3LNXA

Second pdz domain from human ptp1e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
94
structure length
94
Chain Sequence
PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein phosphatase non-receptor type 13
publication title Crystallographic and nuclear magnetic resonance evaluation of the impact of peptide binding to the second PDZ domain of protein tyrosine phosphatase 1E.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 23
structure length 94
sequence length 94
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2010-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 3lnxA00
1N6EA 1WF8A 5GLJA 2YT7A 2KG2A 3ID3A 2K1ZA 1OBYA 2PKUA 2EGKA 4Q2NA 1U3BA 1V6BA 2VSPA 2R4HA 4P2AB 1GQ5A 3GSLA 3EGHC 2VRFA 2HE2A 3OTPA 3DIWA 2LUIA 1V1TA 2PZDA 2P3WA 1UJDA 2PA1A 1N7TA 3GCNA 2PNTA 4K72A 1MC7A 1R6JA 3ID4A 2EJYA 1FC7A 2H3MA 1WHDA 2OSGA 2ZPLA 1G9OA 4K6YA 1WF7A 3QGLA 3ID1A 1Y8TA 1TP3A 1UM7A 2QT5A 2M0UA 5E1YA 2OQSA 2I4SA 1WFGA 3K1RA 2FE5A 4IC6A 2Z9IA 2EAQA 3DJAA 1V5QA 2KOJA 2VWRA 1T2MA 2QKVA 4G69A 1XZ9A 5G1EA 3JXTA 2EEGA 2RCZA 1X45A 2OS6A 4F8KA 1WI2A 2M10A 2IWOA 5F3XA 2L4TA 2W4FA 3E17A 3GDSA 4P0CA 2QG1A 3SHWA 1WFVA 5I7ZA 3CBZA 1N7FA 2EV8A 2KV8A 3DJ3A 1QLCA 1WG6A 1X5QA 5HEBA 4E35A 2G2LA 4Q6HA 2E7KA 2F0AA 2Q3GA 3NGHA 1VB7A 4Q2PA 3ZRTA 3SHUA 1KWAA 3EGGC 4UU6A 4PQWA 5HFBA 1RY4A 2AINA 1VCWA 5HF4A 1OBZA 1RGWA 3KZEA 2DLSA 4NXQA 2FNEA 4AMHA 2I0IA 1Y7NA 2KPLA 1GQ4A 1X5RA 2BYGA 3SUZA 1PDRA 2OCSA 3BPUA 3TSVA 3TSZA 2UZCA 1U37A 2MX6A 2M3MA 1UEQA 3VQFA 1QAVA 3STJA 4KFWA 3TSWA 1NTEA 1RGRA 4H11A 2REYA 3NFLA 3I18A 5E11A 2QBWA 2W7RA 5FHTA 1TE0A 1N99A 1YBOA 4JL7A 3RL8A 3O5NA 4YDPA 1WJLA 2AWXA 1SOTA 5GNDA 3CYYA 3GGEA 2K20A 1VA8A 3L4FD 4KFVA 3AXAA 4JOKA 1Q7XA 2OZFA 5E21A 1SOZA 4RI0A 4JOPA 5EYZA 4MPAA 1U38A 1TP5A 3R0HA 2H2CA 2QKTA 2YT8A 1NF3C 1W9EA 1BE9A 1RZXA 3HPMA 5FB8C 2L4SA 3MH4A 1B8QA 2KQFA 1W9QA 2WL7A 1L6OA 3GJ9A 2KJKA 3KZDA 4FGMA 2EEIA 1QAUA 5E6PB 3TMHA 4E3BA 1N6DA 2L97A 1VAEA 3PV5A 2YUBA 4NMVA 5D13A 2KL1A 3GCOA 4HOPA 4NMQA 1I92A 5HEDA 1UHPA 1WH1A 2ZPMA 1UEPA 3SOEA 2HGAA 3R68A 2KYLA 4N6XA 2KAWA 2DM8A 2EGNA 1X6DA 3DORA 3I1EA 1D5GA 4JOJA 2JREA 2LC6A 2I6VA 4NMRA 4WYUA 2Z17A 2AWWA 3LNXA 4Q2QA 4Q6SA 4YYXA 1WI4A 5E22A 3RL7A 4GVCA 2DC2A 1QAVB 2IWPA 3CS0A 2KOMA 1IU0A 3QDOA 1Z87A 1OBXA 1KEFA 4K76A 1ZOKA 1N6FA 4NNMA 2KA9A 4REYA 3RLEA 3WKMA 2DMZA 2CSSA 5HDYA 5HFDA 2ENOA 4Z8JA 2I04A 4L8NA 2DLUA 1X5NA 2KRGA 2EDVA 4NMPA 3QJNA 2V90A 2JXOA 5B6LA 2FN5A 2M0ZA 1UEWA 1UJVA 3PDZA 3KHFA 3WKLA 3QJMA 2VSVA 5HEYA 3GDUA 4Q2OA 1UF1A 2IWNA 4GVDA 2R3YA 5HFEA 1IHJA 4NXPA 1FC9A 1V5LA 2CSJA 5HF1A 2D92A 2JIKA 2PKTA 3K50A 5DTHA 2CS5A 2JILA 3NFKA 1P1DA 3ID2A 1FCFA 1N7EA 4JORA 2Q9VA 5HETA 3HPKA 2I1NA 4HOPB 3PV2A 4JOEA 3B76A 2PDZA 2EXGA 1WIFA 1W9OA 1P1EA 1UJUA 2G5MB 1M5ZA 4NXRA 1LCYA 3MH7A 1U39A 1Q3PA 1UEZA 2H3LA 1VJ6A 3OU0A 5A2PA 1UFXA 4K78A 2D8IA 5EZ0A 4EDJA 3HVQC 3MH6A 3LNYA 4NMTA 3GDVA 1K32A 2YTWA 2DB5A 2I0LA 3FY5A 