2CSSA

Solution structure of the pdz domain of human kiaa0340 protein
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
121
structure length
121
Chain Sequence
GSSGSSGVTWQPSKEGDRLIGRVILNKRTTMPKDSGALLGLKVVGGKMTDLGRLGAFITKVKKGSLADVVGHLRAGDEVLEWNGKPLPGATNEEVYNIILESKSEPQVEIIVSRPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords Regulating synaptic membrane exocytosis protein 1
publication title Solution structure of the PDZ domain of human KIAA0340 protein
rcsb
source organism Homo sapiens
total genus 18
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00595 PDZ PDZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.42.10 Mainly Beta Roll Pdz3 Domain Pdz3 Domain 2cssA00
2O2TA 1VCWA 2EEHA 3I1EA 4NNMA 4NXPA 5HFFA 3DIWA 2KOJA 1UEZA 4E34A 1U39A 4JL7A 2FN5A 1TP3A 3TSVA 1KY9A 2L4TA 3LNYA 2JWEA 4Z33A 1I16A 1WFGA 2QT5A 4NMOA 2LA8A 2MHOA 2JOAA 1X5RA 4Q2QA 3R0HA 1WF8A 5D13A 4GVCA 4K6YA 3DJ3A 4JOFA 1N99A 2KJDA 2L97A 2K20A 1WG6A 2Q9VA 1ZOKA 1IHJA 3OTPA 2I0IA 4Q2OA 2YTWA 2Z17A 3KHFA 2EEIA 5DTHA 2D90A 3K50A 2AWUA 2Q3GA 2JINA 4Q6SA 1Q7XA 1WI2A 4F8KA 3GJ9A 1W9OA 1UJUA 2PKUA 1UEWA 1Y7NA 4Q3HA 2DMZA 5EYZA 5EZ0A 1U3BA 1UFXA 1WH1A 4N6XA 2PKTA 4UU5A 1RY4A 2KOMA 1V6BA 2DB5A 3QDOA 2I4SA 1UEQA 1FC9A 2YUBA 4NXRA 3NFLA 1YBOA 1VB7A 3CH8A 3QGLA 1FC7A 1OZIA 1WHDA 2ENOA 3GSLA 3DJ1A 2EDVA 1GQ5A 4FGMA 4Q6HA 4MPAA 1NF3C 2MX6A 3GDUA 2KPLA 3SOEA 2IWNA 1UJVA 1X5NA 3TMHA 1G9OA 2KOHA 2DKRA 4NMVA 2VSVA 5E6PB 2W4FA 5G1DA 1OBYA 1OBXA 4K75A 1FC6A 2M0UA 2EJYA 2FE5A 2AWXA 3GCOA 4OAJA 2OSGA 1IU2A 1B8QA 2OS6A 3EGHC 2JXOA 1D5GA 1Z86A 5F3XA 2M0TA 1V5QA 3SUZA 1SOTA 1V5LA 2CS5A 5GNDA 1N7EA 2EDZA 1LCYA 2KV8A 5HEYA 1UM7A 4PQWA 2REYA 3KZDA 2M3MA 3QO6A 1U37A 3ID2A 3QIKA 5G1EA 2BYGA 2HE2A 5HEBA 3VQGA 4RI0A 2LUIA 3TSWA 1RGRA 2PA1A 3CBXA 3HPKA 2JREA 4YDPA 5JXBA 4Q2NA 4KFWA 1I92A 4JOGA 2QKUA 4Q2PA 2DJTA 1N7TA 4GVDA 3QJMA 3GDSA 4KFVA 1Q3PA 3EGGC 2DLSA 2H3MA 3NGHA 1N6EA 4NNLA 2KAWA 2I0LA 2DC2A 4P2AB 2KBSA 4E35A 4OEOA 4YYXA 3QE1A 3PS4A 3CC0A 1UJDA 2YUYA 2I1NA 4HOPB 4NMSA 3O5NA 4NMRA 1QAVA 3PDVA 3PV5A 3SHWA 3PV2A 3DORA 2R3YA 1N6FA 5HFDA 2VSPA 2LC6A 2VWRA 1XZ9A 2KYLA 1TE0A 2D92A 3WKLA 2QKTA 3MH7A 4GHNA 3CS0A 5FHTA 2F5YA 5HDYA 2OQSA 4IC6A 2KJKA 2I6VA 3OU0A 3NFKA 3BPUA 5HF1A 3O46A 2KRGA 2H2CA 1QAUA 2EXGA 1N6DA 2IWQA 1GM1A 5HFEA 1M5ZA 4L8NA 1X45A 3GCNA 3CYYA 2K1ZA 2EV8A 2YT7A 2V90A 2ZPLA 2KG2A 2M0VA 5H3JA 3ZRTA 1ZUBA 2W7RA 4NMPA 1WFVA 2RCZA 3MH6A 2OZFA 2V1WA 1WI4A 2KA9A 4NMQA 1X6DA 5FB8C 2KPKA 1P1DA 2AWWA 1V1TA 5E22A 5HJ1A 4WYUA 2G5MB 1W9EA 3STJA 2JIKA 2EHRA 2H2BA 2VZ5A 3K82A 3RL8A 4JOJA 2WL7A 4O06A 2EAQA 2P3WA 2KQFA 2VRFA 1PDRA 3HPMA 1W9QA 2VPHA 2OCSA 1WF7A 2IWOA 2Z9IA 3SHUA 2DM8A 2FNEA 4HOPA 1V62A 2CSSA 1UM1A 2I04A 3PDZA 2L4SA 5HFBA 1X8SA 1SOZA 1P1EA 1QLCA 2LOBA 1BFEA 4G69A 4EDJA 2M10A 2EEJA 2E7KA 1OBZA 1FCFA 1Z87A 3CBZA 2EGKA 4JOKA 2FCFA 2M0ZA 5F67A 1UHPA 2G2LA 3RL7A 3R69A 2CSJA 2D8IA 1NTEA 3R68A 1R6JA 2OPGA 4K72A 2GZVA 4R2ZA 5GLJA 