3LNXA

Second pdz domain from human ptp1e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
94
Chain Sequence
b'PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 13
publication title Crystallographic and nuclear magnetic resonance evaluation of the impact of peptide binding to the second PDZ domain of protein tyrosine phosphatase 1E.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3lnxA00
2WL7A 1QLCA 2M0TA 1OBZA 1U38A 5HEDA 3WKLA 2Z17A 2I1NA 2EGKA 3DORA 1UEQA 2EJYA 1VCWA 4NMTA 5HF4A 3DJAA 3SOEA 2I0IA 2IWQA 5HDYA 2CS5A 5E11A 2REYA 2UZCA 3CYYA 2JXOA 3TMHA 2BYGA 2PKTA 3QJMA 3R68A 1WI4A 4GVDA 5G1DA 1VAEA 2RCZA 4WYTA 2E7KA 2QKVA 5HFBA 2QG1A 3EGGC 4Q6HA 2LA8A 1MFGA 2YT8A 2EEGA 2FN5A 2QKUA 1WH1A 2DB5A 4K76A 2OPGA 4NXPA 2V90A 2DAZA 1WI2A 2K1ZA 4HOPB 5E6PB 4N6XA 3GJ9A 2YUBA 1L6OA 3NFLA 3CS0A 3PDVA 2IWOA 1V5LA 2DJTA 4NMVA 5HFEA 1WJLA 3JXTA 1OBYA 1IHJA 1X45A 4G69A 1V1TA 1V62A 3BPUA 4WYUA 3K82A 3QJNA 2H2BA 2JIKA 1WFGA 1TQ3A 2L97A 1V6BA 5B6LA 1U3BA 2VSVA 1OBXA 5HEBA 1Q3PA 2QKTA 2L4SA 1UITA 5I7ZA 1Y7NA 1N99A 4GVCA 4Z8JA 1UHPA 2F0AA 2DC2A 4JOPA 1WFVA 3GCNA 2HE2A 1WIFA 2R4HA 1OZIA 3CC0A 3ID4A 1Z87A 1P1EA 3GDSA 2EDVA 3B76A 2KOMA 3DJ1A 5G1EA 4GHNA 2VZ5A 1YBOA 3GDUA 5GNDA 3KZDA 2O2TA 2HGAA 2KV8A 1N6EA 2VPHA 4NMPA 1PDRA 1WHDA 2MX6A 1X5NA 5HF1A 2PNTA 2G5MB 1N7TA 2EAQA 1KEFA 3R69A 2F5YA 2YTWA 3AXAA 2EEJA 3SHWA 5HJ1A 1QAVB 2KJKA 1UF1A 3I4WA 4JOGA 3DJ3A 3HPMA 2KRGA 3I1EA 3PV4A 1WHAA 2X7ZA 3EGHC 4NXRA 3DIWA 2IWNA 3PS4A 4NXQA 3I18A 4NMOA 4YDPA 4NMQA 2IWPA 5A2PA 1IU0A 2I0LA 4Q2PA 2KG2A 4NMRA 3RL8A 1WF7A 3R0HA 2M0VA 5E22A 2KJDA 2Q3GA 1W9QA 3MH6A 4JOJA 5HETA 4PQWA 1X8SA 3LNYA 1T2MA 3HPKA 2QT5A 3PV2A 1GQ4A 1G9OA 2JILA 1QAUA 2AINA 1RZXA 1Y8TA 2EEIA 2GZVA 2JREA 1WF8A 3KZEA 1RY4A 1X5RA 4AMHA 2LC7A 3ID1A 4Q2OA 1UEWA 2ENOA 2FCFA 2H2CA 1P1DA 5FHTA 1BE9A 1VJ6A 3CBYA 2M0UA 2W7RA 1W9OA 3HVQC 1UJDA 1UJVA 1XZ9A 4K72A 3QGLA 3SHUA 2KOJA 3MH4A 2EXGA 4P2AB 1KY9A 1UM7A 3O5NA 1FC7A 2OZFA 1ZOKA 3ZRTA 5JXBA 2OQSA 2DLSA 2M10A 2D8IA 1X5QA 1D5GA 1MFLA 1TP3A 2DKRA 4FGMA 1SOZA 1QAVA 2RRMA 3RL7A 2I4SA 4NMSA 2JOAA 3QE1A 1IU2A 1TE0A 5HEYA 4JL7A 2KBSA 4NNLA 1VA8A 4K6YA 3E17A 5GLJA 1U39A 2PDZA 4LMMA 1GM1A 4JOFA 3CH8A 2JINA 2VRFA 2OMJA 1I92A 1R6JA 2KL1A 3GGEA 1UJUA 2I6VA 2EGNA 4XHVA 2AWXA 3LNXA 4JOKA 3RLEA 2OCSA 1VB7A 1ZUBA 2DM8A 2KPKA 2R3YA 2PA1A 2OS6A 5D13A 5F67A 4Q6SA 2D90A 2Z9IA 3GDVA 4JOHA 2K20A 2AWWA 3OU0A 2W4FA 2M3MA 4HOPA 3MH7A 1Z86A 2KYLA 5F3XA 5DTHA 1BFEA 2LUIA 3TSZA 3L4FD 4YYXA 1NTEA 3QO6A 1FC9A 4KFVA 1N6DA 2FNEA 4KFWA 4NNMA 3CBXA 1M5ZA 3SFJA 5HFDA 3ID2A 1UEZA 1NF3C 5E1YA 2PKUA 2EGOA 2P3WA 4Q2QA 5HFCA 1GQ5A 2EDPA 4O06A 4P0CA 2G2LA 1MC7A 2EV8A 3ID3A 4OEPA 1SOTA 4RI0A 4OAJA 2ZPLA 4E3BA 2EDZA 1N7EA 3TSWA 2EHRA 2KAWA 3O46A 2KOHA 3K50A 2H3LA 4Q2NA 1TP5A 1UFXA 1UM1A 4F8KA 4Z33A 2CSSA 2I04A 1RGWA 2LOBA 4K75A 5H3JA 5HFFA 4H11A 4UU6A 4E35A 3VQFA 2Q9VA 2DMZA 4JORA 2KJPA 1U37A 1B8QA 3SUZA 1RGRA 