2V1WA 3QE1A 4JOHA 4JOGA 2KBSA 2RRMA 4OAJA 4WYTA 2DAZA 1UM1A 2JINA 4Z33A 1UITA 3DJ1A 3CBYA 2VPHA 4O06A 2EDPA 5HFFA 2LA8A 1MFLA 3R69A 1Z86A 3O46A 1OZIA 4OEPA 2HE4A 2VZ5A 4R2ZA 2QKUA 5H3JA 2YUYA 1I16A 4NMSA 2KJPA 2EGOA 2GZVA 3PS4A 3CH8A 3I4WA 2EEHA 2KPKA 4NMOA 2OPGA 2M0VA 3PV4A 4LMMA 2DKRA 5G1DA 3VQGA 4Q3HA 2EHRA 2AWUA 5F67A 2EDZA 1Q3OA 4NNLA 1TQ3A 1X8SA 5JXBA 2X7ZA 4UU5A 4XHVA 2LOBA 1MFGA 2DJTA 2MHOA 2JOAA 3SFJA 1KY9A 5HJ1A 3K82A 2M0TA 1IU2A 2F5YA 4GHNA 2KOHA 4K75A 2O2TA 3CBXA 3PDVA 2KJDA 1GM1A 1FC6A 1ZUBA 2FCFA 2OGPA 3QO6A 2IWQA 2JWEA 3QIKA 3CC0A 2OMJA 4OEOA 2D90A 1V62A 1WHAA 4JOFA 5HFCA 4E34A 2H2BA 1BFEA 2LC7A 2EEJA
chains in the Genus database with same CATH superfamily
1N6EA 1WF8A 5GLJA 2YT7A 2KG2A 3ID3A 2K1ZA 1OBYA 2PKUA 2EGKA 4Q2NA 1U3BA 1V6BA 2VSPA 2R4HA 4P2AB 1GQ5A 3GSLA 3EGHC 2VRFA 2HE2A 3OTPA 3DIWA 2LUIA 1V1TA 2PZDA 2P3WA 1UJDA 2PA1A 1N7TA 3GCNA 2PNTA 4K72A 1MC7A 1R6JA 3ID4A 2EJYA 1FC7A 2H3MA 1WHDA 3GABA 2OSGA 2ZPLA 1G9OA 4K6YA 3KDKA 1WF7A 3QGLA 3ID1A 1Y8TA 1TP3A 1UM7A 2QT5A 2M0UA 3NCVA 5E1YA 2OQSA 2I4SA 1WFGA 3K1RA 2FE5A 4IC6A 2Z9IA 5IL9A 2EAQA 3DJAA 1V5QA 2KOJA 2VWRA 1T2MA 2QKVA 4G69A 1XZ9A 5G1EA 3JXTA 2EEGA 2RCZA 1X45A 2OS6A 4F8KA 1WI2A 2M10A 2IWOA 5F3XA 2L4TA 2W4FA 3E17A 3GDSA 4P0CA 5B42A 2QG1A 3SHWA 1WFVA 5I7ZA 3CBZA 1N7FA 2EV8A 2KV8A 3DJ3A 1QLCA 1WG6A 1X5QA 5HEBA 4E35A 2G2LA 4Q6HA 2E7KA 2F0AA 2Q3GA 3NGHA 1VB7A 4Q2PA 3ZRTA 3SHUA 1KWAA 3EGGC 4UU6A 4PQWA 5HFBA 1RY4A 2AINA 1VCWA 2JSNA 5HF4A 1OBZA 1RGWA 3KZEA 2DLSA 4NXQA 2FNEA 4AMHA 2I0IA 1Y7NA 2KPLA 1GQ4A 1X5RA 2BYGA 3SUZA 1PDRA 2OCSA 3BPUA 3TSVA 3TSZA 2UZCA 1U37A 4JJ3A 2MX6A 2M3MA 1UEQA 3VQFA 1QAVA 3STJA 4KFWA 3TSWA 1NTEA 1RGRA 4H11A 2REYA 3NFLA 3I18A 5E11A 2QBWA 2W7RA 5FHTA 1TE0A 1N99A 1YBOA 4JL7A 3RL8A 3O5NA 4YDPA 1WJLA 2AWXA 1SOTA 5GNDA 3CYYA 3GGEA 2K20A 1VA8A 3L4FD 4KFVA 3AXAA 4JOKA 1Q7XA 2OZFA 5E21A 1SOZA 4RI0A 4JOPA 5EYZA 4MPAA 1U38A 1TP5A 3R0HA 2H2CA 1X9ZA 2GEFA 2QKTA 2YT8A 1NF3C 1W9EA 1BE9A 1RZXA 3HPMA 5FB8C 2L4SA 3MH4A 1B8QA 2KQFA 1W9QA 2WL7A 1L6OA 3GJ9A 2KJKA 3KZDA 4FGMA 2EEIA 1QAUA 5E6PB 3TMHA 4E3BA 1N6DA 2L97A 1VAEA 3PV5A 2YUBA 4NMVA 5D13A 2KL1A 3GCOA 4HOPA 4NMQA 1I92A 5HEDA 1UHPA 1WH1A 2ZPMA 1UEPA 3SOEA 2HGAA 3R68A 2KYLA 4N6XA 2KAWA 2DM8A 2EGNA 1X6DA 3DORA 3I1EA 1D5GA 4JOJA 2JREA 2LC6A 2I6VA 5ILBA 4NMRA 4WYUA 2Z17A 2AWWA 3LNXA 4Q2QA 4Q6SA 4YYXA 1WI4A 5E22A 3RL7A 4GVCA 2DC2A 1QAVB 2IWPA 3CS0A 2KOMA 1IU0A 3QDOA 1Z87A 1OBXA 1KEFA 4K76A 1ZOKA 1N6FA 4NNMA 2KA9A 4REYA 3RLEA 3WKMA 2DMZA 2CSSA 5HDYA 5HFDA 2ENOA 4FLNA 4Z8JA 2I04A 4L8NA 2DLUA 1X5NA 2KRGA 2EDVA 4NMPA 3QJNA 2V90A 2JXOA 5B6LA 2FN5A 2M0ZA 1UEWA 1UJVA 3PDZA 3KHFA 3WKLA 3QJMA 2VSVA 5HEYA 3GDUA 4Q2OA 1UF1A 2IWNA 4GVDA 2R3YA 5HFEA 1IHJA 4NXPA 1FC9A 1V5LA 2CSJA 5HF1A 2D92A 2JIKA 2PKTA 3K50A 5DTHA 2CS5A 2JILA 3NFKA 1P1DA 3ID2A 1FCFA 1N7EA 4JORA 2Q9VA 5HETA 3HPKA 2I1NA 4HOPB 3PV2A 4JOEA 3B76A 2PDZA 2EXGA 1WIFA 1W9OA 1P1EA 1UJUA 2G5MB 1M5ZA 4NXRA 1LCYA 3MH7A 