3FY5A 3GGEA 2DAZA 5E1YA 2DLUA 2F0AA 4NMTA 2IWPA 1UF1A 3I4WA 4JOEA 3QJNA 2EDPA 3LNXA 3VQFA 2ZPMA 4LMMA 2EEGA 1WJLA 2QKVA 1Y8TA 5HEDA 3WKMA 1X5QA 2QG1A 4JOHA 3HVQC 1L6OA 2HE4A 1WIFA 3DJAA 2LC7A 2UZCA 1UITA 1T2MA 2X7ZA 1N7FA 5I7ZA 2AINA 1MFLA 1MFGA 2YT8A 1VAEA 3GDVA 3PV4A 4OEPA 4K76A 5E11A 1IU0A 2OMJA 3ID4A 4XHVA 2KJPA 3RLEA 3JXTA 1Q3OA 5HF4A 3CBYA 1MC7A 3E17A 1U38A 4AMHA 3ID3A 4K78A 5B6LA 2PZDA 4JOPA 2PDZA 3SFJA 1BE9A 2KL1A 2RRMA 1K32A 2JILA 1TQ3A 1RGWA 1TP5A 4P0CA 3K1RA 2H3LA 3B76A 2EGOA 4UU6A 3TSZA 1GQ4A 2PNTA 4E3BA 4REYA 1UEPA 5E21A 3L4FD 2QBWA 5HETA 1QAVB 3AXAA 1WHAA 1VJ6A 3ID1A 3KZEA 1KEFA 2HGAA 2OGPA 2R4HA 1KWAA 1VA8A 4H11A 4WYTA 4NXQA 4Z8JA 5A2PA 3MH4A 5HFCA 2EGNA 3I18A 4JORA 1RZXA
chains in the Genus database with same CATH superfamily
2O2TA 1VCWA 2EEHA 3I1EA 4NNMA 4NXPA 5HFFA 3DIWA 2KOJA 1UEZA 4E34A 1U39A 4JL7A 2FN5A 1TP3A 3TSVA 1KY9A 2L4TA 3LNYA 2JWEA 4Z33A 1I16A 1WFGA 2QT5A 4NMOA 2LA8A 2MHOA 2JOAA 1X5RA 4Q2QA 3R0HA 1WF8A 5D13A 4GVCA 4K6YA 3DJ3A 3KDGA 4JOFA 1N99A 2KJDA 2L97A 2K20A 1WG6A 2Q9VA 4JJ3A 1ZOKA 1IHJA 3OTPA 2I0IA 4Q2OA 2YTWA 2Z17A 3KHFA 2EEIA 5DTHA 2D90A 3K50A 2AWUA 2Q3GA 2JINA 4Q6SA 1Q7XA 1WI2A 4F8KA 3GJ9A 1W9OA 1UJUA 2PKUA 1UEWA 1Y7NA 4Q3HA 2DMZA 5EYZA 5EZ0A 1U3BA 1UFXA 1WH1A 4N6XA 2PKTA 4UU5A 1RY4A 2KOMA 1V6BA 2DB5A 3QDOA 2I4SA 1UEQA 1FC9A 2YUBA 4NXRA 3NFLA 1YBOA 1VB7A 3CH8A 3QGLA 1FC7A 1OZIA 1WHDA 2ENOA 3GSLA 3DJ1A 2EDVA 1GQ5A 4FGMA 4Q6HA 4MPAA 1NF3C 2MX6A 3GDUA 2KPLA 3SOEA 2IWNA 1X9ZA 1UJVA 1X5NA 3TMHA 1G9OA 2KOHA 2DKRA 4NMVA 2VSVA 5E6PB 2W4FA 5G1DA 1OBYA 1OBXA 4K75A 1FC6A 2M0UA 2EJYA 2FE5A 2AWXA 3GCOA 4OAJA 2OSGA 1IU2A 1B8QA 5IL9A 2OS6A 3EGHC 2JXOA 1D5GA 1Z86A 5F3XA 2M0TA 1V5QA 5ILBA 3SUZA 1SOTA 1V5LA 2CS5A 5GNDA 1N7EA 2EDZA 1LCYA 2KV8A 5HEYA 1UM7A 4PQWA 2REYA 3KZDA 2M3MA 3QO6A 1U37A 3ID2A 3QIKA 5G1EA 2BYGA 2HE2A 5HEBA 3VQGA 4RI0A 2LUIA 3TSWA 1RGRA 2PA1A 3CBXA 3GABA 3HPKA 2JREA 4YDPA 5JXBA 4Q2NA 4KFWA 1I92A 4JOGA 2QKUA 4JJ0A 4Q2PA 2DJTA 1N7TA 4GVDA 3QJMA 3GDSA 4KFVA 1Q3PA 3EGGC 2DLSA 2H3MA 3NGHA 1N6EA 4NNLA 2KAWA 2I0LA 2DC2A 4P2AB 2KBSA 4E35A 3NCVA 4OEOA 4YYXA 3QE1A 3PS4A 3CC0A 1UJDA 2YUYA 2I1NA 4HOPB 4NMSA 3O5NA 4NMRA 1QAVA 3PDVA 3PV5A 3SHWA 3PV2A 3DORA 2R3YA 1N6FA 5HFDA 2VSPA 2LC6A 2VWRA 1XZ9A 2KYLA 1TE0A 2D92A 3WKLA 2QKTA 3MH7A 4GHNA 3CS0A 5FHTA 2F5YA 5HDYA 2OQSA 4IC6A 2KJKA 2I6VA 3OU0A 3NFKA 3BPUA 5HF1A 3O46A 2KRGA 2H2CA 1QAUA 2EXGA 1N6DA 2IWQA 1GM1A 5HFEA 1M5ZA 4L8NA 1X45A 3GCNA 3CYYA 2K1ZA 2EV8A 2YT7A 2V90A 2ZPLA 2KG2A 2M0VA 5H3JA 3ZRTA 1ZUBA 2W7RA 4NMPA 1WFVA 2RCZA 3MH6A 2OZFA 2V1WA 1WI4A 2KA9A 4NMQA 1X6DA 5FB8C 2KPKA 1P1DA 2AWWA 1V1TA 5E22A 5HJ1A 4WYUA 2G5MB 1W9EA 3STJA 2JIKA 2EHRA 2H2BA 2VZ5A 3K82A 3RL8A 4JOJA 2WL7A 4O06A 2EAQA 2P3WA 2KQFA 2VRFA 1PDRA 3HPMA 1W9QA 2VPHA 2OCSA 1WF7A 2IWOA 2Z9IA 3SHUA 2DM8A 2FNEA 4HOPA 1V62A 2CSSA 2JSNA 1UM1A 2I04A 3PDZA 2L4SA 5HFBA 1X8SA 1SOZA 1P1EA 1QLCA 2LOBA 1BFEA 4G69A 4EDJA 2M10A 2EEJA 2E7KA 1OBZA 1FCFA 1Z87A 3CBZA 