3K9SA

Crystal structure of the peroxide-bound manganese superoxide dismutase.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Structural Analysis of Peroxide-Soaked MnSOD Crystals Reveals Side-On Binding of Peroxide to Active-Site Manganese.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 75
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3k9sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3k9sA02
3C3SA 1XDCA 1I0HA 2ADPA 1XILA 2RCVA 2QKAA 1AVMA 4E4EA 1P7GA 1QNMA 3AK1A 3MDSA 1VEWA 1IDSA 1BS3A 1JR9A 1GN6A 4X9QA 1N0JA 1EN4A 1SZXA 2CDYA 1JA8A 1MSDA 1B06A 4YIPA 2GDSA 1GN3A 3AK2A 3TJTA 1BT8A 2AW9A 3K9SA 1AP6A 1AR5A 3QVNA 1LUWA 1PL4A 1XUQA 4F6EA 3CEIA 1AP5A 4GUNA 4C7UA 1MMMA 3AK3A 1ZTEA 1IX9A 1ZSPA 1WB7A 1MA1A 2CE4A 4FFKA 3C3TA 1VARA 3RN4A 1EN5A 1MNGA 4JYYA 4BR6A 5AG2A 1D5NA 1ZLZA 1WB8A 1XREA 4JZ2A 3DC6A 1PM9A 1GN2A 1GN4A 2QKCA 3DC5A 5A9GA 3LSUA 1ZUQA 1EN6A 2ADQB 4JZGA 2P4KA 1LUVA 1I08A 3EVKA 1Y67A 4YIOA 1KKCA 3IC9A 1EM1A 1AR4A 1BSMA 1N0NA 1IXBA 3BFRA 3OT7A 3KKYA
chains in the Genus database with same CATH superfamily
1XHZA 2XASA 1N36O 1Q6UA 3LDDA 3CJHB 1M9NA 1QLEB 2N74A 5EZYA 2A06H 3IAYA 4DK1A 3A2FA 1VQ5V 5FNVA 1WAZA 2XTAA 2PF4E 1MZEA 3MD0A 1VQNV 2Y4UA 1KC8W 4NXNB 1RPRA 4LF6O 1Q8IA 1XEQA 1NR7A 2JVDA 3NR7A 3ABKC 4DV5O 3SJBC 4Z1VA 1K5SA 3CD6V 5H6RA 4DR4O 4NXMO 3CRCA 4GUNA 3CMAV 1JJ2U 3ZHVA 4I0XB 5HFMA 5IDJA 3ABMB 4Q6GA 2YIBD 5EIBD 5IYZB 1B6QA 1FXKA 4CC5A 3T1HB 4I4TB 2H8PC 1XMOB 4J41A 1CPYA 3B40A 1HNWO 4FIPC 2BOCC 5LYJA 4MVRA 3PJSK 1F7YA 1Q7YW 1YHQV 4JI7B 2Q67A 3BY6A 5EBMC 1SQXH 1XNQB 2NNUA 1R3LC 2RJZA 3ICXA 4JI8B 2XAJA 1RM1C 1I0HA 1JCHA 1HNXO 4GKKO 2IM9A 2RCVA 2ZD9A 3D36A 4O2BA 3RYFB 1AVMA 3FX7A 3FAVA 4RQEA 4LCUC 4ZOLB 4YXWG 3RGBA 1V55C 3OAAG 1K4CC 4I50A 1BS3A 3H1HH 1YJWV 1QVFU 3W7UA 1NVPD 5KA5A 1WA8A 3N2GA 1JA8A 2Z3YA 1RPOA 5L3GA 4I55A 1WP7A 3OR7C 5C8YA 2Q6AA 3AK2A 3VOUA 3E8GA 5EBWC 1QBZA 1BT8A 4FLWA 2IU3A 1JFFB 3K9SA 1M57B 1LUWA 1XI1A 1NU1H 3SR2C 5KX5B 4F6EA 5J2TB 2GTSA 1MMMA 4K8XA 2YC0A 4DR7B 1FXHA 3M7MX 4JI6B 1GTOA 4DR1O 1E1QG 2X0LA 1BQ0A 3K79A 5IJ0A 1VQ4V 1JX9A 1SA0A 1MNGA 1YTFB 5L3BA 3FFQA 4HYOA 4WFHA 4LF4O 1KMIZ 4MTOA 3CCEV 5EC2C 2OTJV 2QKCA 3DC5A 2UXCO 4HAMA 3EFFK 5E1AC 4LF8B 4PJ0Z 2E75B 1BE3H 4DV1O 2PYLA 5IY5B 5JQGB 4J11A 1OHHG 2P4VA 4GCZA 1L0NH 4TUYA 5J2UA 1H2NA 1GKFA 4GX5A 5ITZB 3IC7A 3RYHB 3CCSV 1E79G 3IJ4A 4LFAB 1AI7A 1IDSA 4IL6Z 2ZR2A 3CPWU 1Q3EA 5CA0B 1FS0G 5LXTA 4DV3B 3JCUZ 1BHAA 1X4TA 4J7JA 5D5QA 3JAKA 4BAYA 3RW0A 4UUJC 1ROPA 1K4DC 1OCOB 5JCOC 2GHYA 4DR5O 3RVYA 4X1IA 4Z1MG 2LGQA 3ZRWB 3CS5A 2QEXV 1EBOA 2YEVB 1TA8A 4C7UA 4WBNB 1BCCH 4PA7A 1IX9A 2RQ6A 2K1EA 3B4SA 3ETGA 1KBHA 3A8TA 2MK3A 4FPPA 1YJNV 2P06A 1US6A 2EINC 2IH1C 4BR6A 