2DLUA 3NGHA 3VQGA 1FC6A 1I16A 1W9EA 3FY5A 1FCFA 5EYZA 2V1WA 2VSPA 3PV5A 2YUYA 2KA9A 4OEOA 1X6DA 4UU5A 1WG6A 2ZPMA 3OTPA 4E34A 5E21A 3WKMA 2VWRA 1UEPA 2H3MA 4REYA 3STJA 1Q3OA 3QIKA 1N6FA 2JWEA 2OGPA 2PZDA 2KPLA 2L4TA 3PDZA 4K78A 2KQFA 3GCOA 3NFKA 2HE4A 3QDOA 1N7FA 3K1RA 2M0ZA 4EDJA 1LCYA 3TSVA 2FE5A 2QBWA 2OSGA 5EZ0A 1Q7XA 4Q3HA 4R2ZA 2CSJA 2EEHA 4IC6A 2AWUA 1K32A 3GSLA 1KWAA 3CBZA 1V5QA 2LC6A 4MPAA 5FB8C 2YT7A 2D92A 4JOEA 4L8NA 3KHFA 2MHOA
chains in the Genus database with same CATH superfamily
2WL7A 1QLCA 2M0TA 1OBZA 1U38A 5HEDA 3WKLA 2Z17A 2I1NA 2EGKA 3NCVA 3DORA 1UEQA 2EJYA 1VCWA 4NMTA 5HF4A 3DJAA 3SOEA 2I0IA 2IWQA 5HDYA 4JJ0A 2CS5A 5E11A 2REYA 2UZCA 3CYYA 2JXOA 3TMHA 2BYGA 2PKTA 3QJMA 3R68A 1WI4A 4GVDA 5G1DA 1VAEA 2RCZA 4WYTA 2E7KA 2QKVA 5HFBA 3GABA 2QG1A 3EGGC 4Q6HA 2LA8A 1MFGA 2YT8A 2EEGA 2FN5A 2QKUA 1WH1A 2DB5A 4K76A 2OPGA 4NXPA 2V90A 2DAZA 1WI2A 2K1ZA 4HOPB 5E6PB 4N6XA 3GJ9A 2YUBA 1L6OA 3NFLA 3CS0A 3PDVA 2IWOA 1V5LA 2DJTA 4NMVA 5HFEA 1WJLA 3JXTA 1OBYA 1IHJA 1X45A 4G69A 1V1TA 1V62A 3BPUA 4WYUA 3K82A 3QJNA 2H2BA 2JIKA 1WFGA 1TQ3A 2L97A 1V6BA 5B6LA 1U3BA 2VSVA 1OBXA 5HEBA 1Q3PA 2QKTA 2L4SA 1UITA 5I7ZA 1Y7NA 1N99A 4GVCA 4Z8JA 1UHPA 2F0AA 2DC2A 4JOPA 1WFVA 3GCNA 2HE2A 1WIFA 2R4HA 1OZIA 3CC0A 3KDKA 3ID4A 1Z87A 1P1EA 5ILBA 3GDSA 2EDVA 3B76A 2KOMA 3DJ1A 5G1EA 4GHNA 2VZ5A 1YBOA 3GDUA 5GNDA 3KZDA 2O2TA 2HGAA 2KV8A 1N6EA 2VPHA 5B42A 4NMPA 1PDRA 1WHDA 4JJ3A 2MX6A 1X5NA 5HF1A 2PNTA 2G5MB 1N7TA 2EAQA 1KEFA 3R69A 2F5YA 2YTWA 3AXAA 2EEJA 3SHWA 5HJ1A 1QAVB 2KJKA 1UF1A 3I4WA 4JOGA 3DJ3A 3HPMA 2KRGA 3I1EA 3PV4A 1WHAA 2X7ZA 3EGHC 4NXRA 3DIWA 2IWNA 3PS4A 4NXQA 3I18A 4NMOA 4YDPA 4NMQA 2IWPA 5A2PA 1IU0A 2I0LA 4Q2PA 2KG2A 4NMRA 3RL8A 1WF7A 3R0HA 2M0VA 5E22A 2KJDA 2Q3GA 1W9QA 3MH6A 4JOJA 5HETA 4PQWA 1X8SA 3LNYA 1T2MA 3HPKA 2QT5A 3PV2A 1GQ4A 1G9OA 2JILA 1QAUA 2AINA 1RZXA 1Y8TA 2EEIA 2GZVA 2JREA 1WF8A 3KZEA 1RY4A 1X5RA 4AMHA 2LC7A 3ID1A 4Q2OA 1UEWA 2ENOA 2FCFA 2H2CA 1P1DA 5FHTA 1BE9A 1VJ6A 3CBYA 2M0UA 2W7RA 1W9OA 3HVQC 1UJDA 1UJVA 1XZ9A 4K72A 3QGLA 3SHUA 2KOJA 3MH4A 2EXGA 4P2AB 1X9ZA 1KY9A 1UM7A 2GEFA 3O5NA 1FC7A 2OZFA 1ZOKA 3ZRTA 5JXBA 2OQSA 2DLSA 2M10A 2D8IA 1X5QA 1D5GA 1MFLA 1TP3A 2DKRA 4FGMA 1SOZA 1QAVA 2RRMA 3RL7A 2I4SA 4NMSA 2JOAA 3QE1A 1IU2A 1TE0A 5HEYA 4JL7A 2KBSA 4NNLA 1VA8A 4K6YA 3E17A 5GLJA 1U39A 2PDZA 4LMMA 1GM1A 4JOFA 3CH8A 2JINA 2VRFA 2OMJA 1I92A 1R6JA 2KL1A 3GGEA 1UJUA 2I6VA 2EGNA 4XHVA 2AWXA 3LNXA 4JOKA 3RLEA 2OCSA 1VB7A 1ZUBA 2DM8A 2KPKA 4FLNA 2R3YA 2PA1A 2OS6A 5D13A 5F67A 4Q6SA 2D90A 2Z9IA 3GDVA 4JOHA 2K20A 2AWWA 3OU0A 2W4FA 2M3MA 4HOPA 3MH7A 1Z86A 2KYLA 5F3XA 5DTHA 1BFEA 2LUIA 3TSZA 3L4FD 4YYXA 1NTEA 3QO6A 1FC9A 4KFVA 1N6DA 2FNEA 4KFWA 4NNMA 3CBXA 1M5ZA 3SFJA 5HFDA 3ID2A 1UEZA 1NF3C 5E1YA 2PKUA 2EGOA 2P3WA 4Q2QA 5HFCA 1GQ5A 2EDPA 4O06A 4P0CA 2G2LA 1MC7A 2EV8A 3ID3A 4OEPA 1SOTA 4RI0A 4OAJA 2ZPLA 4E3BA 2EDZA 1N7EA 3TSWA 2EHRA 2KAWA 3O46A 2KOHA 3K50A 2H3LA 