2FCFA 2M0TA 2H3LA 1FCFA 2KV8A 3EGHC 1X6DA 3VQFA 4NMPA 1WIFA 1RGWA 2ZPMA 1ZOKA 2ENOA 3CBZA 2VSPA 3BPUA 2JIKA 5H3JA 2KPKA 2MX6A 2QKVA 1W9EA 2LA8A 2YTWA 2LUIA 4G69A 1Q3OA 4UU5A 4L8NA 5F3XA 2VRFA 2E7KA 1KEFA 2I04A 3DIWA 4NMSA 2H2BA 4E35A 2D8IA 1I16A 1P1DA 4JOFA 1Y8TA 2EEIA 1V6BA 2H2CA 1WHDA 3ID2A 1U3BA 1RZXA 3GABA 3E17A 4AMHA 2OGPA 2KA9A 2PZDA 4HOPA 4JOEA 5EYZA 1V5QA 3ID3A 2FN5A 2DLUA 3QIKA 4EDJA 2KL1A 2M10A 2M0ZA 3ZRTA 2HE2A 1UJDA 1WI2A 2DC2A 1N7TA 5HEDA 4WYUA 1XZ9A 2JILA 2VSVA 2YUYA 1ZUBA 4NMRA 2AWWA 5GLJA 1GQ4A 3GCNA 2DLSA 1I92A 4XHVA 3PV4A 4JOPA 1N6EA 3CBYA 4Q6HA 1X8SA 5E6PB 3PDVA 4P0CA 5FHTA 4UU6A 2GZVA 1U37A 4Q2PA 1UJVA 2QBWA 5E1YA 5HFBA 1G9OA 5E21A 4YYXA 3CS0A 3O5NA 2I1NA 2V1WA 2Q9VA 3R69A 2BYGA 3DJ1A 3EGGC 4PQWA 3K1RA 2YT8A 4Q3HA 4JORA 3ID4A 1WFGA 4Q6SA 2YT7A 4JJ0A 2W4FA 2KPLA 4REYA 2VWRA 1R6JA 4N6XA 3GSLA
chains in the Genus database with same CATH topology
1UJUA 1VA8A 1N7EA 2KJKA 2JOAA 3SHWA 2KJDA 4JOKA 2GEFA 3R68A 2D90A 2LC7A 2G5MB 4HOPB 1KWAA 3PV5A 5HEBA 3DJAA 1WF7A 3KZDA 1UEQA 4OAJA 3RLEA 4Q2OA 3PS4A 1FC7A 2EEGA 3FY5A 2AINA 2KOMA 2EEJA 1Q7XA 1QLCA 3STJA 5HFEA 1Q3PA 3MH7A 2EGKA 1UF1A 2V90A 3PV2A 3LNYA 2WL7A 2DB5A 3CYYA 1TQ3A 3NFLA 2RCZA 2PDZA 3GDSA 3SOEA 1UITA 2EXGA 4JL7A 2JWEA 2EJYA 5ILBA 2EEHA 4Q2NA 1P1EA 1IU0A 3HPKA 3TSWA 1VB7A 1WH1A 2KBSA 3TMHA 3B76A 2OS6A 2KAWA 4OEOA 4K78A 2R3YA 4GVCA 3KHFA 3NGHA 1GQ5A 1QAUA 1UEZA 5B42A 1NTEA 1WJLA 3CC0A 2EDZA 2QG1A 1OZIA 1SOZA 1T2MA 2QT5A 4OEPA 5HFDA 1KY9A 2KJPA 3OU0A 3K50A 1N6FA 2I6VA 2IWOA 1WG6A 1MFGA 2M0UA 1X5RA 4WYTA 4NMVA 2O2TA 4JOHA 1V5LA 2QKUA 2LOBA 4NMTA 5E11A 3CH8A 2KOJA 3AXAA 1QAVA 3GDVA 4GHNA 5HJ1A 3QJMA 4E3BA 4E34A 3OTPA 2L4TA 2EDVA 3WKMA 2FNEA 3DJ3A 3JXTA 2IWNA 3RL8A 1IHJA 1OBXA 5EZ0A 3SFJA 1WHAA 2L4SA 3TSVA 2F0AA 1FC6A 4Z8JA 1X5QA 2JSNA 1LCYA 4JOGA 2KQFA 4JJ3A 4RI0A 5G1EA 2DMZA 2R4HA 3LNXA 4NXRA 1UHPA 3VQGA 1D5GA 4FGMA 2I4SA 5HFFA 2RRMA 1B8QA 1X5NA 3GJ9A 4GVDA 3KDGA 2JXOA 1W9QA 5HDYA 2KRGA 4K75A 1NF3C 1UM7A 2AWXA 4NNMA 1VAEA 5HFCA 2AWUA 2DKRA 1X9ZA 1VJ6A 1MC7A 1RY4A 5HEYA 2MHOA 3MH6A 2M0VA 1WI4A 1Z86A 1UEWA 2OSGA 3QGLA 1WF8A 3NCVA 5DTHA 3GDUA 4K6YA 2Z9IA 2DAZA 1UEPA 4K76A 2EHRA 2G2LA 2VPHA 1M5ZA 2YUBA 4O06A 3K82A 3L4FD 2OZFA 