4GZRB 2DWEC 3OUSA 1J5EB 2LGWA 3J7AU 3ZN0A 2HP8A 2F43G 3STZC 1FXVA 4AHCA 2Q73A 4UB6Z 3WU2Z 1S5LZ 1UFIA 4JZGA 5CA3A 1LUVA 3E2EA 1G8MA 1KKCA 3JSLA 5CA1A 4W4LA 1HP8A 1SQPH 3OTOO 3CC7V 4H0LB 1PL0A 5KUMA 1GAXA 3HKBB 1DF5A 2Q68A 4JGSA 4JTCB 3SYOA 1N32O 2FB5A 3MHSC 1VQ9V 1DF4A 1R3JC 4JYCA 5H5NA 5GONB 3THOA 2A0LA 2W0FC 4JASA 2DQ0A 1SZXA 3FYIB 2Y0IA 3SJAC 2O57A 3CC2V 4XDJA 4LBEC 4PD4F 3K3WA 2F4VO 1GN3A 5EIBC 1SQQH 1CEZA 3CE2A 5EC1C 1OCRC 2JIZG 1FFXA 3UKMA 2QE7G 5BR8B 2YXYA 2QKSA 3QO5A 1NT2B 4DV2B 4X1KB 5L3CA 3WG7B 1MA1A 4G27B 4BIUA 2CTWA 2RNBA 3K0DA 4TV8A 2UXXA 3X2QC 2Y69C 4FMTA 4XDKA 4DV6O 4DRXB 4LFBO 1F51A 2WA3A 3FKSG 2BOBC 5DECA 4L87A 3K9AA 5KHGA 3F5WC 2F1MA 3LSUA 2EIMC 3LNMB 4B7EA 4O4LB 1W2BU 2DN9A 1M56C 4JPRA 5GTIZ 2Q0OC 2AZ2A 1VQOV 1Y76A 2BTQB 5GTHZ 5JH7B 3CCQV 4K35A 4YJ3A 2HHHB 4JAUA 2CK3G 3CRRA 1GO3F 3BFRA 2UXBB 3SYAA 4PI0A 1PNKA 3OFNG 3JALB 4EFEA 3ZIAG 2QKAA 4RWUA 4B3SO 2QM8A 1YF2A 1ZL8A 2XHBA 3JD0A 3AK1A 2JEUA 2UUCO 2VQEO 3LUTB 4ZI7B 4EB6A 4DV0B 4X1YA 3JD1A 4YHHO 1R73A 4DO2A 2WLIB 4TWKA 4R6ZA 1KYOF 4X89A 1N8RW 3G71V 2EIKB 1ZAUA 3AG2C 3AEIA 4J80A 2EBOA 1YSCA 3ABTA 2EJRA 1Q6HA 2WA4A 2ZE7A 5B1BB 2XNDG 3N2KB 1SRYA 1PD3A 1GM8A 3E8HA 1FPOA 4PELA 5LP6C 5B5EZ 2PYJA 3G6BA 4XDLA 2ZM6B 3L9DA 2CTPA 4JI1B 1TVKB 3KCYA 1EZJA 2R72A 4NTXA 3E22B 4K0KB 3K59A 4X20A 1VQ8V 2IJIA 3P32A 4GKJB 1W0KG 3E35A 3OD4A 4DR3B 1XOUA 3JCZA 2LW1A 1RFYA 5JCOA 4H44B 1L0LH 3D8CA 1XL6A 1VIBA 3JASB 4JYBA 4FVMA 1O9HA 4QPKA 1TGOA 2IJHA 5BY1A 4X65B 3BAAA 4JYYA 5LA6A 2DYSB 2Q7GA 3L75H 5L3EA 1I7FA 3E89A 2RMKB 1LR1A 4FLVA 2JGDA 1P7BA 3C90A 3BEHA 4NTWA 2PZSA 5KMGB 1EN6A 1Z5WA 2CTRA 4GYCB 3M8AA 3ZX6A 1FJGO 3P30A 4WFFA 2BSKA 1Y67A 4FM1A 4KP4A 2BTOA 3IC9A 5BMVB 3AG4B 4JYAB 2A7WA 3UCSC 3FB5C 2IW5A 5KLVH 3HKEB 3BVOA 2QWRB 4H13B 2ZE8A 2QTOA 4J7KA 4BIZA 2ZDIC 4UV8A 1SQGA 4X88A 2Y48A 3G67A 3MDSA 1MOFA 4JI4O 4FZ1A 3T1HO 4DV7B 3U11A 1JR9A 2YSUB 2W6JG 2FL4A 4X66B 2JJ2G 1HDJA 1AJNA 3ZJZA 5E79Z 3SJCC 2R70A 2DQ3A 4YY3O 2ZIMA 1ZWIC 1CXZB 4P2ZA 5L3FA 5LOVA 2AW9A 2ZNIA 4JI0O 3QVNA 4FLTA 2YUAA 3ASNC 1PL4A 4U3JA 2NR5A 3OMAB 1U96A 3ZMZA 4CZZA 2QA4V 1PPJH 1IBKO 4LF5B 3LDCA 4DUYB 1QCEA 3RYCA 3I5DA 5IYBO 2LP7A 1LNQA 5B3SB 3OTFA 5LGUA 3K06A 2HR3A 4X8AA 1H2KA 2E5LO 2F93B 1MG1A 4B3TO 2E76B 2UU9B 4JV5O 4UV9A 3N27A 1SF9A 2IBZH 1GN2A 5JWPA 1FFTB 1VQMV 4JTDB 2CGOA 2WLHA 4QE7A 2CH7A 1JQ0A 3F7YC 3HKCA 3HR0A 4UCOA 2R9RB 5KA6A 1Y4MA 4ABMA 3FB7C 3QO8A 3VBBA 3CCMV 2H3OA 3QO7A 4OGQB 1N0NA 5CB4B 1GK9A 2P67A 4F6RB 1QLEC 3RBZA 1QU7A 1XILA 2QM4A 4A5UB 3JD2A 4EKWA 2KQXA 1OJHA 3CRAA 3SJQC 3JD4A 2NN4A 4LF9B 4J9YB 4PV1B 1AR1B 1Z2GA 3ZBHA 3OGCC 5LHHA 1NR1A 2EIJB 4LWSA 1BGYH 4DW1A 1AI6A 5IJ9A 2UUAB 4O2AA 3K03A 5J9PC 1S3JA 3B09A 1SZTA 2CDYA 2W0XA 