1U39A 1Q3PA 1UEZA 2H3LA 1VJ6A 3OU0A 5A2PA 1UFXA 4K78A 2D8IA 5EZ0A 4EDJA 3HVQC 3MH6A 3LNYA 4NMTA 3GDVA 1K32A 2YTWA 2DB5A 2I0LA 3FY5A 2V1WA 3QE1A 4JOHA 4JOGA 2KBSA 2RRMA 4OAJA 4WYTA 2DAZA 1UM1A 2JINA 4Z33A 1UITA 3DJ1A 3CBYA 2VPHA 4O06A 2EDPA 5HFFA 2LA8A 1MFLA 3R69A 1Z86A 3O46A 1OZIA 4OEPA 2HE4A 2VZ5A 4R2ZA 2QKUA 5H3JA 2YUYA 1I16A 4NMSA 2KJPA 2EGOA 2GZVA 3PS4A 3CH8A 3I4WA 2EEHA 2KPKA 4NMOA 2OPGA 2M0VA 3PV4A 4LMMA 2DKRA 5G1DA 3VQGA 4Q3HA 2EHRA 2AWUA 5F67A 2EDZA 1Q3OA 4NNLA 1TQ3A 1X8SA 5JXBA 2X7ZA 4UU5A 4XHVA 2LOBA 1MFGA 2DJTA 2MHOA 2JOAA 4JJ0A 3SFJA 1KY9A 5HJ1A 3K82A 2M0TA 1IU2A 2F5YA 4GHNA 2KOHA 4K75A 2O2TA 3CBXA 3PDVA 2KJDA 1GM1A 1FC6A 1ZUBA 2FCFA 2OGPA 3QO6A 2IWQA 2JWEA 3QIKA 3CC0A 2OMJA 3KDGA 4OEOA 2D90A 1V62A 1WHAA 4JOFA 5HFCA 4E34A 2H2BA 1BFEA 2LC7A 2EEJA
chains in the Genus database with same CATH topology
1N6EA 1WF8A 5GLJA 2YT7A 2KG2A 3ID3A 2K1ZA 1OBYA 2PKUA 2EGKA 4Q2NA 1U3BA 1V6BA 2VSPA 2R4HA 4P2AB 1GQ5A 3GSLA 3EGHC 2VRFA 2HE2A 3OTPA 3DIWA 2LUIA 1V1TA 2PZDA 2P3WA 1UJDA 2PA1A 1N7TA 3GCNA 2PNTA 4K72A 1MC7A 1R6JA 3ID4A 2EJYA 1FC7A 2H3MA 1WHDA 3GABA 2OSGA 2ZPLA 1G9OA 4K6YA 3KDKA 1WF7A 3QGLA 3ID1A 1Y8TA 1TP3A 1UM7A 2QT5A 2M0UA 3NCVA 5E1YA 2OQSA 2I4SA 1WFGA 3K1RA 2FE5A 4IC6A 2Z9IA 5IL9A 2EAQA 3DJAA 1V5QA 2KOJA 2VWRA 1T2MA 2QKVA 4G69A 1XZ9A 5G1EA 3JXTA 2EEGA 2RCZA 1X45A 2OS6A 4F8KA 1WI2A 2M10A 2IWOA 5F3XA 2L4TA 2W4FA 3E17A 3GDSA 4P0CA 5B42A 2QG1A 3SHWA 1WFVA 5I7ZA 3CBZA 1N7FA 2EV8A 2KV8A 3DJ3A 1QLCA 1WG6A 1X5QA 5HEBA 4E35A 2G2LA 4Q6HA 2E7KA 2F0AA 2Q3GA 3NGHA 1VB7A 4Q2PA 3ZRTA 3SHUA 1KWAA 3EGGC 4UU6A 4PQWA 5HFBA 1RY4A 2AINA 1VCWA 2JSNA 5HF4A 1OBZA 1RGWA 3KZEA 2DLSA 4NXQA 2FNEA 4AMHA 2I0IA 1Y7NA 2KPLA 1GQ4A 1X5RA 2BYGA 3SUZA 1PDRA 2OCSA 3BPUA 3TSVA 3TSZA 2UZCA 1U37A 4JJ3A 2MX6A 2M3MA 1UEQA 3VQFA 1QAVA 3STJA 4KFWA 3TSWA 1NTEA 1RGRA 4H11A 2REYA 3NFLA 3I18A 5E11A 2QBWA 2W7RA 5FHTA 1TE0A 1N99A 1YBOA 4JL7A 3RL8A 3O5NA 4YDPA 1WJLA 2AWXA 1SOTA 5GNDA 3CYYA 3GGEA 2K20A 1VA8A 3L4FD 4KFVA 3AXAA 4JOKA 1Q7XA 2OZFA 5E21A 1SOZA 4RI0A 4JOPA 5EYZA 4MPAA 1U38A 1TP5A 3R0HA 2H2CA 1X9ZA 2GEFA 2QKTA 2YT8A 1NF3C 1W9EA 1BE9A 1RZXA 3HPMA 5FB8C 2L4SA 3MH4A 1B8QA 2KQFA 1W9QA 2WL7A 1L6OA 3GJ9A 2KJKA 3KZDA 4FGMA 2EEIA 1QAUA 5E6PB 3TMHA 4E3BA 1N6DA 2L97A 1VAEA 3PV5A 2YUBA 4NMVA 5D13A 2KL1A 3GCOA 4HOPA 4NMQA 1I92A 5HEDA 1UHPA 1WH1A 2ZPMA 1UEPA 3SOEA 2HGAA 3R68A 2KYLA 4N6XA 2KAWA 2DM8A 2EGNA 1X6DA 3DORA 3I1EA 1D5GA 4JOJA 2JREA 2LC6A 2I6VA 5ILBA 4NMRA 4WYUA 2Z17A 2AWWA 3LNXA 4Q2QA 4Q6SA 4YYXA 1WI4A 5E22A 3RL7A 4GVCA 2DC2A 1QAVB 2IWPA 3CS0A 2KOMA 1IU0A 3QDOA 1Z87A 1OBXA 1KEFA 4K76A 1ZOKA 1N6FA 4NNMA 2KA9A 4REYA 3RLEA 3WKMA 2DMZA 2CSSA 5HDYA 5HFDA 2ENOA 4FLNA 4Z8JA 2I04A 4L8NA 2DLUA 1X5NA 2KRGA 2EDVA 4NMPA 3QJNA 2V90A 2JXOA 5B6LA 2FN5A 2M0ZA 1UEWA 1UJVA 3PDZA 3KHFA 3WKLA 3QJMA 2VSVA 5HEYA 3GDUA 4Q2OA 1UF1A 2IWNA 4GVDA 2R3YA 5HFEA 1IHJA 4NXPA 1FC9A 1V5LA 2CSJA 5HF1A 2D92A 2JIKA 2PKTA 3K50A 5DTHA 2CS5A 2JILA 3NFKA 