4Q2NA 1TP5A 1UFXA 1UM1A 4F8KA 4Z33A 3KDGA 2CSSA 2I04A 1RGWA 2LOBA 4K75A 5H3JA 5HFFA 5IL9A 4H11A 4UU6A 4E35A 3VQFA 2Q9VA 2DMZA 4JORA 2KJPA 1U37A 1B8QA 3SUZA 1RGRA 2DLUA 3NGHA 3VQGA 1FC6A 1I16A 1W9EA 3FY5A 1FCFA 5EYZA 2V1WA 2VSPA 3PV5A 2YUYA 2KA9A 4OEOA 1X6DA 4UU5A 1WG6A 2ZPMA 3OTPA 4E34A 2JSNA 5E21A 3WKMA 2VWRA 1UEPA 2H3MA 4REYA 3STJA 1Q3OA 3QIKA 1N6FA 2JWEA 2OGPA 2PZDA 2KPLA 2L4TA 3PDZA 4K78A 2KQFA 3GCOA 3NFKA 2HE4A 3QDOA 1N7FA 3K1RA 2M0ZA 4EDJA 1LCYA 3TSVA 2FE5A 2QBWA 2OSGA 5EZ0A 1Q7XA 4Q3HA 4R2ZA 2CSJA 2EEHA 4IC6A 2AWUA 1K32A 3GSLA 1KWAA 3CBZA 1V5QA 2LC6A 4MPAA 5FB8C 2YT7A 2D92A 4JOEA 4L8NA 3KHFA 2MHOA
chains in the Genus database with same CATH topology
2WL7A 1QLCA 2M0TA 1OBZA 1U38A 5HEDA 3WKLA 2Z17A 2I1NA 2EGKA 3NCVA 3DORA 1UEQA 2EJYA 1VCWA 4NMTA 5HF4A 3DJAA 3SOEA 2I0IA 2IWQA 5HDYA 4JJ0A 2CS5A 5E11A 2REYA 2UZCA 3CYYA 2JXOA 3TMHA 2BYGA 2PKTA 3QJMA 3R68A 1WI4A 4GVDA 5G1DA 1VAEA 2RCZA 4WYTA 2E7KA 2QKVA 5HFBA 3GABA 2QG1A 3EGGC 4Q6HA 2LA8A 1MFGA 2YT8A 2EEGA 2FN5A 2QKUA 1WH1A 2DB5A 4K76A 2OPGA 4NXPA 2V90A 2DAZA 1WI2A 2K1ZA 4HOPB 5E6PB 4N6XA 3GJ9A 2YUBA 1L6OA 3NFLA 3CS0A 3PDVA 2IWOA 1V5LA 2DJTA 4NMVA 5HFEA 1WJLA 3JXTA 1OBYA 1IHJA 1X45A 4G69A 1V1TA 1V62A 3BPUA 4WYUA 3K82A 3QJNA 2H2BA 2JIKA 1WFGA 1TQ3A 2L97A 1V6BA 5B6LA 1U3BA 2VSVA 1OBXA 5HEBA 1Q3PA 2QKTA 2L4SA 1UITA 5I7ZA 1Y7NA 1N99A 4GVCA 4Z8JA 1UHPA 2F0AA 2DC2A 4JOPA 1WFVA 3GCNA 2HE2A 1WIFA 2R4HA 1OZIA 3CC0A 3KDKA 3ID4A 1Z87A 1P1EA 5ILBA 3GDSA 2EDVA 3B76A 2KOMA 3DJ1A 5G1EA 4GHNA 2VZ5A 1YBOA 3GDUA 5GNDA 3KZDA 2O2TA 2HGAA 2KV8A 1N6EA 2VPHA 5B42A 4NMPA 1PDRA 1WHDA 4JJ3A 2MX6A 1X5NA 5HF1A 2PNTA 2G5MB 1N7TA 2EAQA 1KEFA 3R69A 2F5YA 2YTWA 3AXAA 2EEJA 3SHWA 5HJ1A 1QAVB 2KJKA 1UF1A 3I4WA 4JOGA 3DJ3A 3HPMA 2KRGA 3I1EA 3PV4A 1WHAA 2X7ZA 3EGHC 4NXRA 3DIWA 2IWNA 3PS4A 4NXQA 3I18A 4NMOA 4YDPA 4NMQA 2IWPA 5A2PA 1IU0A 2I0LA 4Q2PA 2KG2A 4NMRA 3RL8A 1WF7A 3R0HA 2M0VA 5E22A 2KJDA 2Q3GA 1W9QA 3MH6A 4JOJA 5HETA 4PQWA 1X8SA 3LNYA 1T2MA 3HPKA 2QT5A 3PV2A 1GQ4A 1G9OA 2JILA 1QAUA 2AINA 1RZXA 1Y8TA 2EEIA 2GZVA 2JREA 1WF8A 3KZEA 1RY4A 1X5RA 4AMHA 2LC7A 3ID1A 4Q2OA 1UEWA 2ENOA 2FCFA 2H2CA 1P1DA 5FHTA 1BE9A 1VJ6A 3CBYA 2M0UA 2W7RA 1W9OA 3HVQC 1UJDA 1UJVA 1XZ9A 4K72A 3QGLA 3SHUA 2KOJA 3MH4A 2EXGA 4P2AB 1X9ZA 1KY9A 1UM7A 2GEFA 3O5NA 1FC7A 2OZFA 1ZOKA 3ZRTA 5JXBA 2OQSA 2DLSA 2M10A 2D8IA 1X5QA 1D5GA 1MFLA 1TP3A 2DKRA 4FGMA 1SOZA 1QAVA 2RRMA 3RL7A 2I4SA 4NMSA 2JOAA 3QE1A 1IU2A 1TE0A 5HEYA 4JL7A 2KBSA 4NNLA 1VA8A 4K6YA 3E17A 5GLJA 1U39A 2PDZA 4LMMA 1GM1A 4JOFA 3CH8A 2JINA 2VRFA 2OMJA 1I92A 1R6JA 2KL1A 3GGEA 1UJUA 2I6VA 2EGNA 4XHVA 2AWXA 3LNXA 4JOKA 3RLEA 2OCSA 1VB7A 1ZUBA 2DM8A 2KPKA 4FLNA 2R3YA 2PA1A 2OS6A 5D13A 5F67A 4Q6SA 2D90A 2Z9IA 3GDVA 4JOHA 2K20A 2AWWA 3OU0A 2W4FA 2M3MA 4HOPA 3MH7A 1Z86A 2KYLA 5F3XA 5DTHA 1BFEA 2LUIA 3TSZA 3L4FD 4YYXA 1NTEA 3QO6A 1FC9A 4KFVA 1N6DA 2FNEA 4KFWA 4NNMA 3CBXA 1M5ZA 3SFJA 5HFDA 3ID2A 1UEZA 1NF3C 