2WLLA 1TUBB 4J10A 4ZBMA 2LO1A 1WLEA 1VF7A 3JARA 4DUZB 1N36B 3JAWB 4ZHQB 3VQXA 1CP9A 3ZHSA 2DYRB 4FM0A 3EXAA 2Q7EA 3T1CA 3F5TA 4QJFB 3OGIB 1HNZB 2QGNA 2UXNA 3LNNA 1JOYA 2AGAA 4NTYA 4MT8A 4YJ2A 3ABMC 2OCCB 1YITV 2DJVA 5CMUA 1WB7A 1NQTA 3CCUV 4MVSA 3W7WA 5LP6A 1R1BA 3HKDB 4DV5B 3T2MA 3Q4HB 4FLZA 1YVWA 4QPJA 3FB6C 2AHZA 4HNAB 3S3WA 4DR4B 4BIOA 4NXMB 2ATKC 1H2GA 2Y4TA 2BTQA 4N23A 5KAFZ 3DXRB 5JJJB 3EHBB 2V1DA 1HW7A 3ZCCA 2YIDA 1I5XA 2LJ2A 4WCEV 4MTGA 2IJJA 2UXDO 1RSOA 3KZIZ 1BSMA 4Z2WA 1OCCB 4IIJB 4MW3A 4Q20A 1XMQO 4O4JA 2F23A 1XDCA 4CH5A 4JI2O 5LHIA 3CCRV 3RT3C 4TV9A 5BXZA 4LF7O 1HNWB 4CH6A 3ZMSA 1XQ8A 5JVDA 1NJIW 3SPHA 1Y74B 4O4IB 3ABLB 1F4MA 4IHJB 3JATA 3ZRSA 4O4HA 2KG7B 4RO2A 2PI4A 3B2EE 2HJDA 2YI8A 3APOA 2Q7HA 5CBHA 3CX5F 1EN4A 2M6YA 2Z5UA 3ETDA 1B06A 1Q86W 1N33O 1M57C 1PP9H 2ZDIA 1HNXB 4GKKB 1S0VA 2X6AA 1OCZB 4MVOA 1P84F 3HB3B 2ODMA 4OPHA 2YDEA 1Y6XA 1AP6A 1AR5A 3K58A 1EFRG 3E83A 3QF7A 4J9ZB 2OTLV 1X59A 3BPZA 1HR0B 4DR2B 3AK3A 3OUFA 3ML0A 2H94A 3I56V 4B7KA 2GUZB 4D6TH 4AQYO 4LP8A 1IBMO 2JGUA 2ZR3A 2KB1A 4LNUA 4JAVA 5LMNO 5LMUB 3ASOB 3TXQA 3RYIA 2B1GA 2QWNB 1K34A 1PM9A 3OR6C 1NTZH 4DXWA 2PY5A 2NLJC 5IWAO 3UT5B 1FYJA 2JRIA 4I9WA 5IY5C 2ILMA 1D2DA 3NXSA 1WPBA 3EVKA 1N34B 4X64O 2XOKG 4UCVA 5EZYB 4BW5A 2ZKOA 3A0HZ 4XBFA 4LF4B 3TETA 1SQBH 3K5OA 5FNVB 4FFBA 1BHBA 2UXCB 2GSMB 4CH4A 4KHPB 5IE9A 2E3CA 3D3QA 4MTFA 4NYKA 1K9MW 2ZXWB 1YCIA 4DV1B 2UUBO 1SQFA 1L8DA 1OCOC 3CJHA 3TK1A 5CBGA 1M4UA 4OPAA 1G1XB 3J80N 5KHIA 3IFXA 4PDVA 2X7RB 3DTUB 3CB2A 4E2LA 2HHHO 4UVCA 2A79B 1F23A 4JF3A 4B08A 3CMEV 5B1AB 4B3MO 3LSQA 2YXLA 2UXBO 1Q82W 1FXKB 1KECA 1NTMH 2YICA 2K9PA 5IYCO 1ZSPA 3CCLV 4GX0A 1GRJA 2HVJC 3SGIA 1FKAO 4K8ZA 3ZS8C 4DR5B 5KHHA 4JI3O 4JTAB 3K5LA 4RUEA 4H33A 3J81N 1SETA 4RAIA 5LYJB 2P90A 4UB8Z 4I0XA 2ZNJA 3BHPA 1I94O 2ARHA 5KHJA 4D7TA 1P49A 3UQ8A 2QWOB 1AILA 4EFBA 5LBQA 2MW2B 1URFA 5IYZA 5KHKA 4DR6O 2OWOA 1WP8A 3OEHG 3O65A 3L72H 1R3IC 2N05A 4JI1O 1IBLO 4NVPA 4I4TA 4O2BB 1MABG 1MZFA 3FAVB 1DK1A 4K0KO 4GKJO 3MHHC 4DR3O 3KG2A 4I50B 2VQFO 1W59A 4OXSA 3ZHUA 2D3OW 1NH2B 1YIJV 1WA8B 1M1KW 3N2GB 4X62O 1BQZA 1P7GA 4J7ZA 4I55B 1VEWA 5B66Z 2R9AA 5C8YB 1BMFG 1K33A 1K8AW 1AI4A 1WJZA 2ZE6A 2VWJA 1KD1W 5EYPB 1IXMA 1FD9A 3RYFA 3OTOB 4KXRA 5CBFA 3T1YO 4ZOLA 3SPJA 1T5EA 4JI5O 4FK5C 1YJ9V 3E86A 2YS8A 1PNLA 3IGAC 3RFRA 4CH3A 1N32B 3L74H 4DV4O 2DW4A 4B3RO 4N21A 3WB2A 4MVUA 4PDMA 2EILB 5IJ0B 1IURA 3ZHTA 4LFCO 1SA0B 2P22C 4UVBA 3T4ZA 3WG7C 1ZTEA 2Y0PA 3TCUA 4PA9A 2BCCH 1KKDA 1JFFA 2OIEA 4FM2A 2CE4A 5KAIZ 3JYCA 1OV9A 3R65A 5IYDO 2F4VB 4K3AA 5KX5A 1MSWD 5J2TA 3K5NA 4QE9A 4R50A 4X66O 1A32A 3I55V 3TGUH 1D5NA 4P9PA 2EZOA 2V7QG 4MSWC 1P4RA 3QTCA 3BRCA 3CHXA 3JAMN 1SC5B 2WSSG 2CUGA 3L70H 4TUYB 5J2UB 