1P1DA 3ID2A 1FCFA 1N7EA 4JORA 2Q9VA 5HETA 3HPKA 2I1NA 4HOPB 3PV2A 4JOEA 3B76A 2PDZA 2EXGA 1WIFA 1W9OA 1P1EA 1UJUA 2G5MB 1M5ZA 4NXRA 1LCYA 3MH7A 1U39A 1Q3PA 1UEZA 2H3LA 1VJ6A 3OU0A 5A2PA 1UFXA 4K78A 2D8IA 5EZ0A 4EDJA 3HVQC 3MH6A 3LNYA 4NMTA 3GDVA 1K32A 2YTWA 2DB5A 2I0LA 3FY5A 2V1WA 3QE1A 4JOHA 4JOGA 2KBSA 2RRMA 4OAJA 4WYTA 2DAZA 1UM1A 2JINA 4Z33A 1UITA 3DJ1A 3CBYA 2VPHA 4O06A 2EDPA 5HFFA 2LA8A 1MFLA 3R69A 1Z86A 3O46A 1OZIA 4OEPA 2HE4A 2VZ5A 4R2ZA 2QKUA 5H3JA 2YUYA 1I16A 4NMSA 2KJPA 2EGOA 2GZVA 3PS4A 3CH8A 3I4WA 2EEHA 2KPKA 4NMOA 2OPGA 2M0VA 3PV4A 4LMMA 2DKRA 5G1DA 3VQGA 4Q3HA 2EHRA 2AWUA 5F67A 2EDZA 1Q3OA 4NNLA 1TQ3A 1X8SA 5JXBA 2X7ZA 4UU5A 4XHVA 2LOBA 1MFGA 2DJTA 2MHOA 2JOAA 4JJ0A 3SFJA 1KY9A 5HJ1A 3K82A 2M0TA 1IU2A 2F5YA 4GHNA 2KOHA 4K75A 2O2TA 3CBXA 3PDVA 2KJDA 1GM1A 1FC6A 1ZUBA 2FCFA 2OGPA 3QO6A 2IWQA 2JWEA 3QIKA 3CC0A 2OMJA 3KDGA 4OEOA 2D90A 1V62A 1WHAA 4JOFA 5HFCA 4E34A 2H2BA 1BFEA 2LC7A 2EEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6E A;  1WF8 A;  5GLJ A;  2YT7 A;  2KG2 A;  3ID3 A;  2K1Z A;  1OBY A;  2PKU A;  2EGK A;  4Q2N A;  1U3B A;  1V6B A;  2VSP A;  2R4H A;  4P2A B;  1GQ5 A;  3GSL A;  3EGH C;  2VRF A;  2HE2 A;  3OTP A;  3DIW A;  2LUI A;  1V1T A;  2PZD A;  2P3W A;  1UJD A;  2PA1 A;  1N7T A;  3GCN A;  2PNT A;  4K72 A;  1MC7 A;  1R6J A;  3ID4 A;  2EJY A;  1FC7 A;  2H3M A;  1WHD A;  2OSG A;  2ZPL A;  1G9O A;  4K6Y A;  1WF7 A;  3QGL A;  3ID1 A;  1Y8T A;  1TP3 A;  1UM7 A;  2QT5 A;  2M0U A;  5E1Y A;  2OQS A;  2I4S A;  1WFG A;  3K1R A;  2FE5 A;  4IC6 A;  2Z9I A;  2EAQ A;  3DJA A;  1V5Q A;  2KOJ A;  2VWR A;  1T2M A;  2QKV A;  4G69 A;  1XZ9 A;  5G1E A;  3JXT A;  2EEG A;  2RCZ A;  1X45 A;  2OS6 A;  4F8K A;  1WI2 A;  2M10 A;  2IWO A;  5F3X A;  2L4T A;  2W4F A;  3E17 A;  3GDS A;  4P0C A;  2QG1 A;  3SHW A;  1WFV A;  5I7Z A;  3CBZ A;  1N7F A;  2EV8 A;  2KV8 A;  3DJ3 A;  1QLC A;  1WG6 A;  1X5Q A;  5HEB A;  4E35 A;  2G2L A;  4Q6H A;  2E7K A;  2F0A A;  2Q3G A;  3NGH A;  1VB7 A;  4Q2P A;  3ZRT A;  3SHU A;  1KWA A;  3EGG C;  4UU6 A;  4PQW A;  5HFB A;  1RY4 A;  2AIN A;  1VCW A;  5HF4 A;  1OBZ A;  1RGW A;  3KZE A;  2DLS A;  4NXQ A;  2FNE A;  4AMH A;  2I0I A;  1Y7N A;  2KPL A;  1GQ4 A;  1X5R A;  2BYG A;  3SUZ A;  1PDR A;  2OCS A;  3BPU A;  3TSV A;  3TSZ A;  2UZC A;  1U37 A;  2MX6 A;  2M3M A;  1UEQ A;  3VQF A;  1QAV A;  3STJ A;  4KFW A;  3TSW A;  1NTE A;  1RGR A;  4H11 A;  2REY A;  3NFL A;  3I18 A;  5E11 A;  2QBW A;  2W7R A;  5FHT A;  1TE0 A;  1N99 A;  1YBO A;  4JL7 A;  3RL8 A;  3O5N A;  4YDP A;  1WJL A;  2AWX A;  1SOT A;  5GND A;  3CYY A;  3GGE A;  2K20 A;  1VA8 A;  3L4F D;  4KFV A;  3AXA A;  4JOK A;  1Q7X A;  2OZF A;  5E21 A;  1SOZ A;  4RI0 A;  4JOP A;  5EYZ A;  4MPA A;  1U38 A;  1TP5 A;  3R0H A;  2H2C A;  2QKT A;  2YT8 A;  1NF3 C;  1W9E A;  1BE9 A;  1RZX A;  3HPM A;  5FB8 C;  2L4S A;  3MH4 A;  1B8Q A;  2KQF A;  1W9Q A;  2WL7 A;  1L6O A;  3GJ9 A;  2KJK A;  3KZD A;  4FGM A;  