2EGKA 4JOKA 2FCFA 2M0ZA 5F67A 1UHPA 2G2LA 3RL7A 3R69A 2CSJA 2D8IA 1NTEA 3R68A 1R6JA 2OPGA 4K72A 2GZVA 4R2ZA 5GLJA 3FY5A 3GGEA 2DAZA 5E1YA 2DLUA 2F0AA 4NMTA 2IWPA 1UF1A 3I4WA 4JOEA 3QJNA 2EDPA 3LNXA 3VQFA 2GEFA 2ZPMA 4LMMA 2EEGA 1WJLA 2QKVA 1Y8TA 5HEDA 3WKMA 1X5QA 2QG1A 4JOHA 3HVQC 1L6OA 2HE4A 1WIFA 3DJAA 2LC7A 2UZCA 4FLNA 1UITA 1T2MA 2X7ZA 1N7FA 5I7ZA 2AINA 3KDKA 1MFLA 1MFGA 2YT8A 1VAEA 3GDVA 5B42A 3PV4A 4OEPA 4K76A 5E11A 1IU0A 2OMJA 3ID4A 4XHVA 2KJPA 3RLEA 3JXTA 1Q3OA 5HF4A 3CBYA 1MC7A 3E17A 1U38A 4AMHA 3ID3A 4K78A 5B6LA 2PZDA 4JOPA 2PDZA 3SFJA 1BE9A 2KL1A 2RRMA 1K32A 2JILA 1TQ3A 1RGWA 1TP5A 4P0CA 3K1RA 2H3LA 3B76A 2EGOA 4UU6A 3TSZA 1GQ4A 2PNTA 4E3BA 4REYA 1UEPA 5E21A 3L4FD 2QBWA 5HETA 1QAVB 3AXAA 1WHAA 1VJ6A 3ID1A 3KZEA 1KEFA 2HGAA 2OGPA 2R4HA 1KWAA 1VA8A 4H11A 4WYTA 4NXQA 4Z8JA 5A2PA 3MH4A 5HFCA 2EGNA 3I18A 4JORA 1RZXA
chains in the Genus database with same CATH topology
2O2TA 1VCWA 2EEHA 3I1EA 4NNMA 4NXPA 5HFFA 3DIWA 2KOJA 1UEZA 4E34A 1U39A 4JL7A 2FN5A 1TP3A 3TSVA 1KY9A 2L4TA 3LNYA 2JWEA 4Z33A 1I16A 1WFGA 2QT5A 4NMOA 2LA8A 2MHOA 2JOAA 1X5RA 4Q2QA 3R0HA 1WF8A 5D13A 4GVCA 4K6YA 3DJ3A 3KDGA 4JOFA 1N99A 2KJDA 2L97A 2K20A 1WG6A 2Q9VA 4JJ3A 1ZOKA 1IHJA 3OTPA 2I0IA 4Q2OA 2YTWA 2Z17A 3KHFA 2EEIA 5DTHA 2D90A 3K50A 2AWUA 2Q3GA 2JINA 4Q6SA 1Q7XA 1WI2A 4F8KA 3GJ9A 1W9OA 1UJUA 2PKUA 1UEWA 1Y7NA 4Q3HA 2DMZA 5EYZA 5EZ0A 1U3BA 1UFXA 1WH1A 4N6XA 2PKTA 4UU5A 1RY4A 2KOMA 1V6BA 2DB5A 3QDOA 2I4SA 1UEQA 1FC9A 2YUBA 4NXRA 3NFLA 1YBOA 1VB7A 3CH8A 3QGLA 1FC7A 1OZIA 1WHDA 2ENOA 3GSLA 3DJ1A 2EDVA 1GQ5A 4FGMA 4Q6HA 4MPAA 1NF3C 2MX6A 3GDUA 2KPLA 3SOEA 2IWNA 1X9ZA 1UJVA 1X5NA 3TMHA 1G9OA 2KOHA 2DKRA 4NMVA 2VSVA 5E6PB 2W4FA 5G1DA 1OBYA 1OBXA 4K75A 1FC6A 2M0UA 2EJYA 2FE5A 2AWXA 3GCOA 4OAJA 2OSGA 1IU2A 1B8QA 5IL9A 2OS6A 3EGHC 2JXOA 1D5GA 1Z86A 5F3XA 2M0TA 1V5QA 5ILBA 3SUZA 1SOTA 1V5LA 2CS5A 5GNDA 1N7EA 2EDZA 1LCYA 2KV8A 5HEYA 1UM7A 4PQWA 2REYA 3KZDA 2M3MA 3QO6A 1U37A 3ID2A 3QIKA 5G1EA 2BYGA 2HE2A 5HEBA 3VQGA 4RI0A 2LUIA 3TSWA 1RGRA 2PA1A 3CBXA 3GABA 3HPKA 2JREA 4YDPA 5JXBA 4Q2NA 4KFWA 1I92A 4JOGA 2QKUA 4JJ0A 4Q2PA 2DJTA 1N7TA 4GVDA 3QJMA 3GDSA 4KFVA 1Q3PA 3EGGC 2DLSA 2H3MA 3NGHA 1N6EA 4NNLA 2KAWA 2I0LA 2DC2A 4P2AB 2KBSA 4E35A 3NCVA 4OEOA 4YYXA 3QE1A 3PS4A 3CC0A 1UJDA 2YUYA 2I1NA 4HOPB 4NMSA 3O5NA 4NMRA 1QAVA 3PDVA 3PV5A 3SHWA 3PV2A 3DORA 2R3YA 1N6FA 5HFDA 2VSPA 2LC6A 2VWRA 1XZ9A 2KYLA 1TE0A 2D92A 3WKLA 2QKTA 3MH7A 4GHNA 3CS0A 5FHTA 2F5YA 5HDYA 2OQSA 4IC6A 2KJKA 2I6VA 3OU0A 3NFKA 3BPUA 5HF1A 3O46A 2KRGA 2H2CA 1QAUA 2EXGA 1N6DA 2IWQA 1GM1A 5HFEA 1M5ZA 4L8NA 1X45A 3GCNA 3CYYA 2K1ZA 2EV8A 2YT7A 2V90A 2ZPLA 2KG2A 2M0VA 5H3JA 3ZRTA 1ZUBA 2W7RA 4NMPA 1WFVA 2RCZA 3MH6A 2OZFA 2V1WA 1WI4A 2KA9A 4NMQA 1X6DA 5FB8C 2KPKA 1P1DA 2AWWA 1V1TA 5E22A 5HJ1A 4WYUA 2G5MB 1W9EA 3STJA 2JIKA 2EHRA 2H2BA 2VZ5A 3K82A 3RL8A 4JOJA 2WL7A 4O06A 2EAQA 2P3WA 2KQFA 2VRFA 1PDRA 3HPMA 1W9QA 2VPHA 2OCSA 1WF7A 2IWOA 2Z9IA 3SHUA 2DM8A 2FNEA 4HOPA 1V62A 