4AILC 2HKOA 2P4KA 2DE0X 5K1XA 4IGGA 4YIOA 4DUYO 2WLJA 3BABA 3CCJV 1GH6A 4G28B 5H6QA 1IXBA 4LFBB 3L73H 5LXTB 4NXNO 1ENVA 2OIGA 4J42A 2YXHA 2VS0A 3WB1A 3H9VA 1NS1A 1R3KC 2W6IG 3JAKB 4E4EA 4U3FH 2EILC 1IJGA 3OW2U 2QSAA 1QNMA 2XUMA 1DGSA 1VMGA 3E8FA 3JD3A 5JQGA 5JJEB 3K0GA 4LC1A 2Q8VA 4P9OA 2Z0AA 4X1IB 3ABUA 1N4CA 2EIKC 4KL1A 3OM3B 3K5MA 3O9OA 5BZBA 2C2AA 5LGNA 3SYPA 5ITZA 3RYHA 1QQCA 5B1BC 2Q69A 3A0RA 4G2KA 1J95A 4PDRA 2P6JA 4PDLA 4WFGA 5CA0A 2OYQA 1AB3A 4B3SB 3ZMVA 1YEWA 5FPRA 2VQEB 1XMOO 3ABKB 2GBOA 5LL6Y 1V54B 4YHHB 1G6UA 3ZRWA 1K3EA 1KQSU 2FMLA 3P3PA 2LQTA 1Z5VA 4IYIA 4NB5A 2P5OA 3ZMTA 4FLYA 2DMXA 2DYSC 3RN4A 2JS5A 2YEVA 1SQVH 4JI7O 4UXNA 3MAQA 1R6TA 1XNQO 2CAZC 1VP7A 4WBNA 1ZX3A 3SYQA 3UM7A 2ZT9B 4JI8O 1GM9A 1XREA 1PNMA 1E1RG 2FTKA 5CA1B 4DUZO 3L71H 4DYLA 3K57A 1VQ6V 2YIBA 1KUQA 4R7CA 2QWPB 3KCXA 3AG4C 4U7NA 4CBCA 4HZ3A 1K97A 1H38A 4ICGA 1HNZO 3CP1A 2HG5C 1F4NA 2EZPA 2L35A 1DLBA 1VQKV 3S3XA 4TQFA 1XNRB 2AXTZ 1RM1B 4OX9B 4CS4A 2IU0A 1FJGB 1V54C 2AHYA 3FD9A 1WNSA 1KU9A 3FYEB 1V55B 3FB8C 3HKBA 1K73W 1GN6A 1NTKH 4DR7O 1S76D 1FFXB 4JI6O 4CS3A 1THZA 1IZ3A 2WLNA 1R6KA 3F7VC 3CRQA 4YIPA 4QGPA 5GONA 3RWRD 2HJFC 5JJNB 2VRZA 1SERA 3B8NA 1BZKA 4TV8B 3JSNA 1G4YB 4JI4B 3H1KH 1K7DA 2X6BA 5B3SC 3CEIA 5LGTA 1FOUA 1PKXA 3W7SA 3BA8A 4LF8O 5FLXN 4FFKA 2Q9LA 3LDEA 3CYOA 2FYUH 4WFAV 4YY3B 4P30A 4QIWF 1S77D 1D5AA 2Q5ZA 3CCVV 4JI0B 4TOIA 3SPIA 4X1KA 2WPDG 4IYHA 1Y76B 4CC6A 1TUEB 1IBKB 5D5PA 1B3QA 4YJ3B 3B77A 2FKXA 3APQA 1ZUQA 4LFAO 2JK5C 4DRXA 4LF6B 3G80A 4DV3O 2EX3A 2E5LB 1XBLA 1HR0O 4B3TB 1JMKC 4DR2O 2PTMA 1ZL8B 4JV5B 3GWOA 1HWYA 4EB6B 2XAQA 2LFRA 3M99B 4X1YB 4LR3A 4O4LA 4HBNA 3UO2A 5CN0A 2XAFA 1H8EG 2JS3A 5JH7A 1TAEA 3UO3A 2EIJC 5EYPA 3ETQA 5DEDA 3ETEA 5IT9N 5LMUO 3VQYA 4GT1A 4L8JA 1KB9F 4LH6A 3JALA 1NH2D 3OEEG 4DW0A 1MSDA 1H5WA 1QR8A 4R8CA 3TXSA 4X20B 4ZI7A 4FLUA 4CS2A 1XL4A 2IH3C 2DYRC 1N34O 1VQ7V 1PV0A 2WLIA 1YDXA 2ZINA 4BW9A 2B9ZA 2HLDG 3OE7G 3CWBH 1J5EO 4QNHB 1QLNA 2OCCC 3N2KA 5LA6B 3ZMUA 3DGEA 3W7TA 2G38A 1JJOA 1Y66A 4RQFA 4KHPO 4GLXA 1EZVH 2JGDB 4MTXA 1VARA 1TVKA 2ZCEA 1KP3A 1EN5A 3E22A 1KP2A 5B1NA 4EEQA 2A9HA 1ZLZA 3SPCA 2EINB 4ZKIA 2BSKB 1WPXA 3DC6A 2QM7A 4BWAA 4ZIBA 1GN4A 3JASA 3PN1A 4PHZA 3ZN1A 3OMNB 2ADQB 5B1OA 1S5HC 1R6NA 4MS2A 3BA9A 5LHGA 2KKWA 2ZE5A 1VF5B 4UCSA 1OCCC 1NI8A 3ZEDA 2RDCA 3KKYA 5KMGA 4JAAA 3OT7A 3R66A 3H1JH 3C3SA 1UPGA 1U97A 2N04A 2ADPA 1Q90D 3U0ZA 5GW7A 3ABLC 1GM7A 4MW8A 4DR1B 3STLC 1K5QA 5BMVA 5A2QN 2WWWA 5BR8O 3HKEA 5LOVB 4X9QA 3ZHRA 1N0JA 4DK0A 4DV2O 2UXDB 1S5JA 1DTOA 4I7ZB 4U3JB 3GVMA 2A3QA 3LSSA 1YZBA 4GX1A 4WF9V 1OCZC 1XMQB 3VQVA 4I9QA 3RYCB 4JI2B 1VF6C 2GDSA 5H2FZ 1M5IA 2OCHA 2P7TC 1NBMG 4LF7B 1SESA 3OMIB 2CGNA 4UVAA 5DM6V 2XAHA 2BE3A 