2EEI A;  1QAU A;  5E6P B;  3TMH A;  4E3B A;  1N6D A;  2L97 A;  1VAE A;  3PV5 A;  2YUB A;  4NMV A;  5D13 A;  2KL1 A;  3GCO A;  4HOP A;  4NMQ A;  1I92 A;  5HED A;  1UHP A;  1WH1 A;  2ZPM A;  1UEP A;  3SOE A;  2HGA A;  3R68 A;  2KYL A;  4N6X A;  2KAW A;  2DM8 A;  2EGN A;  1X6D A;  3DOR A;  3I1E A;  1D5G A;  4JOJ A;  2JRE A;  2LC6 A;  2I6V A;  4NMR A;  4WYU A;  2Z17 A;  2AWW A;  3LNX A;  4Q2Q A;  4Q6S A;  4YYX A;  1WI4 A;  5E22 A;  3RL7 A;  4GVC A;  2DC2 A;  1QAV B;  2IWP A;  3CS0 A;  2KOM A;  1IU0 A;  3QDO A;  1Z87 A;  1OBX A;  1KEF A;  4K76 A;  1ZOK A;  1N6F A;  4NNM A;  2KA9 A;  4REY A;  3RLE A;  3WKM A;  2DMZ A;  2CSS A;  5HDY A;  5HFD A;  2ENO A;  4Z8J A;  2I04 A;  4L8N A;  2DLU A;  1X5N A;  2KRG A;  2EDV A;  4NMP A;  3QJN A;  2V90 A;  2JXO A;  5B6L A;  2FN5 A;  2M0Z A;  1UEW A;  1UJV A;  3PDZ A;  3KHF A;  3WKL A;  3QJM A;  2VSV A;  5HEY A;  3GDU A;  4Q2O A;  1UF1 A;  2IWN A;  4GVD A;  2R3Y A;  5HFE A;  1IHJ A;  4NXP A;  1FC9 A;  1V5L A;  2CSJ A;  5HF1 A;  2D92 A;  2JIK A;  2PKT A;  3K50 A;  5DTH A;  2CS5 A;  2JIL A;  3NFK A;  1P1D A;  3ID2 A;  1FCF A;  1N7E A;  4JOR A;  2Q9V A;  5HET A;  3HPK A;  2I1N A;  4HOP B;  3PV2 A;  4JOE A;  3B76 A;  2PDZ A;  2EXG A;  1WIF A;  1W9O A;  1P1E A;  1UJU A;  2G5M B;  1M5Z A;  4NXR A;  1LCY A;  3MH7 A;  1U39 A;  1Q3P A;  1UEZ A;  2H3L A;  1VJ6 A;  3OU0 A;  5A2P A;  1UFX A;  4K78 A;  2D8I A;  5EZ0 A;  4EDJ A;  3HVQ C;  3MH6 A;  3LNY A;  4NMT A;  3GDV A;  1K32 A;  2YTW A;  2DB5 A;  2I0L A;  3FY5 A;  2V1W A;  3QE1 A;  4JOH A;  4JOG A;  2KBS A;  2RRM A;  4OAJ A;  4WYT A;  2DAZ A;  1UM1 A;  2JIN A;  4Z33 A;  1UIT A;  3DJ1 A;  3CBY A;  2VPH A;  4O06 A;  2EDP A;  5HFF A;  2LA8 A;  1MFL A;  3R69 A;  1Z86 A;  3O46 A;  1OZI A;  4OEP A;  2HE4 A;  2VZ5 A;  4R2Z A;  2QKU A;  5H3J A;  2YUY A;  1I16 A;  4NMS A;  2KJP A;  2EGO A;  2GZV A;  3PS4 A;  3CH8 A;  3I4W A;  2EEH A;  2KPK A;  4NMO A;  2OPG A;  2M0V A;  3PV4 A;  4LMM A;  2DKR A;  5G1D A;  3VQG A;  4Q3H A;  2EHR A;  2AWU A;  5F67 A;  2EDZ A;  1Q3O A;  4NNL A;  1TQ3 A;  1X8S A;  5JXB A;  2X7Z A;  4UU5 A;  4XHV A;  2LOB A;  1MFG A;  2DJT A;  2MHO A;  2JOA A;  3SFJ A;  1KY9 A;  5HJ1 A;  3K82 A;  2M0T A;  1IU2 A;  2F5Y A;  4GHN A;  2KOH A;  4K75 A;  2O2T A;  3CBX A;  3PDV A;  2KJD A;  1GM1 A;  1FC6 A;  1ZUB A;  2FCF A;  2OGP A;  3QO6 A;  2IWQ A;  2JWE A;  3QIK A;  3CC0 A;  2OMJ A;  4OEO A;  2D90 A;  1V62 A;  1WHA A;  4JOF A;  5HFC A;  4E34 A;  2H2B A;  1BFE A;  2LC7 A;  2EEJ A; 
#chains in the Genus database with same CATH topology