1UFXA 3QDOA 2EGNA 5HETA 2EV8A 2IWQA 1QAVB 4F8KA 3SUZA 4K72A 5FB8C 2OMJA 1Y7NA 3O46A 4JOJA 3PDZA 5JXBA 3R0HA 4P2AB 5G1DA 1V1TA 4Z33A 2VZ5A 3MH4A 4R2ZA 1TP5A 2L97A 2FE5A 3I1EA 1L6OA 2LC6A 2M3MA 4YDPA 2K20A 3NFKA 2CSJA 5IL9A 1N99A 1MFLA 5GNDA 3TSZA 4NNLA 1RGRA 5D13A 1VCWA 2I0LA 3HVQC 4NMOA 3I18A 1U39A 3KDKA 2PKTA 3CBXA 4Q2QA 1PDRA 2KYLA 2CSSA 1SOTA 1N7FA 5HF1A 2Q3GA 3WKLA 3SHUA 3ID1A 3I4WA 3KZEA 5A2PA 1TP3A 2F5YA 4NMQA 2OPGA 5HF4A 1U38A 3HPMA 1K32A 2EDPA 1Z87A 2PA1A 4KFVA 2REYA 2JINA 1X45A 3DORA 1TE0A 2ZPLA 2W7RA 1BFEA 1OBYA 2KOHA 2X7ZA 2KG2A 2EAQA 2P3WA 3QE1A 3QJNA 2HGAA 1FC9A 2JREA 1YBOA 2DM8A 2UZCA 4KFWA 2HE4A 2IWPA 1W9OA 1IU2A 4MPAA 2OCSA 2PKUA 2D92A 1GM1A 5E22A 3GCOA 2CS5A 3GGEA 4NXQA 1BE9A 1WFVA 3QO6A 5B6LA 4H11A 4NXPA 2K1ZA 2PNTA 1N6DA 4LMMA 1V62A 2EGOA 5F67A 2Z17A 2DJTA 3RL7A 4FLNA 1UM1A 4IC6A 2I0IA 2QKTA 5I7ZA 2OQSA 2H3MA 1OBZA 2FCFA 2M0TA 2H3LA 1FCFA 2KV8A 3EGHC 1X6DA 3VQFA 4NMPA 1WIFA 1RGWA 2ZPMA 1ZOKA 2ENOA 3CBZA 2VSPA 3BPUA 2JIKA 5H3JA 2KPKA 2MX6A 2QKVA 1W9EA 2LA8A 2YTWA 2LUIA 4G69A 1Q3OA 4UU5A 4L8NA 5F3XA 2VRFA 2E7KA 1KEFA 2I04A 3DIWA 4NMSA 2H2BA 4E35A 2D8IA 1I16A 1P1DA 4JOFA 1Y8TA 2EEIA 1V6BA 2H2CA 1WHDA 3ID2A 1U3BA 1RZXA 3GABA 3E17A 4AMHA 2OGPA 2KA9A 2PZDA 4HOPA 4JOEA 5EYZA 1V5QA 3ID3A 2FN5A 2DLUA 3QIKA 4EDJA 2KL1A 2M10A 2M0ZA 3ZRTA 2HE2A 1UJDA 1WI2A 2DC2A 1N7TA 5HEDA 4WYUA 1XZ9A 2JILA 2VSVA 2YUYA 1ZUBA 4NMRA 2AWWA 5GLJA 1GQ4A 3GCNA 2DLSA 1I92A 4XHVA 3PV4A 4JOPA 1N6EA 3CBYA 4Q6HA 1X8SA 5E6PB 3PDVA 4P0CA 5FHTA 4UU6A 2GZVA 1U37A 4Q2PA 1UJVA 2QBWA 5E1YA 5HFBA 1G9OA 5E21A 4YYXA 3CS0A 3O5NA 2I1NA 2V1WA 2Q9VA 3R69A 2BYGA 3DJ1A 3EGGC 4PQWA 3K1RA 2YT8A 4Q3HA 4JORA 3ID4A 1WFGA 4Q6SA 2YT7A 4JJ0A 2W4FA 2KPLA 4REYA 2VWRA 1R6JA 4N6XA 3GSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJU A;  1VA8 A;  1N7E A;  2KJK A;  2JOA A;  3SHW A;  2KJD A;  4JOK A;  3R68 A;  2D90 A;  2LC7 A;  2G5M B;  4HOP B;  1KWA A;  3PV5 A;  5HEB A;  3DJA A;  1WF7 A;  3KZD A;  1UEQ A;  4OAJ A;  3RLE A;  4Q2O A;  3PS4 A;  1FC7 A;  2EEG A;  3FY5 A;  2AIN A;  2KOM A;  2EEJ A;  1Q7X A;  1QLC A;  3STJ A;  5HFE A;  1Q3P A;  3MH7 A;  2EGK A;  1UF1 A;  2V90 A;  3PV2 A;  3LNY A;  2WL7 A;  2DB5 A;  3CYY A;  1TQ3 A;  3NFL