4W4KA 1OCRB 2HEPA 5FL7G 2DWDC 3GWKC 1BL8A 4PA4A 3VQWA 1N33B 1JPXA 3ASOC 1IVSA 2D2CB 2PUSA 2WLMA 3AG7A 5AG2A 3X2QB 1NZ6A 1Q5OA 2CH7B 3HKCB 2ITDC 2Y69B 2WAMA 3QG5A 3ZRVA 4F4LA 1H8HG 1VQPV 4NR1A 5EK0A 4KFMA 4PA6A 2EIMB 3G6EV 4FLXA 3WFVA 1JVMA 4DV0O 1AJQA 1L1FA 2QDOA 2HVKC 1M56B 4RUFA 4AQYB 1IBMB 3D3IA 2JDIG 2ZQMA 5LMNB 1NKDA 5F2VO 4LWSB 1S72V 1XHXA 1NVPB 1H2SB 5IJ9B 4O2AB 2WLLB 4FJCC 5IWAB 2ZM6O 2ZXWC 2YIAA 3CSXA 2QJ1A 2F95B 2Q4PA 5CB4A 3DSQA 3JARB 4F6RA 5FPOA 3K08A 3WB0A 4X64B 2DOSA 4GX2A 1O9GA 3B8MA 3AG1B 1QR9A 2OT5A 1SS3A 1FAFA 1JNBA 3SYCA 2LFSA 2R9IA 3AG2B 3TJTA 1GMGA 1SKVA 4NKGB 5B1AC 4YJ2B 1OZ0A 2ITCC 3CC4V 4MVMA 4X65O 1FXKC 3ZRXA 3H01A 2JEXA 4WFEA 3SDLA 2QWQB 4KUMA 1TUBA 2B1IA 4TQDA 5LP6B 2UUBB 2ETNA 3JAWA 4MVQA 2GV9A 2CTQA 2LW7A 2X6CA 4ZHQA 3W7XA 3G4SV 3H1IH 2HFEC 2XT9A 3RVZA 1COWG 4UCRA 4JYAO 5H9CA 4H37A 2B5UA 3HPLC 4B3MB 5KUKA 3P3NA 1WB8A 5C93A 2QTSA 4ASUG 4TSFG 1RSOB 5A9GA 3T4DA 1QVGU 3AG3B 3CRMA 2WLKA 3D36C 3CXCU 1W0JG 2RN9A 4O4JB 5K1PA 3HKDA 3A0BZ 3Q4HA 4DV7O 4FZ0A 5HFLA 4WFBV 1I08A 3QNEA 4HNAA 2XAGA 4JI3B 3CXHF 4TV9B 3AG1C 1AR4A 4LH7A 2E74B 3K04A 5JVDB 3DXRA 3JATB 4O4HB 1M93A 2M7WA 1I94B 3SPGA 2EJ7A 1QHTA 4DR6B 1RP3B 4IIJA 2ZIOA 1V9PA 1IBLB 4LF5O 1Q6IA 1ORQC 2IJKA 3BCCH 4DV6B 1WN7A 5EBLC 2VQFB 4U7OA 1H2LA 4UCTA 2JJ1G 1Y74A 4O4IA 3GB7C 4IHJA 2KG7A 4X62B 2UU9O 2VWKA 1AROP 4I5SA 4UFZA 1VQLV 1XUQA 2F66C 4D7SA 3AG3C 5DN6G 2L6LA 2Q0AA 1AP5A 3ASNB 1Q81W 4LNUB 3ZHQA 3T1YB 1XNRO 4OX9O 3RYIB 1YXBA 2YI9A 5L3DA 1VF6A 3E8BA 3H1LH 3U10A 3C3TA 4JI5B 1YTFD 1AI5A 2GTAA 2AZ0A 1H2MA 2QR4A 1AJPA 1YI2V 4AI8A 4DV4B 4B3RB 4UCUA 2UUCB 2V4DA 4LFCB 4JZ2A 1M90W 4PI2A 1Q43A 2GUZA 1UJWB 4MVZA 4LF9O 1B04A 1I5YA 4TT3G 4FFBB 2EULA 2UUAO 3KDRA 2KSDA 1EM1A 2PI5A 2PGGA 4PA3A 5TISZ 1K92A 4IT5A 3UT5A
chains in the Genus database with same CATH topology
3C3SA 1XDCA 1I0HA 2ADPA 1XILA 2RCVA 2QKAA 1AVMA 4E4EA 1P7GA 1QNMA 3AK1A 3MDSA 1VEWA 1IDSA 1BS3A 1JR9A 1GN6A 4X9QA 1N0JA 1EN4A 1SZXA 2CDYA 1JA8A 1MSDA 1B06A 4YIPA 2GDSA 1GN3A 3AK2A 3TJTA 1BT8A 2AW9A 3K9SA 1AP6A 1AR5A 3QVNA 1LUWA 1PL4A 1XUQA 4F6EA 3CEIA 1AP5A 4GUNA 4C7UA 1MMMA 3AK3A 1ZTEA 1IX9A 1ZSPA 1WB7A 1MA1A 2CE4A 4FFKA 3C3TA 1VARA 3RN4A 1EN5A 1MNGA 4JYYA 4BR6A 5AG2A 1D5NA 1ZLZA 1WB8A 1XREA 4JZ2A 3DC6A 1PM9A 1GN2A 1GN4A 2QKCA 3DC5A 5A9GA 3LSUA 1ZUQA 1EN6A 2ADQB 4JZGA 2P4KA 1LUVA 1I08A 3EVKA 1Y67A 4YIOA 1KKCA 3IC9A 3KDRA 1EM1A 1AR4A 1BSMA 1N0NA 1IXBA 3BFRA 3OT7A 3KKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3S A;  1XDC A;  1I0H A;  2ADP A;  1XIL A;  2RCV A;  2QKA A;  1AVM A;  4E4E A;  1P7G A;  1QNM A;  3AK1 A;  3MDS A;  1VEW A;  1IDS A;  1BS3 A;  1JR9 A;  1GN6 A;  4X9Q A;  1N0J A;  1EN4 A;  1SZX A;  2CDY A;  1JA8 A;  1MSD