5E1YA 2PKUA 2EGOA 2P3WA 4Q2QA 5HFCA 1GQ5A 2EDPA 4O06A 4P0CA 2G2LA 1MC7A 2EV8A 3ID3A 4OEPA 1SOTA 4RI0A 4OAJA 2ZPLA 4E3BA 2EDZA 1N7EA 3TSWA 2EHRA 2KAWA 3O46A 2KOHA 3K50A 2H3LA 4Q2NA 1TP5A 1UFXA 1UM1A 4F8KA 4Z33A 3KDGA 2CSSA 2I04A 1RGWA 2LOBA 4K75A 5H3JA 5HFFA 5IL9A 4H11A 4UU6A 4E35A 3VQFA 2Q9VA 2DMZA 4JORA 2KJPA 1U37A 1B8QA 3SUZA 1RGRA 2DLUA 3NGHA 3VQGA 1FC6A 1I16A 1W9EA 3FY5A 1FCFA 5EYZA 2V1WA 2VSPA 3PV5A 2YUYA 2KA9A 4OEOA 1X6DA 4UU5A 1WG6A 2ZPMA 3OTPA 4E34A 2JSNA 5E21A 3WKMA 2VWRA 1UEPA 2H3MA 4REYA 3STJA 1Q3OA 3QIKA 1N6FA 2JWEA 2OGPA 2PZDA 2KPLA 2L4TA 3PDZA 4K78A 2KQFA 3GCOA 3NFKA 2HE4A 3QDOA 1N7FA 3K1RA 2M0ZA 4EDJA 1LCYA 3TSVA 2FE5A 2QBWA 2OSGA 5EZ0A 1Q7XA 4Q3HA 4R2ZA 2CSJA 2EEHA 4IC6A 2AWUA 1K32A 3GSLA 1KWAA 3CBZA 1V5QA 2LC6A 4MPAA 5FB8C 2YT7A 2D92A 4JOEA 4L8NA 3KHFA 2MHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WL7 A;  1QLC A;  2M0T A;  1OBZ A;  1U38 A;  5HED A;  3WKL A;  2Z17 A;  2I1N A;  2EGK A;  3DOR A;  1UEQ A;  2EJY A;  1VCW A;  4NMT A;  5HF4 A;  3DJA A;  3SOE A;  2I0I A;  2IWQ A;  5HDY A;  2CS5 A;  5E11 A;  2REY A;  2UZC A;  3CYY A;  2JXO A;  3TMH A;  2BYG A;  2PKT A;  3QJM A;  3R68 A;  1WI4 A;  4GVD A;  5G1D A;  1VAE A;  2RCZ A;  4WYT A;  2E7K A;  2QKV A;  5HFB A;  2QG1 A;  3EGG C;  4Q6H A;  2LA8 A;  1MFG A;  2YT8 A;  2EEG A;  2FN5 A;  2QKU A;  1WH1 A;  2DB5 A;  4K76 A;  2OPG A;  4NXP A;  2V90 A;  2DAZ A;  1WI2 A;  2K1Z A;  4HOP B;  5E6P B;  4N6X A;  3GJ9 A;  2YUB A;  1L6O A;  3NFL A;  3CS0 A;  3PDV A;  2IWO A;  1V5L A;  2DJT A;  4NMV A;  5HFE A;  1WJL A;  3JXT A;  1OBY A;  1IHJ A;  1X45 A;  4G69 A;  1V1T A;  1V62 A;  3BPU A;  4WYU A;  3K82 A;  3QJN A;  2H2B A;  2JIK A;  1WFG A;  1TQ3 A;  2L97 A;  1V6B A;  5B6L A;  1U3B A;  2VSV A;  1OBX A;  5HEB A;  1Q3P A;  2QKT A;  2L4S A;  1UIT A;  5I7Z A;  1Y7N A;  1N99 A;  4GVC A;  4Z8J A;  1UHP A;  2F0A A;  2DC2 A;  4JOP A;  1WFV A;  3GCN A;  2HE2 A;  1WIF A;  2R4H A;  1OZI A;  3CC0 A;  3ID4 A;  1Z87 A;  1P1E A;  3GDS A;  2EDV A;  3B76 A;  2KOM A;  3DJ1 A;  5G1E A;  4GHN A;  2VZ5 A;  1YBO A;  3GDU A;  5GND A;  3KZD A;  2O2T A;  2HGA A;  2KV8 A;  1N6E A;  2VPH A;  4NMP A;  1PDR A;  1WHD A;  2MX6 A;  1X5N A;  5HF1 A;  2PNT A;  2G5M B;  1N7T A;  2EAQ A;  1KEF A;  3R69 A;  2F5Y A;  2YTW A;  3AXA A;  2EEJ A;  3SHW A;  5HJ1 A;  1QAV B;  2KJK A;  1UF1 A;  3I4W A;  4JOG A;  3DJ3 A;  3HPM A;  2KRG A;  3I1E A;  3PV4 A;  1WHA A;  2X7Z A;  3EGH C;  4NXR A;  3DIW A;  2IWN A;  3PS4 A;  4NXQ A;  3I18 A;  4NMO A;  4YDP A;  4NMQ A;  2IWP A;  5A2P A;  1IU0 A;  2I0L A;  4Q2P A;  2KG2 A;  4NMR A;  3RL8 A;  1WF7 A;  3R0H A;  2M0V A;  5E22 A;  2KJD A;  2Q3G A;  1W9Q A;  3MH6 A;  4JOJ A;  5HET A;  4PQW A;  1X8S A;  3LNY A;  1T2M A;  3HPK A;  2QT5 A;  3PV2 A;  1GQ4 A;  1G9O A;  2JIL A;  1QAU A;  2AIN A;  1RZX A;  1Y8T A;  2EEI A;  2GZV A;  2JRE A;  1WF8 A;  3KZE A;  1RY4 A;  1X5R A;  4AMH A;  2LC7 A;  3ID1 A;  4Q2O