 1N6E A;  1WF8 A;  5GLJ A;  2YT7 A;  2KG2 A;  3ID3 A;  2K1Z A;  1OBY A;  2PKU A;  2EGK A;  4Q2N A;  1U3B A;  1V6B A;  2VSP A;  2R4H A;  4P2A B;  1GQ5 A;  3GSL A;  3EGH C;  2VRF A;  2HE2 A;  3OTP A;  3DIW A;  2LUI A;  1V1T A;  2PZD A;  2P3W A;  1UJD A;  2PA1 A;  1N7T A;  3GCN A;  2PNT A;  4K72 A;  1MC7 A;  1R6J A;  3ID4 A;  2EJY A;  1FC7 A;  2H3M A;  1WHD A;  3GAB A;  2OSG A;  2ZPL A;  1G9O A;  4K6Y A;  3KDK A;  1WF7 A;  3QGL A;  3ID1 A;  1Y8T A;  1TP3 A;  1UM7 A;  2QT5 A;  2M0U A;  3NCV A;  5E1Y A;  2OQS A;  2I4S A;  1WFG A;  3K1R A;  2FE5 A;  4IC6 A;  2Z9I A;  5IL9 A;  2EAQ A;  3DJA A;  1V5Q A;  2KOJ A;  2VWR A;  1T2M A;  2QKV A;  4G69 A;  1XZ9 A;  5G1E A;  3JXT A;  2EEG A;  2RCZ A;  1X45 A;  2OS6 A;  4F8K A;  1WI2 A;  2M10 A;  2IWO A;  5F3X A;  2L4T A;  2W4F A;  3E17 A;  3GDS A;  4P0C A;  5B42 A;  2QG1 A;  3SHW A;  1WFV A;  5I7Z A;  3CBZ A;  1N7F A;  2EV8 A;  2KV8 A;  3DJ3 A;  1QLC A;  1WG6 A;  1X5Q A;  5HEB A;  4E35 A;  2G2L A;  4Q6H A;  2E7K A;  2F0A A;  2Q3G A;  3NGH A;  1VB7 A;  4Q2P A;  3ZRT A;  3SHU A;  1KWA A;  3EGG C;  4UU6 A;  4PQW A;  5HFB A;  1RY4 A;  2AIN A;  1VCW A;  2JSN A;  5HF4 A;  1OBZ A;  1RGW A;  3KZE A;  2DLS A;  4NXQ A;  2FNE A;  4AMH A;  2I0I A;  1Y7N A;  2KPL A;  1GQ4 A;  1X5R A;  2BYG A;  3SUZ A;  1PDR A;  2OCS A;  3BPU A;  3TSV A;  3TSZ A;  2UZC A;  1U37 A;  4JJ3 A;  2MX6 A;  2M3M A;  1UEQ A;  3VQF A;  1QAV A;  3STJ A;  4KFW A;  3TSW A;  1NTE A;  1RGR A;  4H11 A;  2REY A;  3NFL A;  3I18 A;  5E11 A;  2QBW A;  2W7R A;  5FHT A;  1TE0 A;  1N99 A;  1YBO A;  4JL7 A;  3RL8 A;  3O5N A;  4YDP A;  1WJL A;  2AWX A;  1SOT A;  5GND A;  3CYY A;  3GGE A;  2K20 A;  1VA8 A;  3L4F D;  4KFV A;  3AXA A;  4JOK A;  1Q7X A;  2OZF A;  5E21 A;  1SOZ A;  4RI0 A;  4JOP A;  5EYZ A;  4MPA A;  1U38 A;  1TP5 A;  3R0H A;  2H2C A;  1X9Z A;  2GEF A;  2QKT A;  2YT8 A;  1NF3 C;  1W9E A;  1BE9 A;  1RZX A;  3HPM A;  5FB8 C;  2L4S A;  3MH4 A;  1B8Q A;  2KQF A;  1W9Q A;  2WL7 A;  1L6O A;  3GJ9 A;  2KJK A;  3KZD A;  4FGM A;  2EEI A;  1QAU A;  5E6P B;  3TMH A;  4E3B A;  1N6D A;  2L97 A;  1VAE A;  3PV5 A;  2YUB A;  4NMV A;  5D13 A;  2KL1 A;  3GCO A;  4HOP A;  4NMQ A;  1I92 A;  5HED A;  1UHP A;  1WH1 A;  2ZPM A;  1UEP A;  3SOE A;  2HGA A;  3R68 A;  2KYL A;  4N6X A;  2KAW A;  2DM8 A;  2EGN A;  1X6D A;  3DOR A;  3I1E A;  1D5G A;  4JOJ A;  2JRE A;  2LC6 A;  2I6V A;  5ILB A;  4NMR A;  4WYU A;  2Z17 A;  2AWW A;  3LNX A;  4Q2Q A;  4Q6S A;  4YYX A;  1WI4 A;  5E22 A;  3RL7 A;  4GVC A;  2DC2 A;  1QAV B;  2IWP A;  3CS0 A;  2KOM A;  1IU0 A;  3QDO A;  1Z87 A;  1OBX A;  1KEF A;  4K76 A;  1ZOK A;  1N6F A;  4NNM A;  2KA9 A;  4REY A;  3RLE A;  3WKM A;  2DMZ A;  2CSS A;  5HDY A;  5HFD A;  2ENO A;  4FLN A;  4Z8J A;  2I04 A;  4L8N A;  2DLU A;  1X5N A;  2KRG A;  2EDV A;  4NMP A;  3QJN A;  2V90 A;  2JXO A;  5B6L A;  2FN5 A;  2M0Z A;  1UEW A;  1UJV A;  3PDZ A;  3KHF A;  3WKL A;  3QJM A;  2VSV A;  5HEY A;  3GDU A;  4Q2O A;  1UF1 A;  2IWN A;  4GVD A;  2R3Y A;  5HFE A;  1IHJ A;  4NXP A;  1FC9 A;  1V5L A;  2CSJ A;  5HF1 A;  2D92 A;  2JIK A;  2PKT A;  3K50 A;  5DTH A;  2CS5 A;  2JIL A;  3NFK A;  1P1D A;  3ID2 A;  1FCF A;  1N7E A;  4JOR A;  2Q9V A;  5HET A;  3HPK A;  2I1N A;  4HOP B;  3PV2 A;  4JOE A;  3B76 A;  2PDZ A;  2EXG A;  1WIF A;  1W9O A;  1P1E A;  1UJU A;  2G5M B;  1M5Z A;  4NXR A;  