A;  1B06 A;  4YIP A;  2GDS A;  1GN3 A;  3AK2 A;  3TJT A;  1BT8 A;  2AW9 A;  3K9S A;  1AP6 A;  1AR5 A;  3QVN A;  1LUW A;  1PL4 A;  1XUQ A;  4F6E A;  3CEI A;  1AP5 A;  4GUN A;  4C7U A;  1MMM A;  3AK3 A;  1ZTE A;  1IX9 A;  1ZSP A;  1WB7 A;  1MA1 A;  2CE4 A;  4FFK A;  3C3T A;  1VAR A;  3RN4 A;  1EN5 A;  1MNG A;  4JYY A;  4BR6 A;  5AG2 A;  1D5N A;  1ZLZ A;  1WB8 A;  1XRE A;  4JZ2 A;  3DC6 A;  1PM9 A;  1GN2 A;  1GN4 A;  2QKC A;  3DC5 A;  5A9G A;  3LSU A;  1ZUQ A;  1EN6 A;  2ADQ B;  4JZG A;  2P4K A;  1LUV A;  1I08 A;  3EVK A;  1Y67 A;  4YIO A;  1KKC A;  3IC9 A;  1EM1 A;  1AR4 A;  1BSM A;  1N0N A;  1IXB A;  3BFR A;  3OT7 A;  3KKY A; 
#chains in the Genus database with same CATH topology
 1XHZ A;  2XAS A;  1N36 O;  1Q6U A;  3LDD A;  3CJH B;  1M9N A;  1QLE B;  2N74 A;  5EZY A;  2A06 H;  3IAY A;  4DK1 A;  3A2F A;  1VQ5 V;  5FNV A;  1WAZ A;  2XTA A;  2PF4 E;  1MZE A;  3MD0 A;  1VQN V;  2Y4U A;  1KC8 W;  4NXN B;  1RPR A;  4LF6 O;  1Q8I A;  1XEQ A;  1NR7 A;  2JVD A;  3NR7 A;  3ABK C;  4DV5 O;  3SJB C;  4Z1V A;  1K5S A;  3CD6 V;  5H6R A;  4DR4 O;  4NXM O;  3CRC A;  4GUN A;  3CMA V;  1JJ2 U;  3ZHV A;  4I0X B;  5HFM A;  5IDJ A;  3ABM B;  4Q6G A;  2YIB D;  5EIB D;  5IYZ B;  1B6Q A;  1FXK A;  4CC5 A;  3T1H B;  4I4T B;  2H8P C;  1XMO B;  4J41 A;  1CPY A;  3B40 A;  1HNW O;  4FIP C;  2BOC C;  5LYJ A;  4MVR A;  3PJS K;  1F7Y A;  1Q7Y W;  1YHQ V;  4JI7 B;  2Q67 A;  3BY6 A;  5EBM C;  1SQX H;  1XNQ B;  2NNU A;  1R3L C;  2RJZ A;  3ICX A;  4JI8 B;  2XAJ A;  1RM1 C;  1I0H A;  1JCH A;  1HNX O;  4GKK O;  2IM9 A;  2RCV A;  2ZD9 A;  3D36 A;  4O2B A;  3RYF B;  1AVM A;  3FX7 A;  3FAV A;  4RQE A;  4LCU C;  4ZOL B;  4YXW G;  3RGB A;  1V55 C;  3OAA G;  1K4C C;  4I50 A;  1BS3 A;  3H1H H;  1YJW V;  1QVF U;  3W7U A;  1NVP D;  5KA5 A;  1WA8 A;  3N2G A;  1JA8 A;  2Z3Y A;  1RPO A;  5L3G A;  4I55 A;  1WP7 A;  3OR7 C;  5C8Y A;  2Q6A A;  3AK2 A;  3VOU A;  3E8G A;  5EBW C;  1QBZ A;  1BT8 A;  4FLW A;  2IU3 A;  1JFF B;  3K9S A;  1M57 B;  1LUW A;  1XI1 A;  1NU1 H;  3SR2 C;  5KX5 B;  4F6E A;  5J2T B;  2GTS A;  1MMM A;  4K8X A;  2YC0 A;  4DR7 B;  1FXH A;  3M7M X;  4JI6 B;  1GTO A;  4DR1 O;  1E1Q G;  2X0L A;  1BQ0 A;  3K79 A;  5IJ0 A;  1VQ4 V;  1JX9 A;  1SA0 A;  1MNG A;  1YTF B;  5L3B A;  3FFQ A;  4HYO A;  4WFH A;  4LF4 O;  1KMI Z;  4MTO A;  3CCE V;  5EC2 C;  2OTJ V;  2QKC A;  3DC5 A;  2UXC O;  4HAM A;  3EFF K;  5E1A C;  4LF8 B;  4PJ0 Z;  2E75 B;  1BE3 H;  4DV1 O;  2PYL A;  5IY5 B;  5JQG B;  4J11 A;  1OHH G;  2P4V A;  4GCZ A;  1L0N H;  4TUY A;  5J2U A;  1H2N A;  1GKF A;  4GX5 A;  5ITZ B;  3IC7 A;  3RYH B;  3CCS V;  1E79 G;  3IJ4 A;  4LFA B;  1AI7 A;  1IDS A;  4IL6 Z;  2ZR2 A;  3CPW U;  1Q3E A;  5CA0 B;  