A;  1UEW A;  2ENO A;  2FCF A;  2H2C A;  1P1D A;  5FHT A;  1BE9 A;  1VJ6 A;  3CBY A;  2M0U A;  2W7R A;  1W9O A;  3HVQ C;  1UJD A;  1UJV A;  1XZ9 A;  4K72 A;  3QGL A;  3SHU A;  2KOJ A;  3MH4 A;  2EXG A;  4P2A B;  1KY9 A;  1UM7 A;  3O5N A;  1FC7 A;  2OZF A;  1ZOK A;  3ZRT A;  5JXB A;  2OQS A;  2DLS A;  2M10 A;  2D8I A;  1X5Q A;  1D5G A;  1MFL A;  1TP3 A;  2DKR A;  4FGM A;  1SOZ A;  1QAV A;  2RRM A;  3RL7 A;  2I4S A;  4NMS A;  2JOA A;  3QE1 A;  1IU2 A;  1TE0 A;  5HEY A;  4JL7 A;  2KBS A;  4NNL A;  1VA8 A;  4K6Y A;  3E17 A;  5GLJ A;  1U39 A;  2PDZ A;  4LMM A;  1GM1 A;  4JOF A;  3CH8 A;  2JIN A;  2VRF A;  2OMJ A;  1I92 A;  1R6J A;  2KL1 A;  3GGE A;  1UJU A;  2I6V A;  2EGN A;  4XHV A;  2AWX A;  3LNX A;  4JOK A;  3RLE A;  2OCS A;  1VB7 A;  1ZUB A;  2DM8 A;  2KPK A;  2R3Y A;  2PA1 A;  2OS6 A;  5D13 A;  5F67 A;  4Q6S A;  2D90 A;  2Z9I A;  3GDV A;  4JOH A;  2K20 A;  2AWW A;  3OU0 A;  2W4F A;  2M3M A;  4HOP A;  3MH7 A;  1Z86 A;  2KYL A;  5F3X A;  5DTH A;  1BFE A;  2LUI A;  3TSZ A;  3L4F D;  4YYX A;  1NTE A;  3QO6 A;  1FC9 A;  4KFV A;  1N6D A;  2FNE A;  4KFW A;  4NNM A;  3CBX A;  1M5Z A;  3SFJ A;  5HFD A;  3ID2 A;  1UEZ A;  1NF3 C;  5E1Y A;  2PKU A;  2EGO A;  2P3W A;  4Q2Q A;  5HFC A;  1GQ5 A;  2EDP A;  4O06 A;  4P0C A;  2G2L A;  1MC7 A;  2EV8 A;  3ID3 A;  4OEP A;  1SOT A;  4RI0 A;  4OAJ A;  2ZPL A;  4E3B A;  2EDZ A;  1N7E A;  3TSW A;  2EHR A;  2KAW A;  3O46 A;  2KOH A;  3K50 A;  2H3L A;  4Q2N A;  1TP5 A;  1UFX A;  1UM1 A;  4F8K A;  4Z33 A;  2CSS A;  2I04 A;  1RGW A;  2LOB A;  4K75 A;  5H3J A;  5HFF A;  4H11 A;  4UU6 A;  4E35 A;  3VQF A;  2Q9V A;  2DMZ A;  4JOR A;  2KJP A;  1U37 A;  1B8Q A;  3SUZ A;  1RGR A;  2DLU A;  3NGH A;  3VQG A;  1FC6 A;  1I16 A;  1W9E A;  3FY5 A;  1FCF A;  5EYZ A;  2V1W A;  2VSP A;  3PV5 A;  2YUY A;  2KA9 A;  4OEO A;  1X6D A;  4UU5 A;  1WG6 A;  2ZPM A;  3OTP A;  4E34 A;  5E21 A;  3WKM A;  2VWR A;  1UEP A;  2H3M A;  4REY A;  3STJ A;  1Q3O A;  3QIK A;  1N6F A;  2JWE A;  2OGP A;  2PZD A;  2KPL A;  2L4T A;  3PDZ A;  4K78 A;  2KQF A;  3GCO A;  3NFK A;  2HE4 A;  3QDO A;  1N7F A;  3K1R A;  2M0Z A;  4EDJ A;  1LCY A;  3TSV A;  2FE5 A;  2QBW A;  2OSG A;  5EZ0 A;  1Q7X A;  4Q3H A;  4R2Z A;  2CSJ A;  2EEH A;  4IC6 A;  2AWU A;  1K32 A;  3GSL A;  1KWA A;  3CBZ A;  1V5Q A;  2LC6 A;  4MPA A;  5FB8 C;  2YT7 A;  2D92 A;  4JOE A;  4L8N A;  3KHF A;  2MHO A; 
#chains in the Genus database with same CATH topology
 2WL7 A;  1QLC A;  2M0T A;  1OBZ A;  1U38 A;  5HED A;  3WKL A;  2Z17 A;  2I1N A;  2EGK A;  3NCV A;  3DOR A;  1UEQ A;  2EJY A;  1VCW A;  4NMT A;  5HF4 A;  3DJA A;  3SOE A;  2I0I A;  2IWQ A;  5HDY A;  4JJ0 A;  2CS5 A;  5E11 A;  2REY A;  2UZC A;  3CYY A;  2JXO A;  3TMH A;  2BYG A;  2PKT A;  3QJM A;  3R68 A;  1WI4 A;  4GVD A;  5G1D A;  1VAE A;  2RCZ A;  4WYT A;  2E7K A;  2QKV A;  5HFB A;  3GAB A;  2QG1 A;  3EGG C;  4Q6H A;  2LA8 A;  1MFG A;  2YT8 A;  2EEG