2CSSA 2JSNA 1UM1A 2I04A 3PDZA 2L4SA 5HFBA 1X8SA 1SOZA 1P1EA 1QLCA 2LOBA 1BFEA 4G69A 4EDJA 2M10A 2EEJA 2E7KA 1OBZA 1FCFA 1Z87A 3CBZA 2EGKA 4JOKA 2FCFA 2M0ZA 5F67A 1UHPA 2G2LA 3RL7A 3R69A 2CSJA 2D8IA 1NTEA 3R68A 1R6JA 2OPGA 4K72A 2GZVA 4R2ZA 5GLJA 3FY5A 3GGEA 2DAZA 5E1YA 2DLUA 2F0AA 4NMTA 2IWPA 1UF1A 3I4WA 4JOEA 3QJNA 2EDPA 3LNXA 3VQFA 2GEFA 2ZPMA 4LMMA 2EEGA 1WJLA 2QKVA 1Y8TA 5HEDA 3WKMA 1X5QA 2QG1A 4JOHA 3HVQC 1L6OA 2HE4A 1WIFA 3DJAA 2LC7A 2UZCA 4FLNA 1UITA 1T2MA 2X7ZA 1N7FA 5I7ZA 2AINA 3KDKA 1MFLA 1MFGA 2YT8A 1VAEA 3GDVA 5B42A 3PV4A 4OEPA 4K76A 5E11A 1IU0A 2OMJA 3ID4A 4XHVA 2KJPA 3RLEA 3JXTA 1Q3OA 5HF4A 3CBYA 1MC7A 3E17A 1U38A 4AMHA 3ID3A 4K78A 5B6LA 2PZDA 4JOPA 2PDZA 3SFJA 1BE9A 2KL1A 2RRMA 1K32A 2JILA 1TQ3A 1RGWA 1TP5A 4P0CA 3K1RA 2H3LA 3B76A 2EGOA 4UU6A 3TSZA 1GQ4A 2PNTA 4E3BA 4REYA 1UEPA 5E21A 3L4FD 2QBWA 5HETA 1QAVB 3AXAA 1WHAA 1VJ6A 3ID1A 3KZEA 1KEFA 2HGAA 2OGPA 2R4HA 1KWAA 1VA8A 4H11A 4WYTA 4NXQA 4Z8JA 5A2PA 3MH4A 5HFCA 2EGNA 3I18A 4JORA 1RZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2T A;  1VCW A;  2EEH A;  3I1E A;  4NNM A;  4NXP A;  5HFF A;  3DIW A;  2KOJ A;  1UEZ A;  4E34 A;  1U39 A;  4JL7 A;  2FN5 A;  1TP3 A;  3TSV A;  1KY9 A;  2L4T A;  3LNY A;  2JWE A;  4Z33 A;  1I16 A;  1WFG A;  2QT5 A;  4NMO A;  2LA8 A;  2MHO A;  2JOA A;  1X5R A;  4Q2Q A;  3R0H A;  1WF8 A;  5D13 A;  4GVC A;  4K6Y A;  3DJ3 A;  4JOF A;  1N99 A;  2KJD A;  2L97 A;  2K20 A;  1WG6 A;  2Q9V A;  1ZOK A;  1IHJ A;  3OTP A;  2I0I A;  4Q2O A;  2YTW A;  2Z17 A;  3KHF A;  2EEI A;  5DTH A;  2D90 A;  3K50 A;  2AWU A;  2Q3G A;  2JIN A;  4Q6S A;  1Q7X A;  1WI2 A;  4F8K A;  3GJ9 A;  1W9O A;  1UJU A;  2PKU A;  1UEW A;  1Y7N A;  4Q3H A;  2DMZ A;  5EYZ A;  5EZ0 A;  1U3B A;  1UFX A;  1WH1 A;  4N6X A;  2PKT A;  4UU5 A;  1RY4 A;  2KOM A;  1V6B A;  2DB5 A;  3QDO A;  2I4S A;  1UEQ A;  1FC9 A;  2YUB A;  4NXR A;  3NFL A;  1YBO A;  1VB7 A;  3CH8 A;  3QGL A;  1FC7 A;  1OZI A;  1WHD A;  2ENO A;  3GSL A;  3DJ1 A;  2EDV A;  1GQ5 A;  4FGM A;  4Q6H A;  4MPA A;  1NF3 C;  2MX6 A;  3GDU A;  2KPL A;  3SOE A;  2IWN A;  1UJV A;  1X5N A;  3TMH A;  1G9O A;  2KOH A;  2DKR A;  4NMV A;  2VSV A;  5E6P B;  2W4F A;  5G1D A;  1OBY A;  1OBX A;  4K75 A;  1FC6 A;  2M0U A;  2EJY A;  2FE5 A;  2AWX A;  3GCO A;  4OAJ A;  2OSG A;  1IU2 A;  1B8Q A;  2OS6 A;  3EGH C;  2JXO A;  1D5G A;  1Z86 A;  5F3X A;  2M0T A;  1V5Q A;  3SUZ A;  1SOT A;  1V5L A;  2CS5 A;  5GND A;  1N7E A;  2EDZ A;  1LCY A;  2KV8 A;  5HEY A;  1UM7 A;  4PQW A;  2REY A;  3KZD A;  2M3M A;  3QO6 A;  1U37 A;  3ID2 A;  3QIK A;  5G1E A;  2BYG A;  2HE2 A;  5HEB A;  3VQG A;  4RI0 A;  2LUI A;  3TSW A;  1RGR A;  2PA1 A;  3CBX A;  3HPK A;  2JRE A;  4YDP A;  5JXB A;  4Q2N A;  4KFW A;  1I92 A;  4JOG A;  2QKU A;  4Q2P A;  2DJT A;  1N7T A;  4GVD A;  3QJM A;  3GDS A;  4KFV A;  1Q3P A;  3EGG C;  2DLS A;  2H3M A;  3NGH A;  1N6E A;  4NNL A;  2KAW A;  2I0L A;  2DC2 A;  4P2A B;  2KBS A;  4E35 A;  4OEO A;  4YYX