A;  2RCZ A;  2PDZ A;  3GDS A;  3SOE A;  1UIT A;  2EXG A;  4JL7 A;  2JWE A;  2EJY A;  2EEH A;  4Q2N A;  1P1E A;  1IU0 A;  3HPK A;  3TSW A;  1VB7 A;  1WH1 A;  2KBS A;  3TMH A;  3B76 A;  2OS6 A;  2KAW A;  4OEO A;  4K78 A;  2R3Y A;  4GVC A;  3KHF A;  3NGH A;  1GQ5 A;  1QAU A;  1UEZ A;  1NTE A;  1WJL A;  3CC0 A;  2EDZ A;  2QG1 A;  1OZI A;  1SOZ A;  1T2M A;  2QT5 A;  4OEP A;  5HFD A;  1KY9 A;  2KJP A;  3OU0 A;  3K50 A;  1N6F A;  2I6V A;  2IWO A;  1WG6 A;  1MFG A;  2M0U A;  1X5R A;  4WYT A;  4NMV A;  2O2T A;  4JOH A;  1V5L A;  2QKU A;  2LOB A;  4NMT A;  5E11 A;  3CH8 A;  2KOJ A;  3AXA A;  1QAV A;  3GDV A;  4GHN A;  5HJ1 A;  3QJM A;  4E3B A;  4E34 A;  3OTP A;  2L4T A;  2EDV A;  3WKM A;  2FNE A;  3DJ3 A;  3JXT A;  2IWN A;  3RL8 A;  1IHJ A;  1OBX A;  5EZ0 A;  3SFJ A;  1WHA A;  2L4S A;  3TSV A;  2F0A A;  1FC6 A;  4Z8J A;  1X5Q A;  1LCY A;  4JOG A;  2KQF A;  4RI0 A;  5G1E A;  2DMZ A;  2R4H A;  3LNX A;  4NXR A;  1UHP A;  3VQG A;  1D5G A;  4FGM A;  2I4S A;  5HFF A;  2RRM A;  1B8Q A;  1X5N A;  3GJ9 A;  4GVD A;  2JXO A;  1W9Q A;  5HDY A;  2KRG A;  4K75 A;  1NF3 C;  1UM7 A;  2AWX A;  4NNM A;  1VAE A;  5HFC A;  2AWU A;  2DKR A;  1VJ6 A;  1MC7 A;  1RY4 A;  5HEY A;  2MHO A;  3MH6 A;  2M0V A;  1WI4 A;  1Z86 A;  1UEW A;  2OSG A;  3QGL A;  1WF8 A;  5DTH A;  3GDU A;  4K6Y A;  2Z9I A;  2DAZ A;  1UEP A;  4K76 A;  2EHR A;  2G2L A;  2VPH A;  1M5Z A;  2YUB A;  4O06 A;  3K82 A;  3L4F D;  2OZF A;  1UFX A;  3QDO A;  2EGN A;  5HET A;  2EV8 A;  2IWQ A;  1QAV B;  4F8K A;  3SUZ A;  4K72 A;  5FB8 C;  2OMJ A;  1Y7N A;  3O46 A;  4JOJ A;  3PDZ A;  5JXB A;  3R0H A;  4P2A B;  5G1D A;  1V1T A;  4Z33 A;  2VZ5 A;  3MH4 A;  4R2Z A;  1TP5 A;  2L97 A;  2FE5 A;  3I1E A;  1L6O A;  2LC6 A;  2M3M A;  4YDP A;  2K20 A;  3NFK A;  2CSJ A;  1N99 A;  1MFL A;  5GND A;  3TSZ A;  4NNL A;  1RGR A;  5D13 A;  1VCW A;  2I0L A;  3HVQ C;  4NMO A;  3I18 A;  1U39 A;  2PKT A;  3CBX A;  4Q2Q A;  1PDR A;  2KYL A;  2CSS A;  1SOT A;  1N7F A;  5HF1 A;  2Q3G A;  3WKL A;  3SHU A;  3ID1 A;  3I4W A;  3KZE A;  5A2P A;  1TP3 A;  2F5Y A;  4NMQ A;  2OPG A;  5HF4 A;  1U38 A;  3HPM A;  1K32 A;  2EDP A;  1Z87 A;  2PA1 A;  4KFV A;  2REY A;  2JIN A;  1X45 A;  3DOR A;  1TE0 A;  