A;  2FN5 A;  2QKU A;  1WH1 A;  2DB5 A;  4K76 A;  2OPG A;  4NXP A;  2V90 A;  2DAZ A;  1WI2 A;  2K1Z A;  4HOP B;  5E6P B;  4N6X A;  3GJ9 A;  2YUB A;  1L6O A;  3NFL A;  3CS0 A;  3PDV A;  2IWO A;  1V5L A;  2DJT A;  4NMV A;  5HFE A;  1WJL A;  3JXT A;  1OBY A;  1IHJ A;  1X45 A;  4G69 A;  1V1T A;  1V62 A;  3BPU A;  4WYU A;  3K82 A;  3QJN A;  2H2B A;  2JIK A;  1WFG A;  1TQ3 A;  2L97 A;  1V6B A;  5B6L A;  1U3B A;  2VSV A;  1OBX A;  5HEB A;  1Q3P A;  2QKT A;  2L4S A;  1UIT A;  5I7Z A;  1Y7N A;  1N99 A;  4GVC A;  4Z8J A;  1UHP A;  2F0A A;  2DC2 A;  4JOP A;  1WFV A;  3GCN A;  2HE2 A;  1WIF A;  2R4H A;  1OZI A;  3CC0 A;  3KDK A;  3ID4 A;  1Z87 A;  1P1E A;  5ILB A;  3GDS A;  2EDV A;  3B76 A;  2KOM A;  3DJ1 A;  5G1E A;  4GHN A;  2VZ5 A;  1YBO A;  3GDU A;  5GND A;  3KZD A;  2O2T A;  2HGA A;  2KV8 A;  1N6E A;  2VPH A;  5B42 A;  4NMP A;  1PDR A;  1WHD A;  4JJ3 A;  2MX6 A;  1X5N A;  5HF1 A;  2PNT A;  2G5M B;  1N7T A;  2EAQ A;  1KEF A;  3R69 A;  2F5Y A;  2YTW A;  3AXA A;  2EEJ A;  3SHW A;  5HJ1 A;  1QAV B;  2KJK A;  1UF1 A;  3I4W A;  4JOG A;  3DJ3 A;  3HPM A;  2KRG A;  3I1E A;  3PV4 A;  1WHA A;  2X7Z A;  3EGH C;  4NXR A;  3DIW A;  2IWN A;  3PS4 A;  4NXQ A;  3I18 A;  4NMO A;  4YDP A;  4NMQ A;  2IWP A;  5A2P A;  1IU0 A;  2I0L A;  4Q2P A;  2KG2 A;  4NMR A;  3RL8 A;  1WF7 A;  3R0H A;  2M0V A;  5E22 A;  2KJD A;  2Q3G A;  1W9Q A;  3MH6 A;  4JOJ A;  5HET A;  4PQW A;  1X8S A;  3LNY A;  1T2M A;  3HPK A;  2QT5 A;  3PV2 A;  1GQ4 A;  1G9O A;  2JIL A;  1QAU A;  2AIN A;  1RZX A;  1Y8T A;  2EEI A;  2GZV A;  2JRE A;  1WF8 A;  3KZE A;  1RY4 A;  1X5R A;  4AMH A;  2LC7 A;  3ID1 A;  4Q2O A;  1UEW A;  2ENO A;  2FCF A;  2H2C A;  1P1D A;  5FHT A;  1BE9 A;  1VJ6 A;  3CBY A;  2M0U A;  2W7R A;  1W9O A;  3HVQ C;  1UJD A;  1UJV A;  1XZ9 A;  4K72 A;  3QGL A;  3SHU A;  2KOJ A;  3MH4 A;  2EXG A;  4P2A B;  1X9Z A;  1KY9 A;  1UM7 A;  2GEF A;  3O5N A;  1FC7 A;  2OZF A;  1ZOK A;  3ZRT A;  5JXB A;  2OQS A;  2DLS A;  2M10 A;  2D8I A;  1X5Q A;  1D5G A;  1MFL A;  1TP3 A;  2DKR A;  4FGM A;  1SOZ A;  1QAV A;  2RRM A;  3RL7 A;  2I4S A;  4NMS A;  2JOA A;  3QE1 A;  1IU2 A;  1TE0 A;  5HEY A;  4JL7 A;  2KBS A;  4NNL A;  1VA8 A;  4K6Y A;  3E17 A;  5GLJ A;  1U39 A;  2PDZ A;  4LMM A;  1GM1 A;  4JOF A;  3CH8 A;  2JIN A;  2VRF A;  2OMJ A;  1I92 A;  1R6J A;  2KL1 A;  3GGE A;  1UJU A;  2I6V A;  2EGN A;  4XHV A;  2AWX A;  3LNX A;  4JOK A;  3RLE A;  2OCS A;  1VB7 A;  1ZUB A;  2DM8 A;  2KPK A;  4FLN A;  2R3Y A;  2PA1 A;  2OS6 A;  5D13 A;  5F67 A;  4Q6S A;  2D90 A;  2Z9I A;  3GDV A;  4JOH A;  2K20 A;  2AWW A;  3OU0 A;  2W4F A;  2M3M A;  4HOP A;  3MH7 A;  1Z86 A;  2KYL A;  5F3X A;  5DTH A;  1BFE A;  2LUI A;  3TSZ A;  3L4F D;  4YYX A;  1NTE A;  3QO6 A;  1FC9 A;  4KFV A;  1N6D A;  2FNE A;  4KFW A;  4NNM A;  3CBX A;  1M5Z A;  3SFJ A;  5HFD A;  3ID2 A;  1UEZ A;  1NF3 C;  5E1Y A;  2PKU A;  2EGO A;  2P3W A;  4Q2Q A;  5HFC A;  1GQ5 