A;  3QE1 A;  3PS4 A;  3CC0 A;  1UJD A;  2YUY A;  2I1N A;  4HOP B;  4NMS A;  3O5N A;  4NMR A;  1QAV A;  3PDV A;  3PV5 A;  3SHW A;  3PV2 A;  3DOR A;  2R3Y A;  1N6F A;  5HFD A;  2VSP A;  2LC6 A;  2VWR A;  1XZ9 A;  2KYL A;  1TE0 A;  2D92 A;  3WKL A;  2QKT A;  3MH7 A;  4GHN A;  3CS0 A;  5FHT A;  2F5Y A;  5HDY A;  2OQS A;  4IC6 A;  2KJK A;  2I6V A;  3OU0 A;  3NFK A;  3BPU A;  5HF1 A;  3O46 A;  2KRG A;  2H2C A;  1QAU A;  2EXG A;  1N6D A;  2IWQ A;  1GM1 A;  5HFE A;  1M5Z A;  4L8N A;  1X45 A;  3GCN A;  3CYY A;  2K1Z A;  2EV8 A;  2YT7 A;  2V90 A;  2ZPL A;  2KG2 A;  2M0V A;  5H3J A;  3ZRT A;  1ZUB A;  2W7R A;  4NMP A;  1WFV A;  2RCZ A;  3MH6 A;  2OZF A;  2V1W A;  1WI4 A;  2KA9 A;  4NMQ A;  1X6D A;  5FB8 C;  2KPK A;  1P1D A;  2AWW A;  1V1T A;  5E22 A;  5HJ1 A;  4WYU A;  2G5M B;  1W9E A;  3STJ A;  2JIK A;  2EHR A;  2H2B A;  2VZ5 A;  3K82 A;  3RL8 A;  4JOJ A;  2WL7 A;  4O06 A;  2EAQ A;  2P3W A;  2KQF A;  2VRF A;  1PDR A;  3HPM A;  1W9Q A;  2VPH A;  2OCS A;  1WF7 A;  2IWO A;  2Z9I A;  3SHU A;  2DM8 A;  2FNE A;  4HOP A;  1V62 A;  2CSS A;  1UM1 A;  2I04 A;  3PDZ A;  2L4S A;  5HFB A;  1X8S A;  1SOZ A;  1P1E A;  1QLC A;  2LOB A;  1BFE A;  4G69 A;  4EDJ A;  2M10 A;  2EEJ A;  2E7K A;  1OBZ A;  1FCF A;  1Z87 A;  3CBZ A;  2EGK A;  4JOK A;  2FCF A;  2M0Z A;  5F67 A;  1UHP A;  2G2L A;  3RL7 A;  3R69 A;  2CSJ A;  2D8I A;  1NTE A;  3R68 A;  1R6J A;  2OPG A;  4K72 A;  2GZV A;  4R2Z A;  5GLJ A;  3FY5 A;  3GGE A;  2DAZ A;  5E1Y A;  2DLU A;  2F0A A;  4NMT A;  2IWP A;  1UF1 A;  3I4W A;  4JOE A;  3QJN A;  2EDP A;  3LNX A;  3VQF A;  2ZPM A;  4LMM A;  2EEG A;  1WJL A;  2QKV A;  1Y8T A;  5HED A;  3WKM A;  1X5Q A;  2QG1 A;  4JOH A;  3HVQ C;  1L6O A;  2HE4 A;  1WIF A;  3DJA A;  2LC7 A;  2UZC A;  1UIT A;  1T2M A;  2X7Z A;  1N7F A;  5I7Z A;  2AIN A;  1MFL A;  1MFG A;  2YT8 A;  1VAE A;  3GDV A;  3PV4 A;  4OEP A;  4K76 A;  5E11 A;  1IU0 A;  2OMJ A;  3ID4 A;  4XHV A;  2KJP A;  3RLE A;  3JXT A;  1Q3O A;  5HF4 A;  3CBY A;  1MC7 A;  3E17 A;  1U38 A;  4AMH A;  3ID3 A;  4K78 A;  5B6L A;  2PZD A;  4JOP A;  2PDZ A;  3SFJ A;  1BE9 A;  2KL1 A;  2RRM A;  1K32 A;  2JIL A;  1TQ3 A;  1RGW A;  1TP5 A;  4P0C A;  3K1R A;  2H3L A;  3B76 A;  2EGO A;  4UU6 A;  3TSZ A;  1GQ4 A;  2PNT A;  4E3B A;  4REY A;  1UEP A;  5E21 A;  3L4F D;  2QBW A;  5HET A;  1QAV B;  3AXA A;  1WHA A;  1VJ6 A;  3ID1 A;  3KZE A;  1KEF A;  2HGA A;  2OGP A;  2R4H A;  1KWA A;  1VA8 A;  4H11 A;  4WYT A;  4NXQ A;  4Z8J A;  5A2P A;  3MH4 A;  5HFC A;  2EGN A;  3I18 A;  4JOR A;  1RZX A; 
#chains in the Genus database with same CATH topology