2ZPL A;  2W7R A;  1BFE A;  1OBY A;  2KOH A;  2X7Z A;  2KG2 A;  2EAQ A;  2P3W A;  3QE1 A;  3QJN A;  2HGA A;  1FC9 A;  2JRE A;  1YBO A;  2DM8 A;  2UZC A;  4KFW A;  2HE4 A;  2IWP A;  1W9O A;  1IU2 A;  4MPA A;  2OCS A;  2PKU A;  2D92 A;  1GM1 A;  5E22 A;  3GCO A;  2CS5 A;  3GGE A;  4NXQ A;  1BE9 A;  1WFV A;  3QO6 A;  5B6L A;  4H11 A;  4NXP A;  2K1Z A;  2PNT A;  1N6D A;  4LMM A;  1V62 A;  2EGO A;  5F67 A;  2Z17 A;  2DJT A;  3RL7 A;  1UM1 A;  4IC6 A;  2I0I A;  2QKT A;  5I7Z A;  2OQS A;  2H3M A;  1OBZ A;  2FCF A;  2M0T A;  2H3L A;  1FCF A;  2KV8 A;  3EGH C;  1X6D A;  3VQF A;  4NMP A;  1WIF A;  1RGW A;  2ZPM A;  1ZOK A;  2ENO A;  3CBZ A;  2VSP A;  3BPU A;  2JIK A;  5H3J A;  2KPK A;  2MX6 A;  2QKV A;  1W9E A;  2LA8 A;  2YTW A;  2LUI A;  4G69 A;  1Q3O A;  4UU5 A;  4L8N A;  5F3X A;  2VRF A;  2E7K A;  1KEF A;  2I04 A;  3DIW A;  4NMS A;  2H2B A;  4E35 A;  2D8I A;  1I16 A;  1P1D A;  4JOF A;  1Y8T A;  2EEI A;  1V6B A;  2H2C A;  1WHD A;  3ID2 A;  1U3B A;  1RZX A;  3E17 A;  4AMH A;  2OGP A;  2KA9 A;  2PZD A;  4HOP A;  4JOE A;  5EYZ A;  1V5Q A;  3ID3 A;  2FN5 A;  2DLU A;  3QIK A;  4EDJ A;  2KL1 A;  2M10 A;  2M0Z A;  3ZRT A;  2HE2 A;  1UJD A;  1WI2 A;  2DC2 A;  1N7T A;  5HED A;  4WYU A;  1XZ9 A;  2JIL A;  2VSV A;  2YUY A;  1ZUB A;  4NMR A;  2AWW A;  5GLJ A;  1GQ4 A;  3GCN A;  2DLS A;  1I92 A;  4XHV A;  3PV4 A;  4JOP A;  1N6E A;  3CBY A;  4Q6H A;  1X8S A;  5E6P B;  3PDV A;  4P0C A;  5FHT A;  4UU6 A;  2GZV A;  1U37 A;  4Q2P A;  1UJV A;  2QBW A;  5E1Y A;  5HFB A;  1G9O A;  5E21 A;  4YYX A;  3CS0 A;  3O5N A;  2I1N A;  2V1W A;  2Q9V A;  3R69 A;  2BYG A;  3DJ1 A;  3EGG C;  4PQW A;  3K1R A;  2YT8 A;  4Q3H A;  4JOR A;  3ID4 A;  1WFG A;  4Q6S A;  2YT7 A;  2W4F A;  2KPL A;  4REY A;  2VWR A;  1R6J A;  4N6X A;  3GSL A; 
#chains in the Genus database with same CATH topology
 1UJU A;  1VA8 A;  1N7E A;  2KJK A;  2JOA A;  3SHW A;  2KJD A;  4JOK A;  2GEF A;  3R68 A;  2D90 A;  2LC7 A;  2G5M B;  4HOP B;  1KWA A;  3PV5 A;  5HEB A;  3DJA A;  1WF7 A;  3KZD A;  1UEQ A;  4OAJ A;  3RLE A;  4Q2O A;  3PS4 A;  1FC7 A;  2EEG A;  3FY5 A;  2AIN A;  2KOM A;  2EEJ A;  1Q7X A;  1QLC A;  3STJ A;  5HFE A;  1Q3P A;  3MH7 A;  2EGK A;  1UF1 A;  