A;  2EDP A;  4O06 A;  4P0C A;  2G2L A;  1MC7 A;  2EV8 A;  3ID3 A;  4OEP A;  1SOT A;  4RI0 A;  4OAJ A;  2ZPL A;  4E3B A;  2EDZ A;  1N7E A;  3TSW A;  2EHR A;  2KAW A;  3O46 A;  2KOH A;  3K50 A;  2H3L A;  4Q2N A;  1TP5 A;  1UFX A;  1UM1 A;  4F8K A;  4Z33 A;  3KDG A;  2CSS A;  2I04 A;  1RGW A;  2LOB A;  4K75 A;  5H3J A;  5HFF A;  5IL9 A;  4H11 A;  4UU6 A;  4E35 A;  3VQF A;  2Q9V A;  2DMZ A;  4JOR A;  2KJP A;  1U37 A;  1B8Q A;  3SUZ A;  1RGR A;  2DLU A;  3NGH A;  3VQG A;  1FC6 A;  1I16 A;  1W9E A;  3FY5 A;  1FCF A;  5EYZ A;  2V1W A;  2VSP A;  3PV5 A;  2YUY A;  2KA9 A;  4OEO A;  1X6D A;  4UU5 A;  1WG6 A;  2ZPM A;  3OTP A;  4E34 A;  2JSN A;  5E21 A;  3WKM A;  2VWR A;  1UEP A;  2H3M A;  4REY A;  3STJ A;  1Q3O A;  3QIK A;  1N6F A;  2JWE A;  2OGP A;  2PZD A;  2KPL A;  2L4T A;  3PDZ A;  4K78 A;  2KQF A;  3GCO A;  3NFK A;  2HE4 A;  3QDO A;  1N7F A;  3K1R A;  2M0Z A;  4EDJ A;  1LCY A;  3TSV A;  2FE5 A;  2QBW A;  2OSG A;  5EZ0 A;  1Q7X A;  4Q3H A;  4R2Z A;  2CSJ A;  2EEH A;  4IC6 A;  2AWU A;  1K32 A;  3GSL A;  1KWA A;  3CBZ A;  1V5Q A;  2LC6 A;  4MPA A;  5FB8 C;  2YT7 A;  2D92 A;  4JOE A;  4L8N A;  3KHF A;  2MHO A; 
#chains in the Genus database with same CATH homology
 2WL7 A;  1QLC A;  2M0T A;  1OBZ A;  1U38 A;  5HED A;  3WKL A;  2Z17 A;  2I1N A;  2EGK A;  3NCV A;  3DOR A;  1UEQ A;  2EJY A;  1VCW A;  4NMT A;  5HF4 A;  3DJA A;  3SOE A;  2I0I A;  2IWQ A;  5HDY A;  4JJ0 A;  2CS5 A;  5E11 A;  2REY A;  2UZC A;  3CYY A;  2JXO A;  3TMH A;  2BYG A;  2PKT A;  3QJM A;  3R68 A;  1WI4 A;  4GVD A;  5G1D A;  1VAE A;  2RCZ A;  4WYT A;  2E7K A;  2QKV A;  5HFB A;  3GAB A;  2QG1 A;  3EGG C;  4Q6H A;  2LA8 A;  1MFG A;  2YT8 A;  2EEG A;  2FN5 A;  2QKU A;  1WH1 A;  2DB5 A;  4K76 A;  2OPG A;  4NXP A;  2V90 A;  2DAZ A;  1WI2 A;  2K1Z A;  4HOP B;  5E6P B;  4N6X A;  3GJ9 A;  2YUB A;  1L6O A;  3NFL A;  3CS0 A;  3PDV A;  2IWO A;  1V5L A;  2DJT A;  4NMV A;  5HFE A;  1WJL A;  3JXT A;  1OBY A;  1IHJ A;  1X45 A;  4G69 A;  1V1T A;  1V62 A;  3BPU A;  4WYU A;  3K82 A;  3QJN A;  2H2B A;  2JIK A;  1WFG A;  1TQ3 A;  2L97 A;  1V6B A;  5B6L A;  1U3B A;  2VSV A;  1OBX A;  5HEB A;  1Q3P A;  2QKT A;  2L4S A;  1UIT A;  5I7Z A;  1Y7N A;  1N99 A;  4GVC A;  4Z8J A;  1UHP A;  2F0A A;  2DC2 A;  4JOP A;  1WFV A;  3GCN A;  2HE2 A;  1WIF A;  2R4H A;  1OZI A;  3CC0 A;  3KDK A;  3ID4 A;  1Z87 A;  1P1E A;  5ILB A;  3GDS A;  2EDV A;  3B76 A;  2KOM A;  3DJ1 A;  5G1E A;  4GHN A;  2VZ5 A;  1YBO A;  3GDU A;  5GND A;  3KZD A;  2O2T A;  2HGA A;  2KV8 A;  1N6E A;  2VPH A;  5B42 A;  4NMP A;  1PDR A;  1WHD A;  4JJ3 A;  2MX6 A;  1X5N A;  5HF1 A;  2PNT A;  2G5M B;  1N7T A;  2EAQ A;  1KEF A;  3R69 A;  2F5Y A;  2YTW A;  3AXA A;  2EEJ A;  3SHW A;  5HJ1 A;  1QAV B;  2KJK A;  1UF1 A;  3I4W A;  4JOG A;  3DJ3 A;  3HPM A;  2KRG A;  3I1E A;  3PV4 A;  1WHA A;  2X7Z A;  3EGH C;  4NXR A;  3DIW A;  2IWN A;  3PS4 A;  4NXQ A;  3I18 A;  4NMO