 2O2T A;  1VCW A;  2EEH A;  3I1E A;  4NNM A;  4NXP A;  5HFF A;  3DIW A;  2KOJ A;  1UEZ A;  4E34 A;  1U39 A;  4JL7 A;  2FN5 A;  1TP3 A;  3TSV A;  1KY9 A;  2L4T A;  3LNY A;  2JWE A;  4Z33 A;  1I16 A;  1WFG A;  2QT5 A;  4NMO A;  2LA8 A;  2MHO A;  2JOA A;  1X5R A;  4Q2Q A;  3R0H A;  1WF8 A;  5D13 A;  4GVC A;  4K6Y A;  3DJ3 A;  3KDG A;  4JOF A;  1N99 A;  2KJD A;  2L97 A;  2K20 A;  1WG6 A;  2Q9V A;  4JJ3 A;  1ZOK A;  1IHJ A;  3OTP A;  2I0I A;  4Q2O A;  2YTW A;  2Z17 A;  3KHF A;  2EEI A;  5DTH A;  2D90 A;  3K50 A;  2AWU A;  2Q3G A;  2JIN A;  4Q6S A;  1Q7X A;  1WI2 A;  4F8K A;  3GJ9 A;  1W9O A;  1UJU A;  2PKU A;  1UEW A;  1Y7N A;  4Q3H A;  2DMZ A;  5EYZ A;  5EZ0 A;  1U3B A;  1UFX A;  1WH1 A;  4N6X A;  2PKT A;  4UU5 A;  1RY4 A;  2KOM A;  1V6B A;  2DB5 A;  3QDO A;  2I4S A;  1UEQ A;  1FC9 A;  2YUB A;  4NXR A;  3NFL A;  1YBO A;  1VB7 A;  3CH8 A;  3QGL A;  1FC7 A;  1OZI A;  1WHD A;  2ENO A;  3GSL A;  3DJ1 A;  2EDV A;  1GQ5 A;  4FGM A;  4Q6H A;  4MPA A;  1NF3 C;  2MX6 A;  3GDU A;  2KPL A;  3SOE A;  2IWN A;  1X9Z A;  1UJV A;  1X5N A;  3TMH A;  1G9O A;  2KOH A;  2DKR A;  4NMV A;  2VSV A;  5E6P B;  2W4F A;  5G1D A;  1OBY A;  1OBX A;  4K75 A;  1FC6 A;  2M0U A;  2EJY A;  2FE5 A;  2AWX A;  3GCO A;  4OAJ A;  2OSG A;  1IU2 A;  1B8Q A;  5IL9 A;  2OS6 A;  3EGH C;  2JXO A;  1D5G A;  1Z86 A;  5F3X A;  2M0T A;  1V5Q A;  5ILB A;  3SUZ A;  1SOT A;  1V5L A;  2CS5 A;  5GND A;  1N7E A;  2EDZ A;  1LCY A;  2KV8 A;  5HEY A;  1UM7 A;  4PQW A;  2REY A;  3KZD A;  2M3M A;  3QO6 A;  1U37 A;  3ID2 A;  3QIK A;  5G1E A;  2BYG A;  2HE2 A;  5HEB A;  3VQG A;  4RI0 A;  2LUI A;  3TSW A;  1RGR A;  2PA1 A;  3CBX A;  3GAB A;  3HPK A;  2JRE A;  4YDP A;  5JXB A;  4Q2N A;  4KFW A;  1I92 A;  4JOG A;  2QKU A;  4JJ0 A;  4Q2P A;  2DJT A;  1N7T A;  4GVD A;  3QJM A;  3GDS A;  4KFV A;  1Q3P A;  3EGG C;  2DLS A;  2H3M A;  3NGH A;  1N6E A;  4NNL A;  2KAW A;  2I0L A;  2DC2 A;  4P2A B;  2KBS A;  4E35 A;  3NCV A;  4OEO A;  4YYX A;  3QE1 A;  3PS4 A;  3CC0 A;  1UJD A;  2YUY A;  2I1N A;  4HOP B;  4NMS A;  3O5N A;  4NMR A;  1QAV A;  3PDV A;  3PV5 A;  3SHW A;  3PV2 A;  3DOR A;  2R3Y A;  1N6F A;  5HFD A;  2VSP A;  2LC6 A;  2VWR A;  1XZ9 A;  2KYL A;  1TE0 A;  2D92 A;  3WKL A;  2QKT A;  3MH7 A;  4GHN A;  3CS0 A;  5FHT A;  2F5Y A;  5HDY A;  2OQS A;  4IC6 A;  2KJK A;  2I6V A;  3OU0 A;  3NFK A;  3BPU A;  5HF1 A;  3O46 A;  2KRG A;  2H2C A;  1QAU A;  2EXG A;  1N6D A;  2IWQ A;  1GM1 A;  5HFE A;  1M5Z A;  4L8N A;  1X45 A;  3GCN A;  3CYY A;  2K1Z A;  2EV8 A;  2YT7 A;  2V90 A;  2ZPL A;  2KG2 A;  2M0V A;  5H3J A;  3ZRT A;  1ZUB A;  2W7R A;  4NMP A;  1WFV A;  2RCZ A;  3MH6 A;  2OZF A;  2V1W A;  1WI4 A;  2KA9 A;  4NMQ A;  1X6D A;  5FB8 C;  2KPK A;  1P1D A;  2AWW A;  1V1T A;  5E22 A;  5HJ1 A;  4WYU A;  2G5M B;  1W9E A;  3STJ A;  2JIK A;  2EHR A;  2H2B A;  2VZ5 A;  3K82 A;  3RL8 A;  4JOJ A;  2WL7 A;  4O06 A;  2EAQ A;  2P3W A;  2KQF A;  2VRF A;  1PDR A;  3HPM A;  1W9Q A;  2VPH A;  2OCS A;  1WF7 A;  2IWO A;  2Z9I A;  3SHU A;  2DM8 A;  2FNE A;  4HOP A;  1V62 A;  2CSS A;  2JSN A;  1UM1 A;  2I04 A;  3PDZ A;  2L4S A;  5HFB A;  1X8S A;  1SOZ A;  1P1E A;  1QLC A;  2LOB A;  1BFE A;  4G69 A;  4EDJ A;  2M10 A;  2EEJ A;  2E7K A;  1OBZ A;  1FCF A;  1Z87 A;  3CBZ A;  2EGK A;  4JOK A;  2FCF A;  2M0Z A;  5F67 A;  1UHP A;  2G2L