1FS0 G;  5LXT A;  4DV3 B;  3JCU Z;  1BHA A;  1X4T A;  4J7J A;  5D5Q A;  3JAK A;  4BAY A;  3RW0 A;  4UUJ C;  1ROP A;  1K4D C;  1OCO B;  5JCO C;  2GHY A;  4DR5 O;  3RVY A;  4X1I A;  4Z1M G;  2LGQ A;  3ZRW B;  3CS5 A;  2QEX V;  1EBO A;  2YEV B;  1TA8 A;  4C7U A;  4WBN B;  1BCC H;  4PA7 A;  1IX9 A;  2RQ6 A;  2K1E A;  3B4S A;  3ETG A;  1KBH A;  3A8T A;  2MK3 A;  4FPP A;  1YJN V;  2P06 A;  1US6 A;  2EIN C;  2IH1 C;  4BR6 A;  4GZR B;  2DWE C;  3OUS A;  1J5E B;  2LGW A;  3J7A U;  3ZN0 A;  2HP8 A;  2F43 G;  3STZ C;  1FXV A;  4AHC A;  2Q73 A;  4UB6 Z;  3WU2 Z;  1S5L Z;  1UFI A;  4JZG A;  5CA3 A;  1LUV A;  3E2E A;  1G8M A;  1KKC A;  3JSL A;  5CA1 A;  4W4L A;  1HP8 A;  1SQP H;  3OTO O;  3CC7 V;  4H0L B;  1PL0 A;  5KUM A;  1GAX A;  3HKB B;  1DF5 A;  2Q68 A;  4JGS A;  4JTC B;  3SYO A;  1N32 O;  2FB5 A;  3MHS C;  1VQ9 V;  1DF4 A;  1R3J C;  4JYC A;  5H5N A;  5GON B;  3THO A;  2A0L A;  2W0F C;  4JAS A;  2DQ0 A;  1SZX A;  3FYI B;  2Y0I A;  3SJA C;  2O57 A;  3CC2 V;  4XDJ A;  4LBE C;  4PD4 F;  3K3W A;  2F4V O;  1GN3 A;  5EIB C;  1SQQ H;  1CEZ A;  3CE2 A;  5EC1 C;  1OCR C;  2JIZ G;  1FFX A;  3UKM A;  2QE7 G;  5BR8 B;  2YXY A;  2QKS A;  3QO5 A;  1NT2 B;  4DV2 B;  4X1K B;  5L3C A;  3WG7 B;  1MA1 A;  4G27 B;  4BIU A;  2CTW A;  2RNB A;  3K0D A;  4TV8 A;  2UXX A;  3X2Q C;  2Y69 C;  4FMT A;  4XDK A;  4DV6 O;  4DRX B;  4LFB O;  1F51 A;  2WA3 A;  3FKS G;  2BOB C;  5DEC A;  4L87 A;  3K9A A;  5KHG A;  3F5W C;  2F1M A;  3LSU A;  2EIM C;  3LNM B;  4B7E A;  4O4L B;  1W2B U;  2DN9 A;  1M56 C;  4JPR A;  5GTI Z;  2Q0O C;  2AZ2 A;  1VQO V;  1Y76 A;  2BTQ B;  5GTH Z;  5JH7 B;  3CCQ V;  4K35 A;  4YJ3 A;  2HHH B;  4JAU A;  2CK3 G;  3CRR A;  1GO3 F;  3BFR A;  2UXB B;  3SYA A;  4PI0 A;  1PNK A;  3OFN G;  3JAL B;  4EFE A;  3ZIA G;  2QKA A;  4RWU A;  4B3S O;  2QM8 A;  1YF2 A;  1ZL8 A;  2XHB A;  3JD0 A;  3AK1 A;  2JEU A;  2UUC O;  2VQE O;  3LUT B;  4ZI7 B;  4EB6 A;  4DV0 B;  4X1Y A;  3JD1 A;  4YHH O;  1R73 A;  4DO2 A;  2WLI B;  4TWK A;  4R6Z A;  1KYO F;  4X89 A;  1N8R W;  3G71 V;  2EIK B;  1ZAU A;  3AG2 C;  3AEI A;  4J80 A;  2EBO A;  1YSC A;  3ABT A;  2EJR A;  1Q6H A;  2WA4 A;  2ZE7 A;  5B1B B;  2XND G;  3N2K B;  1SRY A;  1PD3 A;  1GM8 A;  3E8H A;  1FPO A;  4PEL A;  5LP6 C;  5B5E Z;  2PYJ A;  3G6B A;  4XDL A;  2ZM6 B;  3L9D A;  2CTP A;  4JI1 B;  1TVK B;  3KCY A;  1EZJ A;  2R72 A;  4NTX A;  3E22 B;  4K0K B;  3K59 A;  4X20 A;  1VQ8 V;  2IJI A;  3P32 A;  4GKJ B;  1W0K G;  3E35 A;  3OD4 A;  4DR3 B;  1XOU A;  3JCZ A;  2LW1 A;  1RFY A;  5JCO A;  4H44 B;  1L0L H;  3D8C A;  1XL6 A;  1VIB A;  3JAS B;  4JYB A;  4FVM A;  1O9H A;  4QPK A;  1TGO A;  2IJH A;  5BY1 A;  4X65 B;  3BAA A;  4JYY A;  5LA6 A;  2DYS B;  