A;  4YDP A;  4NMQ A;  2IWP A;  5A2P A;  1IU0 A;  2I0L A;  4Q2P A;  2KG2 A;  4NMR A;  3RL8 A;  1WF7 A;  3R0H A;  2M0V A;  5E22 A;  2KJD A;  2Q3G A;  1W9Q A;  3MH6 A;  4JOJ A;  5HET A;  4PQW A;  1X8S A;  3LNY A;  1T2M A;  3HPK A;  2QT5 A;  3PV2 A;  1GQ4 A;  1G9O A;  2JIL A;  1QAU A;  2AIN A;  1RZX A;  1Y8T A;  2EEI A;  2GZV A;  2JRE A;  1WF8 A;  3KZE A;  1RY4 A;  1X5R A;  4AMH A;  2LC7 A;  3ID1 A;  4Q2O A;  1UEW A;  2ENO A;  2FCF A;  2H2C A;  1P1D A;  5FHT A;  1BE9 A;  1VJ6 A;  3CBY A;  2M0U A;  2W7R A;  1W9O A;  3HVQ C;  1UJD A;  1UJV A;  1XZ9 A;  4K72 A;  3QGL A;  3SHU A;  2KOJ A;  3MH4 A;  2EXG A;  4P2A B;  1X9Z A;  1KY9 A;  1UM7 A;  2GEF A;  3O5N A;  1FC7 A;  2OZF A;  1ZOK A;  3ZRT A;  5JXB A;  2OQS A;  2DLS A;  2M10 A;  2D8I A;  1X5Q A;  1D5G A;  1MFL A;  1TP3 A;  2DKR A;  4FGM A;  1SOZ A;  1QAV A;  2RRM A;  3RL7 A;  2I4S A;  4NMS A;  2JOA A;  3QE1 A;  1IU2 A;  1TE0 A;  5HEY A;  4JL7 A;  2KBS A;  4NNL A;  1VA8 A;  4K6Y A;  3E17 A;  5GLJ A;  1U39 A;  2PDZ A;  4LMM A;  1GM1 A;  4JOF A;  3CH8 A;  2JIN A;  2VRF A;  2OMJ A;  1I92 A;  1R6J A;  2KL1 A;  3GGE A;  1UJU A;  2I6V A;  2EGN A;  4XHV A;  2AWX A;  3LNX A;  4JOK A;  3RLE A;  2OCS A;  1VB7 A;  1ZUB A;  2DM8 A;  2KPK A;  4FLN A;  2R3Y A;  2PA1 A;  2OS6 A;  5D13 A;  5F67 A;  4Q6S A;  2D90 A;  2Z9I A;  3GDV A;  4JOH A;  2K20 A;  2AWW A;  3OU0 A;  2W4F A;  2M3M A;  4HOP A;  3MH7 A;  1Z86 A;  2KYL A;  5F3X A;  5DTH A;  1BFE A;  2LUI A;  3TSZ A;  3L4F D;  4YYX A;  1NTE A;  3QO6 A;  1FC9 A;  4KFV A;  1N6D A;  2FNE A;  4KFW A;  4NNM A;  3CBX A;  1M5Z A;  3SFJ A;  5HFD A;  3ID2 A;  1UEZ A;  1NF3 C;  5E1Y A;  2PKU A;  2EGO A;  2P3W A;  4Q2Q A;  5HFC A;  1GQ5 A;  2EDP A;  4O06 A;  4P0C A;  2G2L A;  1MC7 A;  2EV8 A;  3ID3 A;  4OEP A;  1SOT A;  4RI0 A;  4OAJ A;  2ZPL A;  4E3B A;  2EDZ A;  1N7E A;  3TSW A;  2EHR A;  2KAW A;  3O46 A;  2KOH A;  3K50 A;  2H3L A;  4Q2N A;  1TP5 A;  1UFX A;  1UM1 A;  4F8K A;  4Z33 A;  3KDG A;  2CSS A;  2I04 A;  1RGW A;  2LOB A;  4K75 A;  5H3J A;  5HFF A;  5IL9 A;  4H11 A;  4UU6 A;  4E35 A;  3VQF A;  2Q9V A;  2DMZ A;  4JOR A;  2KJP A;  1U37 A;  1B8Q A;  3SUZ A;  1RGR A;  2DLU A;  3NGH A;  3VQG A;  1FC6 A;  1I16 A;  1W9E A;  3FY5 A;  1FCF A;  5EYZ A;  2V1W A;  2VSP A;  3PV5 A;  2YUY A;  2KA9 A;  4OEO A;  1X6D A;  4UU5 A;  1WG6 A;  2ZPM A;  3OTP A;  4E34 A;  2JSN A;  5E21 A;  3WKM A;  2VWR A;  1UEP A;  2H3M A;  4REY A;  3STJ A;  1Q3O A;  3QIK A;  1N6F A;  2JWE A;  2OGP A;  2PZD A;  2KPL A;  2L4T A;  3PDZ A;  4K78 A;  2KQF A;  3GCO A;  3NFK A;  2HE4 A;  3QDO A;  1N7F A;  3K1R A;  2M0Z A;  4EDJ A;  1LCY A;  3TSV A;  2FE5 A;  2QBW A;  2OSG A;  5EZ0 A;  1Q7X A;  4Q3H A;  4R2Z A;  2CSJ A;  2EEH A;  4IC6 A;  2AWU A;  1K32 A;  3GSL A;  1KWA A;  3CBZ A;  1V5Q A;  2LC6 A;  4MPA A;  5FB8 C;  2YT7 A;  2D92 A;  4JOE A;  4L8N A;  3KHF A;  2MHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...