1LCY A;  3MH7 A;  1U39 A;  1Q3P A;  1UEZ A;  2H3L A;  1VJ6 A;  3OU0 A;  5A2P A;  1UFX A;  4K78 A;  2D8I A;  5EZ0 A;  4EDJ A;  3HVQ C;  3MH6 A;  3LNY A;  4NMT A;  3GDV A;  1K32 A;  2YTW A;  2DB5 A;  2I0L A;  3FY5 A;  2V1W A;  3QE1 A;  4JOH A;  4JOG A;  2KBS A;  2RRM A;  4OAJ A;  4WYT A;  2DAZ A;  1UM1 A;  2JIN A;  4Z33 A;  1UIT A;  3DJ1 A;  3CBY A;  2VPH A;  4O06 A;  2EDP A;  5HFF A;  2LA8 A;  1MFL A;  3R69 A;  1Z86 A;  3O46 A;  1OZI A;  4OEP A;  2HE4 A;  2VZ5 A;  4R2Z A;  2QKU A;  5H3J A;  2YUY A;  1I16 A;  4NMS A;  2KJP A;  2EGO A;  2GZV A;  3PS4 A;  3CH8 A;  3I4W A;  2EEH A;  2KPK A;  4NMO A;  2OPG A;  2M0V A;  3PV4 A;  4LMM A;  2DKR A;  5G1D A;  3VQG A;  4Q3H A;  2EHR A;  2AWU A;  5F67 A;  2EDZ A;  1Q3O A;  4NNL A;  1TQ3 A;  1X8S A;  5JXB A;  2X7Z A;  4UU5 A;  4XHV A;  2LOB A;  1MFG A;  2DJT A;  2MHO A;  2JOA A;  4JJ0 A;  3SFJ A;  1KY9 A;  5HJ1 A;  3K82 A;  2M0T A;  1IU2 A;  2F5Y A;  4GHN A;  2KOH A;  4K75 A;  2O2T A;  3CBX A;  3PDV A;  2KJD A;  1GM1 A;  1FC6 A;  1ZUB A;  2FCF A;  2OGP A;  3QO6 A;  2IWQ A;  2JWE A;  3QIK A;  3CC0 A;  2OMJ A;  3KDG A;  4OEO A;  2D90 A;  1V62 A;  1WHA A;  4JOF A;  5HFC A;  4E34 A;  2H2B A;  1BFE A;  2LC7 A;  2EEJ A; 
#chains in the Genus database with same CATH homology
 1N6E A;  1WF8 A;  5GLJ A;  2YT7 A;  2KG2 A;  3ID3 A;  2K1Z A;  1OBY A;  2PKU A;  2EGK A;  4Q2N A;  1U3B A;  1V6B A;  2VSP A;  2R4H A;  4P2A B;  1GQ5 A;  3GSL A;  3EGH C;  2VRF A;  2HE2 A;  3OTP A;  3DIW A;  2LUI A;  1V1T A;  2PZD A;  2P3W A;  1UJD A;  2PA1 A;  1N7T A;  3GCN A;  2PNT A;  4K72 A;  1MC7 A;  1R6J A;  3ID4 A;  2EJY A;  1FC7 A;  2H3M A;  1WHD A;  3GAB A;  2OSG A;  2ZPL A;  1G9O A;  4K6Y A;  3KDK A;  1WF7 A;  3QGL A;  3ID1 A;  1Y8T A;  1TP3 A;  1UM7 A;  2QT5 A;  2M0U A;  3NCV A;  5E1Y A;  2OQS A;  2I4S A;  1WFG A;  3K1R A;  2FE5 A;  4IC6 A;  2Z9I A;  5IL9 A;  2EAQ A;  3DJA A;  1V5Q A;  2KOJ A;  2VWR A;  1T2M A;  2QKV A;  4G69 A;  1XZ9 A;  5G1E A;  3JXT A;  2EEG A;  2RCZ A;  1X45 A;  2OS6 A;  4F8K A;  1WI2 A;  2M10 A;  2IWO A;  5F3X A;  2L4T A;  2W4F A;  3E17 A;  3GDS A;  4P0C A;  5B42 A;  2QG1 A;  3SHW A;  1WFV A;  5I7Z A;  3CBZ A;  1N7F A;  2EV8 A;  2KV8 A;  3DJ3 A;  1QLC A;  1WG6 A;  1X5Q A;  5HEB A;  4E35 A;  2G2L A;  4Q6H A;  2E7K A;  2F0A A;  2Q3G A;  3NGH A;  1VB7 A;  4Q2P A;  3ZRT A;  3SHU A;  1KWA A;  3EGG C;  4UU6 A;  4PQW A;  5HFB A;  1RY4 A;  2AIN A;  1VCW A;  2JSN A;  5HF4 A;  1OBZ A;  1RGW A;  3KZE A;  2DLS A;  4NXQ A;  2FNE A;  4AMH A;  2I0I A;  1Y7N A;  2KPL A;  1GQ4 A;  1X5R A;  2BYG A;  3SUZ A;  1PDR A;  2OCS A;  3BPU A;  3TSV A;  3TSZ A;  2UZC A;  1U37 A;  4JJ3 A;  2MX6 A;  2M3M A;  1UEQ A;  3VQF A;  1QAV A;  3STJ A;  4KFW A;  3TSW A;  1NTE A;  1RGR A;  4H11 A;  2REY A;  3NFL A;  3I18 A;  5E11 A;  2QBW A;  2W7R A;  5FHT A;  1TE0 A;  1N99 A;  1YBO A;  4JL7 A;  3RL8 A;  3O5N A;  4YDP A;  1WJL A;  2AWX A;  1SOT A;  5GND A;  3CYY A;  3GGE A;  2K20 