A;  3RL7 A;  3R69 A;  2CSJ A;  2D8I A;  1NTE A;  3R68 A;  1R6J A;  2OPG A;  4K72 A;  2GZV A;  4R2Z A;  5GLJ A;  3FY5 A;  3GGE A;  2DAZ A;  5E1Y A;  2DLU A;  2F0A A;  4NMT A;  2IWP A;  1UF1 A;  3I4W A;  4JOE A;  3QJN A;  2EDP A;  3LNX A;  3VQF A;  2GEF A;  2ZPM A;  4LMM A;  2EEG A;  1WJL A;  2QKV A;  1Y8T A;  5HED A;  3WKM A;  1X5Q A;  2QG1 A;  4JOH A;  3HVQ C;  1L6O A;  2HE4 A;  1WIF A;  3DJA A;  2LC7 A;  2UZC A;  4FLN A;  1UIT A;  1T2M A;  2X7Z A;  1N7F A;  5I7Z A;  2AIN A;  3KDK A;  1MFL A;  1MFG A;  2YT8 A;  1VAE A;  3GDV A;  5B42 A;  3PV4 A;  4OEP A;  4K76 A;  5E11 A;  1IU0 A;  2OMJ A;  3ID4 A;  4XHV A;  2KJP A;  3RLE A;  3JXT A;  1Q3O A;  5HF4 A;  3CBY A;  1MC7 A;  3E17 A;  1U38 A;  4AMH A;  3ID3 A;  4K78 A;  5B6L A;  2PZD A;  4JOP A;  2PDZ A;  3SFJ A;  1BE9 A;  2KL1 A;  2RRM A;  1K32 A;  2JIL A;  1TQ3 A;  1RGW A;  1TP5 A;  4P0C A;  3K1R A;  2H3L A;  3B76 A;  2EGO A;  4UU6 A;  3TSZ A;  1GQ4 A;  2PNT A;  4E3B A;  4REY A;  1UEP A;  5E21 A;  3L4F D;  2QBW A;  5HET A;  1QAV B;  3AXA A;  1WHA A;  1VJ6 A;  3ID1 A;  3KZE A;  1KEF A;  2HGA A;  2OGP A;  2R4H A;  1KWA A;  1VA8 A;  4H11 A;  4WYT A;  4NXQ A;  4Z8J A;  5A2P A;  3MH4 A;  5HFC A;  2EGN A;  3I18 A;  4JOR A;  1RZX A; 
#chains in the Genus database with same CATH homology
 2O2T A;  1VCW A;  2EEH A;  3I1E A;  4NNM A;  4NXP A;  5HFF A;  3DIW A;  2KOJ A;  1UEZ A;  4E34 A;  1U39 A;  4JL7 A;  2FN5 A;  1TP3 A;  3TSV A;  1KY9 A;  2L4T A;  3LNY A;  2JWE A;  4Z33 A;  1I16 A;  1WFG A;  2QT5 A;  4NMO A;  2LA8 A;  2MHO A;  2JOA A;  1X5R A;  4Q2Q A;  3R0H A;  1WF8 A;  5D13 A;  4GVC A;  4K6Y A;  3DJ3 A;  3KDG A;  4JOF A;  1N99 A;  2KJD A;  2L97 A;  2K20 A;  1WG6 A;  2Q9V A;  4JJ3 A;  1ZOK A;  1IHJ A;  3OTP A;  2I0I A;  4Q2O A;  2YTW A;  2Z17 A;  3KHF A;  2EEI A;  5DTH A;  2D90 A;  3K50 A;  2AWU A;  2Q3G A;  2JIN A;  4Q6S A;  1Q7X A;  1WI2 A;  4F8K A;  3GJ9 A;  1W9O A;  1UJU A;  2PKU A;  1UEW A;  1Y7N A;  4Q3H A;  2DMZ A;  5EYZ A;  5EZ0 A;  1U3B A;  1UFX A;  1WH1 A;  4N6X A;  2PKT A;  4UU5 A;  1RY4 A;  2KOM A;  1V6B A;  2DB5 A;  3QDO A;  2I4S A;  1UEQ A;  1FC9 A;  2YUB A;  4NXR A;  3NFL A;  1YBO A;  1VB7 A;  3CH8 A;  3QGL A;  1FC7 A;  1OZI A;  1WHD A;  2ENO A;  3GSL A;  3DJ1 A;  2EDV A;  1GQ5 A;  4FGM A;  4Q6H A;  4MPA A;  1NF3 C;  2MX6 A;  3GDU A;  2KPL A;  3SOE A;  2IWN A;  1X9Z A;  1UJV A;  1X5N A;  3TMH A;  1G9O A;  2KOH A;  2DKR A;  4NMV A;  2VSV A;  5E6P B;  2W4F A;  5G1D A;  1OBY A;  1OBX A;  4K75 A;  1FC6 A;  2M0U A;  2EJY A;  2FE5 A;  2AWX A;  3GCO A;  4OAJ A;  2OSG A;  1IU2 A;  1B8Q A;  5IL9 A;  2OS6 A;  3EGH C;  2JXO A;  1D5G A;  1Z86 A;  5F3X A;  2M0T A;  1V5Q A;  5ILB A;  3SUZ A;  1SOT A;  1V5L A;  2CS5 A;  5GND A;  1N7E A;  2EDZ A;  1LCY A;  2KV8 A;  5HEY A;  1UM7 A;  4PQW A;  2REY A;  3KZD A;  2M3M A;  3QO6 A;  1U37 A;  3ID2 A;  3QIK A;  5G1E A;  2BYG A;  2HE2 A;  5HEB A;  3VQG A;  4RI0 A;  2LUI A;  3TSW A;  1RGR A;  2PA1 A;  3CBX