2V90 A;  3PV2 A;  3LNY A;  2WL7 A;  2DB5 A;  3CYY A;  1TQ3 A;  3NFL A;  2RCZ A;  2PDZ A;  3GDS A;  3SOE A;  1UIT A;  2EXG A;  4JL7 A;  2JWE A;  2EJY A;  5ILB A;  2EEH A;  4Q2N A;  1P1E A;  1IU0 A;  3HPK A;  3TSW A;  1VB7 A;  1WH1 A;  2KBS A;  3TMH A;  3B76 A;  2OS6 A;  2KAW A;  4OEO A;  4K78 A;  2R3Y A;  4GVC A;  3KHF A;  3NGH A;  1GQ5 A;  1QAU A;  1UEZ A;  5B42 A;  1NTE A;  1WJL A;  3CC0 A;  2EDZ A;  2QG1 A;  1OZI A;  1SOZ A;  1T2M A;  2QT5 A;  4OEP A;  5HFD A;  1KY9 A;  2KJP A;  3OU0 A;  3K50 A;  1N6F A;  2I6V A;  2IWO A;  1WG6 A;  1MFG A;  2M0U A;  1X5R A;  4WYT A;  4NMV A;  2O2T A;  4JOH A;  1V5L A;  2QKU A;  2LOB A;  4NMT A;  5E11 A;  3CH8 A;  2KOJ A;  3AXA A;  1QAV A;  3GDV A;  4GHN A;  5HJ1 A;  3QJM A;  4E3B A;  4E34 A;  3OTP A;  2L4T A;  2EDV A;  3WKM A;  2FNE A;  3DJ3 A;  3JXT A;  2IWN A;  3RL8 A;  1IHJ A;  1OBX A;  5EZ0 A;  3SFJ A;  1WHA A;  2L4S A;  3TSV A;  2F0A A;  1FC6 A;  4Z8J A;  1X5Q A;  2JSN A;  1LCY A;  4JOG A;  2KQF A;  4JJ3 A;  4RI0 A;  5G1E A;  2DMZ A;  2R4H A;  3LNX A;  4NXR A;  1UHP A;  3VQG A;  1D5G A;  4FGM A;  2I4S A;  5HFF A;  2RRM A;  1B8Q A;  1X5N A;  3GJ9 A;  4GVD A;  3KDG A;  2JXO A;  1W9Q A;  5HDY A;  2KRG A;  4K75 A;  1NF3 C;  1UM7 A;  2AWX A;  4NNM A;  1VAE A;  5HFC A;  2AWU A;  2DKR A;  1X9Z A;  1VJ6 A;  1MC7 A;  1RY4 A;  5HEY A;  2MHO A;  3MH6 A;  2M0V A;  1WI4 A;  1Z86 A;  1UEW A;  2OSG A;  3QGL A;  1WF8 A;  3NCV A;  5DTH A;  3GDU A;  4K6Y A;  2Z9I A;  2DAZ A;  1UEP A;  4K76 A;  2EHR A;  2G2L A;  2VPH A;  1M5Z A;  2YUB A;  4O06 A;  3K82 A;  3L4F D;  2OZF A;  1UFX A;  3QDO A;  2EGN A;  5HET A;  2EV8 A;  2IWQ A;  1QAV B;  4F8K A;  3SUZ A;  4K72 A;  5FB8 C;  2OMJ A;  1Y7N A;  3O46 A;  4JOJ A;  3PDZ A;  5JXB A;  3R0H A;  4P2A B;  5G1D A;  1V1T A;  4Z33 A;  2VZ5 A;  3MH4 A;  4R2Z A;  1TP5 A;  2L97 A;  2FE5 A;  3I1E A;  1L6O A;  2LC6 A;  2M3M A;  4YDP A;  2K20 A;  3NFK A;  2CSJ A;  5IL9 A;  1N99 A;  1MFL A;  5GND A;  3TSZ A;  4NNL A;  1RGR A;  5D13 A;  1VCW A;  2I0L A;  3HVQ C;  4NMO A;  3I18 A;  1U39 A;  3KDK A;  2PKT A;  3CBX A;  4Q2Q A;  1PDR A;  2KYL A;  2CSS A;  1SOT A;  1N7F A;  5HF1 A;  2Q3G A;  3WKL A;  3SHU A;  3ID1 A;  3I4W A;  3KZE A;  5A2P A;  