A;  1VA8 A;  3L4F D;  4KFV A;  3AXA A;  4JOK A;  1Q7X A;  2OZF A;  5E21 A;  1SOZ A;  4RI0 A;  4JOP A;  5EYZ A;  4MPA A;  1U38 A;  1TP5 A;  3R0H A;  2H2C A;  1X9Z A;  2GEF A;  2QKT A;  2YT8 A;  1NF3 C;  1W9E A;  1BE9 A;  1RZX A;  3HPM A;  5FB8 C;  2L4S A;  3MH4 A;  1B8Q A;  2KQF A;  1W9Q A;  2WL7 A;  1L6O A;  3GJ9 A;  2KJK A;  3KZD A;  4FGM A;  2EEI A;  1QAU A;  5E6P B;  3TMH A;  4E3B A;  1N6D A;  2L97 A;  1VAE A;  3PV5 A;  2YUB A;  4NMV A;  5D13 A;  2KL1 A;  3GCO A;  4HOP A;  4NMQ A;  1I92 A;  5HED A;  1UHP A;  1WH1 A;  2ZPM A;  1UEP A;  3SOE A;  2HGA A;  3R68 A;  2KYL A;  4N6X A;  2KAW A;  2DM8 A;  2EGN A;  1X6D A;  3DOR A;  3I1E A;  1D5G A;  4JOJ A;  2JRE A;  2LC6 A;  2I6V A;  5ILB A;  4NMR A;  4WYU A;  2Z17 A;  2AWW A;  3LNX A;  4Q2Q A;  4Q6S A;  4YYX A;  1WI4 A;  5E22 A;  3RL7 A;  4GVC A;  2DC2 A;  1QAV B;  2IWP A;  3CS0 A;  2KOM A;  1IU0 A;  3QDO A;  1Z87 A;  1OBX A;  1KEF A;  4K76 A;  1ZOK A;  1N6F A;  4NNM A;  2KA9 A;  4REY A;  3RLE A;  3WKM A;  2DMZ A;  2CSS A;  5HDY A;  5HFD A;  2ENO A;  4FLN A;  4Z8J A;  2I04 A;  4L8N A;  2DLU A;  1X5N A;  2KRG A;  2EDV A;  4NMP A;  3QJN A;  2V90 A;  2JXO A;  5B6L A;  2FN5 A;  2M0Z A;  1UEW A;  1UJV A;  3PDZ A;  3KHF A;  3WKL A;  3QJM A;  2VSV A;  5HEY A;  3GDU A;  4Q2O A;  1UF1 A;  2IWN A;  4GVD A;  2R3Y A;  5HFE A;  1IHJ A;  4NXP A;  1FC9 A;  1V5L A;  2CSJ A;  5HF1 A;  2D92 A;  2JIK A;  2PKT A;  3K50 A;  5DTH A;  2CS5 A;  2JIL A;  3NFK A;  1P1D A;  3ID2 A;  1FCF A;  1N7E A;  4JOR A;  2Q9V A;  5HET A;  3HPK A;  2I1N A;  4HOP B;  3PV2 A;  4JOE A;  3B76 A;  2PDZ A;  2EXG A;  1WIF A;  1W9O A;  1P1E A;  1UJU A;  2G5M B;  1M5Z A;  4NXR A;  1LCY A;  3MH7 A;  1U39 A;  1Q3P A;  1UEZ A;  2H3L A;  1VJ6 A;  3OU0 A;  5A2P A;  1UFX A;  4K78 A;  2D8I A;  5EZ0 A;  4EDJ A;  3HVQ C;  3MH6 A;  3LNY A;  4NMT A;  3GDV A;  1K32 A;  2YTW A;  2DB5 A;  2I0L A;  3FY5 A;  2V1W A;  3QE1 A;  4JOH A;  4JOG A;  2KBS A;  2RRM A;  4OAJ A;  4WYT A;  2DAZ A;  1UM1 A;  2JIN A;  4Z33 A;  1UIT A;  3DJ1 A;  3CBY A;  2VPH A;  4O06 A;  2EDP A;  5HFF A;  2LA8 A;  1MFL A;  3R69 A;  1Z86 A;  3O46 A;  1OZI A;  4OEP A;  2HE4 A;  2VZ5 A;  4R2Z A;  2QKU A;  5H3J A;  2YUY A;  1I16 A;  4NMS A;  2KJP A;  2EGO A;  2GZV A;  3PS4 A;  3CH8 A;  3I4W A;  2EEH A;  2KPK A;  4NMO A;  2OPG A;  2M0V A;  3PV4 A;  4LMM A;  2DKR A;  5G1D A;  3VQG A;  4Q3H A;  2EHR A;  2AWU A;  5F67 A;  2EDZ A;  1Q3O A;  4NNL A;  1TQ3 A;  1X8S A;  5JXB A;  2X7Z A;  4UU5 A;  4XHV A;  2LOB A;  1MFG A;  2DJT A;  2MHO A;  2JOA A;  4JJ0 A;  3SFJ A;  1KY9 A;  5HJ1 A;  3K82 A;  2M0T A;  1IU2 A;  2F5Y A;  4GHN A;  2KOH A;  4K75 A;  2O2T A;  3CBX A;  3PDV A;  2KJD A;  1GM1 A;  1FC6 A;  1ZUB A;  2FCF A;  2OGP A;  3QO6 A;  2IWQ A;  2JWE A;  3QIK A;  3CC0 A;  2OMJ A;  3KDG A;  4OEO A;  2D90 A;  1V62 A;  1WHA A;  4JOF A;  5HFC A;  4E34 A;  2H2B A;  1BFE A;  2LC7 A;  2EEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...