A;  3GAB A;  3HPK A;  2JRE A;  4YDP A;  5JXB A;  4Q2N A;  4KFW A;  1I92 A;  4JOG A;  2QKU A;  4JJ0 A;  4Q2P A;  2DJT A;  1N7T A;  4GVD A;  3QJM A;  3GDS A;  4KFV A;  1Q3P A;  3EGG C;  2DLS A;  2H3M A;  3NGH A;  1N6E A;  4NNL A;  2KAW A;  2I0L A;  2DC2 A;  4P2A B;  2KBS A;  4E35 A;  3NCV A;  4OEO A;  4YYX A;  3QE1 A;  3PS4 A;  3CC0 A;  1UJD A;  2YUY A;  2I1N A;  4HOP B;  4NMS A;  3O5N A;  4NMR A;  1QAV A;  3PDV A;  3PV5 A;  3SHW A;  3PV2 A;  3DOR A;  2R3Y A;  1N6F A;  5HFD A;  2VSP A;  2LC6 A;  2VWR A;  1XZ9 A;  2KYL A;  1TE0 A;  2D92 A;  3WKL A;  2QKT A;  3MH7 A;  4GHN A;  3CS0 A;  5FHT A;  2F5Y A;  5HDY A;  2OQS A;  4IC6 A;  2KJK A;  2I6V A;  3OU0 A;  3NFK A;  3BPU A;  5HF1 A;  3O46 A;  2KRG A;  2H2C A;  1QAU A;  2EXG A;  1N6D A;  2IWQ A;  1GM1 A;  5HFE A;  1M5Z A;  4L8N A;  1X45 A;  3GCN A;  3CYY A;  2K1Z A;  2EV8 A;  2YT7 A;  2V90 A;  2ZPL A;  2KG2 A;  2M0V A;  5H3J A;  3ZRT A;  1ZUB A;  2W7R A;  4NMP A;  1WFV A;  2RCZ A;  3MH6 A;  2OZF A;  2V1W A;  1WI4 A;  2KA9 A;  4NMQ A;  1X6D A;  5FB8 C;  2KPK A;  1P1D A;  2AWW A;  1V1T A;  5E22 A;  5HJ1 A;  4WYU A;  2G5M B;  1W9E A;  3STJ A;  2JIK A;  2EHR A;  2H2B A;  2VZ5 A;  3K82 A;  3RL8 A;  4JOJ A;  2WL7 A;  4O06 A;  2EAQ A;  2P3W A;  2KQF A;  2VRF A;  1PDR A;  3HPM A;  1W9Q A;  2VPH A;  2OCS A;  1WF7 A;  2IWO A;  2Z9I A;  3SHU A;  2DM8 A;  2FNE A;  4HOP A;  1V62 A;  2CSS A;  2JSN A;  1UM1 A;  2I04 A;  3PDZ A;  2L4S A;  5HFB A;  1X8S A;  1SOZ A;  1P1E A;  1QLC A;  2LOB A;  1BFE A;  4G69 A;  4EDJ A;  2M10 A;  2EEJ A;  2E7K A;  1OBZ A;  1FCF A;  1Z87 A;  3CBZ A;  2EGK A;  4JOK A;  2FCF A;  2M0Z A;  5F67 A;  1UHP A;  2G2L A;  3RL7 A;  3R69 A;  2CSJ A;  2D8I A;  1NTE A;  3R68 A;  1R6J A;  2OPG A;  4K72 A;  2GZV A;  4R2Z A;  5GLJ A;  3FY5 A;  3GGE A;  2DAZ A;  5E1Y A;  2DLU A;  2F0A A;  4NMT A;  2IWP A;  1UF1 A;  3I4W A;  4JOE A;  3QJN A;  2EDP A;  3LNX A;  3VQF A;  2GEF A;  2ZPM A;  4LMM A;  2EEG A;  1WJL A;  2QKV A;  1Y8T A;  5HED A;  3WKM A;  1X5Q A;  2QG1 A;  4JOH A;  3HVQ C;  1L6O A;  2HE4 A;  1WIF A;  3DJA A;  2LC7 A;  2UZC A;  4FLN A;  1UIT A;  1T2M A;  2X7Z A;  1N7F A;  5I7Z A;  2AIN A;  3KDK A;  1MFL A;  1MFG A;  2YT8 A;  1VAE A;  3GDV A;  5B42 A;  3PV4 A;  4OEP A;  4K76 A;  5E11 A;  1IU0 A;  2OMJ A;  3ID4 A;  4XHV A;  2KJP A;  3RLE A;  3JXT A;  1Q3O A;  5HF4 A;  3CBY A;  1MC7 A;  3E17 A;  1U38 A;  4AMH A;  3ID3 A;  4K78 A;  5B6L A;  2PZD A;  4JOP A;  2PDZ A;  3SFJ A;  1BE9 A;  2KL1 A;  2RRM A;  1K32 A;  2JIL A;  1TQ3 A;  1RGW A;  1TP5 A;  4P0C A;  3K1R A;  2H3L A;  3B76 A;  2EGO A;  4UU6 A;  3TSZ A;  1GQ4 A;  2PNT A;  4E3B A;  4REY A;  1UEP A;  5E21 A;  3L4F D;  2QBW A;  5HET A;  1QAV B;  3AXA A;  1WHA A;  1VJ6 A;  3ID1 A;  3KZE A;  1KEF A;  2HGA A;  2OGP A;  2R4H A;  1KWA A;  1VA8 A;  4H11 A;  4WYT A;  4NXQ A;  4Z8J A;  5A2P A;  3MH4 A;  5HFC A;  2EGN A;  3I18 A;  4JOR A;  1RZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...