1TP3 A;  2F5Y A;  4NMQ A;  2OPG A;  5HF4 A;  1U38 A;  3HPM A;  1K32 A;  2EDP A;  1Z87 A;  2PA1 A;  4KFV A;  2REY A;  2JIN A;  1X45 A;  3DOR A;  1TE0 A;  2ZPL A;  2W7R A;  1BFE A;  1OBY A;  2KOH A;  2X7Z A;  2KG2 A;  2EAQ A;  2P3W A;  3QE1 A;  3QJN A;  2HGA A;  1FC9 A;  2JRE A;  1YBO A;  2DM8 A;  2UZC A;  4KFW A;  2HE4 A;  2IWP A;  1W9O A;  1IU2 A;  4MPA A;  2OCS A;  2PKU A;  2D92 A;  1GM1 A;  5E22 A;  3GCO A;  2CS5 A;  3GGE A;  4NXQ A;  1BE9 A;  1WFV A;  3QO6 A;  5B6L A;  4H11 A;  4NXP A;  2K1Z A;  2PNT A;  1N6D A;  4LMM A;  1V62 A;  2EGO A;  5F67 A;  2Z17 A;  2DJT A;  3RL7 A;  4FLN A;  1UM1 A;  4IC6 A;  2I0I A;  2QKT A;  5I7Z A;  2OQS A;  2H3M A;  1OBZ A;  2FCF A;  2M0T A;  2H3L A;  1FCF A;  2KV8 A;  3EGH C;  1X6D A;  3VQF A;  4NMP A;  1WIF A;  1RGW A;  2ZPM A;  1ZOK A;  2ENO A;  3CBZ A;  2VSP A;  3BPU A;  2JIK A;  5H3J A;  2KPK A;  2MX6 A;  2QKV A;  1W9E A;  2LA8 A;  2YTW A;  2LUI A;  4G69 A;  1Q3O A;  4UU5 A;  4L8N A;  5F3X A;  2VRF A;  2E7K A;  1KEF A;  2I04 A;  3DIW A;  4NMS A;  2H2B A;  4E35 A;  2D8I A;  1I16 A;  1P1D A;  4JOF A;  1Y8T A;  2EEI A;  1V6B A;  2H2C A;  1WHD A;  3ID2 A;  1U3B A;  1RZX A;  3GAB A;  3E17 A;  4AMH A;  2OGP A;  2KA9 A;  2PZD A;  4HOP A;  4JOE A;  5EYZ A;  1V5Q A;  3ID3 A;  2FN5 A;  2DLU A;  3QIK A;  4EDJ A;  2KL1 A;  2M10 A;  2M0Z A;  3ZRT A;  2HE2 A;  1UJD A;  1WI2 A;  2DC2 A;  1N7T A;  5HED A;  4WYU A;  1XZ9 A;  2JIL A;  2VSV A;  2YUY A;  1ZUB A;  4NMR A;  2AWW A;  5GLJ A;  1GQ4 A;  3GCN A;  2DLS A;  1I92 A;  4XHV A;  3PV4 A;  4JOP A;  1N6E A;  3CBY A;  4Q6H A;  1X8S A;  5E6P B;  3PDV A;  4P0C A;  5FHT A;  4UU6 A;  2GZV A;  1U37 A;  4Q2P A;  1UJV A;  2QBW A;  5E1Y A;  5HFB A;  1G9O A;  5E21 A;  4YYX A;  3CS0 A;  3O5N A;  2I1N A;  2V1W A;  2Q9V A;  3R69 A;  2BYG A;  3DJ1 A;  3EGG C;  4PQW A;  3K1R A;  2YT8 A;  4Q3H A;  4JOR A;  3ID4 A;  1WFG A;  4Q6S A;  2YT7 A;  4JJ0 A;  2W4F A;  2KPL A;  4REY A;  2VWR A;  1R6J A;  4N6X A;  3GSL A; 
#chains in the Genus database with same CATH homology
 1UJU A;  1VA8 A;  1N7E A;  2KJK A;  2JOA A;  3SHW A;  2KJD A;  4JOK A;  2GEF A;  3R68 A;  2D90 A;  2LC7 A;  2G5M B;  4HOP B;  1KWA A;  3PV5 A;  5HEB A;  3DJA A;  1WF7 A;  3KZD A;  1UEQ A;  4OAJ A;  3RLE A;  4Q2O A;  3PS4 A;  1FC7 A;  2EEG A;  3FY5 A;  2AIN A;  2KOM A;  2EEJ A;  1Q7X A;  1QLC A;  3STJ A;  5HFE A;  1Q3P A;  3MH7 A;  2EGK A;  1UF1 A;  2V90 A;  3PV2 A;  3LNY A;  2WL7 A;  2DB5 A;  3CYY A;  1TQ3 A;  3NFL A;  2RCZ A;  2PDZ A;  3GDS A;  3SOE A;  1UIT A;  2EXG A;  4JL7 A;  2JWE A;  2EJY A;  5ILB A;  2EEH A;  4Q2N A;  1P1E A;  1IU0 A;  3HPK A;  3TSW A;  1VB7 A;  1WH1 A;  2KBS A;  3TMH A;  3B76 A;  2OS6 A;  2KAW A;  4OEO A;  4K78 A;  2R3Y A;  4GVC A;  3KHF A;  3NGH A;  1GQ5 A;  1QAU A;  1UEZ A;  5B42 A;  1NTE A;  1WJL A;  3CC0 A;  2EDZ A;  2QG1 A;  1OZI A;  1SOZ A;  1T2M A;  2QT5 A;  4OEP A;  5HFD A;  1KY9 A;  2KJP A;  3OU0 A;  3K50 A;  1N6F A;  2I6V A;  2IWO A;  1WG6 A;  1MFG A;  2M0U A;  1X5R A;  4WYT A;  4NMV A;  2O2T A;  4JOH A;  1V5L A;  2QKU A;  2LOB A;  4NMT A;  5E11 A;  3CH8 A;  2KOJ A;  3AXA A;  1QAV A;  3GDV A;  4GHN A;  5HJ1 A;  3QJM A;  4E3B A;  4E34 A;  3OTP A;  2L4T A;  2EDV A;  3WKM A;  2FNE A;  3DJ3 A;  3JXT A;  2IWN A;  3RL8 A;  1IHJ A;  1OBX A;  5EZ0 A;  3SFJ A;  1WHA A;  2L4S A;  3TSV A;  2F0A A;  1FC6 A;  4Z8J A;  1X5Q A;  2JSN A;  1LCY A;  4JOG A;  2KQF A;  4JJ3 A;  4RI0 A;  5G1E A;  2DMZ A;  2R4H A;  3LNX A;  4NXR A;  1UHP A;  3VQG A;  1D5G A;  4FGM A;  2I4S A;  5HFF A;  2RRM A;  1B8Q A;  1X5N A;  3GJ9 A;  4GVD A;  3KDG A;  2JXO A;  1W9Q A;  5HDY A;  2KRG A;  4K75 A;  1NF3 C;  1UM7 A;  2AWX A;  4NNM A;  1VAE A;  5HFC A;  2AWU A;  2DKR A;  1X9Z A;  1VJ6 A;  1MC7 A;  1RY4 A;  5HEY A;  2MHO A;  3MH6 A;  2M0V A;  1WI4 A;  1Z86 A;  1UEW A;  2OSG A;  3QGL A;  1WF8 A;  3NCV A;  5DTH A;  3GDU A;  4K6Y A;  2Z9I A;  2DAZ A;  1UEP A;  4K76 A;  2EHR A;  2G2L A;  2VPH A;  1M5Z A;  2YUB A;  4O06 A;  3K82 A;  3L4F D;  2OZF A;  1UFX A;  3QDO A;  2EGN A;  5HET A;  2EV8 A;  2IWQ A;  1QAV B;  4F8K A;  3SUZ A;  4K72 A;  5FB8 C;  2OMJ A;  1Y7N A;  3O46 A;  4JOJ A;  3PDZ A;  5JXB A;  3R0H A;  4P2A B;  5G1D A;  1V1T A;  4Z33 A;  2VZ5 A;  3MH4 A;  4R2Z A;  1TP5 A;  2L97 A;  2FE5 A;  3I1E A;  1L6O A;  2LC6 A;  2M3M A;  4YDP A;  2K20 A;  3NFK A;  2CSJ A;  5IL9 A;  1N99 A;  1MFL A;  5GND A;  3TSZ A;  4NNL A;  1RGR A;  5D13 A;  1VCW A;  2I0L A;  3HVQ C;  4NMO A;  3I18 A;  1U39 A;  3KDK A;  2PKT A;  3CBX A;  4Q2Q A;  1PDR A;  2KYL A;  2CSS A;  1SOT A;  1N7F A;  5HF1 A;  2Q3G A;  3WKL A;  3SHU A;  3ID1 A;  3I4W A;  3KZE A;  5A2P A;  1TP3 A;  2F5Y A;  4NMQ A;  2OPG A;  5HF4 A;  1U38 A;  3HPM A;  1K32 A;  2EDP A;  1Z87 A;  2PA1 A;  4KFV A;  2REY A;  2JIN A;  1X45 A;  3DOR A;  1TE0 A;  2ZPL A;  2W7R A;  1BFE A;  1OBY A;  2KOH A;  2X7Z A;  2KG2 A;  2EAQ A;  2P3W A;  3QE1 A;  3QJN A;  2HGA A;  1FC9 A;  2JRE A;  1YBO A;  2DM8 A;  2UZC A;  4KFW A;  2HE4 A;  2IWP A;  1W9O A;  1IU2 A;  4MPA A;  2OCS A;  2PKU A;  2D92 A;  1GM1 A;  5E22 A;  3GCO A;  2CS5 A;  3GGE A;  4NXQ A;  1BE9 A;  1WFV A;  3QO6 A;  5B6L A;  4H11 A;  4NXP A;  2K1Z A;  2PNT A;  1N6D A;  4LMM A;  1V62 A;  2EGO A;  5F67 A;  2Z17 A;  2DJT A;  3RL7 A;  4FLN A;  1UM1 A;  4IC6 A;  2I0I A;  2QKT A;  5I7Z A;  2OQS A;  2H3M A;  1OBZ A;  2FCF A;  2M0T A;  2H3L A;  1FCF A;  2KV8 A;  3EGH C;  1X6D A;  3VQF A;  4NMP A;  1WIF A;  1RGW A;  2ZPM A;  1ZOK A;  2ENO A;  3CBZ A;  2VSP A;  3BPU A;  2JIK A;  5H3J A;  2KPK A;  2MX6 A;  2QKV A;  1W9E A;  2LA8 A;  2YTW A;  2LUI A;  4G69 A;  1Q3O A;  4UU5 A;  4L8N A;  5F3X A;  2VRF A;  2E7K A;  1KEF A;  2I04 A;  3DIW A;  4NMS A;  2H2B A;  4E35 A;  2D8I A;  1I16 A;  1P1D A;  4JOF A;  1Y8T A;  2EEI A;  1V6B A;  2H2C A;  1WHD A;  3ID2 A;  1U3B A;  1RZX A;  3GAB A;  3E17 A;  4AMH A;  2OGP A;  2KA9 A;  2PZD A;  4HOP A;  4JOE A;  5EYZ A;  1V5Q A;  3ID3 A;  2FN5 A;  2DLU A;  3QIK A;  4EDJ A;  2KL1 A;  2M10 A;  2M0Z A;  3ZRT A;  2HE2 A;  1UJD A;  1WI2 A;  2DC2 A;  1N7T A;  5HED A;  4WYU A;  1XZ9 A;  2JIL A;  2VSV A;  2YUY A;  1ZUB A;  4NMR A;  2AWW A;  5GLJ A;  1GQ4 A;  3GCN A;  2DLS A;  1I92 A;  4XHV A;  3PV4 A;  4JOP A;  1N6E A;  3CBY A;  4Q6H A;  1X8S A;  5E6P B;  3PDV A;  4P0C A;  5FHT A;  4UU6 A;  2GZV A;  1U37 A;  4Q2P A;  1UJV A;  2QBW A;  5E1Y A;  5HFB A;  1G9O A;  5E21 A;  4YYX A;  3CS0 A;  3O5N A;  2I1N A;  2V1W A;  2Q9V A;  3R69 A;  2BYG A;  3DJ1 A;  3EGG C;  4PQW A;  3K1R A;  2YT8 A;  4Q3H A;  4JOR A;  3ID4 A;  1WFG A;  4Q6S A;  2YT7 A;  4JJ0 A;  2W4F A;  2KPL A;  4REY A;  2VWR A;  1R6J A;  4N6X A;  3GSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...