2Q7G A;  3L75 H;  5L3E A;  1I7F A;  3E89 A;  2RMK B;  1LR1 A;  4FLV A;  2JGD A;  1P7B A;  3C90 A;  3BEH A;  4NTW A;  2PZS A;  5KMG B;  1EN6 A;  1Z5W A;  2CTR A;  4GYC B;  3M8A A;  3ZX6 A;  1FJG O;  3P30 A;  4WFF A;  2BSK A;  1Y67 A;  4FM1 A;  4KP4 A;  2BTO A;  3IC9 A;  5BMV B;  3AG4 B;  4JYA B;  2A7W A;  3UCS C;  3FB5 C;  2IW5 A;  5KLV H;  3HKE B;  3BVO A;  2QWR B;  4H13 B;  2ZE8 A;  2QTO A;  4J7K A;  4BIZ A;  2ZDI C;  4UV8 A;  1SQG A;  4X88 A;  2Y48 A;  3G67 A;  3MDS A;  1MOF A;  4JI4 O;  4FZ1 A;  3T1H O;  4DV7 B;  3U11 A;  1JR9 A;  2YSU B;  2W6J G;  2FL4 A;  4X66 B;  2JJ2 G;  1HDJ A;  1AJN A;  3ZJZ A;  5E79 Z;  3SJC C;  2R70 A;  2DQ3 A;  4YY3 O;  2ZIM A;  1ZWI C;  1CXZ B;  4P2Z A;  5L3F A;  5LOV A;  2AW9 A;  2ZNI A;  4JI0 O;  3QVN A;  4FLT A;  2YUA A;  3ASN C;  1PL4 A;  4U3J A;  2NR5 A;  3OMA B;  1U96 A;  3ZMZ A;  4CZZ A;  2QA4 V;  1PPJ H;  1IBK O;  4LF5 B;  3LDC A;  4DUY B;  1QCE A;  3RYC A;  3I5D A;  5IYB O;  2LP7 A;  1LNQ A;  5B3S B;  3OTF A;  5LGU A;  3K06 A;  2HR3 A;  4X8A A;  1H2K A;  2E5L O;  2F93 B;  1MG1 A;  4B3T O;  2E76 B;  2UU9 B;  4JV5 O;  4UV9 A;  3N27 A;  1SF9 A;  2IBZ H;  1GN2 A;  5JWP A;  1FFT B;  1VQM V;  4JTD B;  2CGO A;  2WLH A;  4QE7 A;  2CH7 A;  1JQ0 A;  3F7Y C;  3HKC A;  3HR0 A;  4UCO A;  2R9R B;  5KA6 A;  1Y4M A;  4ABM A;  3FB7 C;  3QO8 A;  3VBB A;  3CCM V;  2H3O A;  3QO7 A;  4OGQ B;  1N0N A;  5CB4 B;  1GK9 A;  2P67 A;  4F6R B;  1QLE C;  3RBZ A;  1QU7 A;  1XIL A;  2QM4 A;  4A5U B;  3JD2 A;  4EKW A;  2KQX A;  1OJH A;  3CRA A;  3SJQ C;  3JD4 A;  2NN4 A;  4LF9 B;  4J9Y B;  4PV1 B;  1AR1 B;  1Z2G A;  3ZBH A;  3OGC C;  5LHH A;  1NR1 A;  2EIJ B;  4LWS A;  1BGY H;  4DW1 A;  1AI6 A;  5IJ9 A;  2UUA B;  4O2A A;  3K03 A;  5J9P C;  1S3J A;  3B09 A;  1SZT A;  2CDY A;  2W0X A;  2WLL A;  1TUB B;  4J10 A;  4ZBM A;  2LO1 A;  1WLE A;  1VF7 A;  3JAR A;  4DUZ B;  1N36 B;  3JAW B;  4ZHQ B;  3VQX A;  1CP9 A;  3ZHS A;  2DYR B;  4FM0 A;  3EXA A;  2Q7E A;  3T1C A;  3F5T A;  4QJF B;  3OGI B;  1HNZ B;  2QGN A;  2UXN A;  3LNN A;  1JOY A;  2AGA A;  4NTY A;  4MT8 A;  4YJ2 A;  3ABM C;  2OCC B;  1YIT V;  2DJV A;  5CMU A;  1WB7 A;  1NQT A;  3CCU V;  4MVS A;  3W7W A;  5LP6 A;  1R1B A;  3HKD B;  4DV5 B;  3T2M A;  3Q4H B;  4FLZ A;  1YVW A;  4QPJ A;  3FB6 C;  2AHZ A;  4HNA B;  3S3W A;  4DR4 B;  4BIO A;  4NXM B;  2ATK C;  1H2G A;  2Y4T A;  2BTQ A;  4N23 A;  5KAF Z;  3DXR B;  5JJJ B;  3EHB B;  2V1D A;  1HW7 A;  3ZCC A;  2YID A;  1I5X A;  2LJ2 A;  4WCE V;  4MTG A;  2IJJ A;  2UXD O;  1RSO A;  3KZI Z;  1BSM A;  4Z2W A;  1OCC B;  4IIJ B;  4MW3 A;  4Q20 A;  1XMQ O;  4O4J A;  2F23 A;  1XDC A;  4CH5 A;  4JI2 O;  5LHI A;  3CCR V;  3RT3 C;  4TV9 A;  5BXZ A;  4LF7 O;  1HNW B;  4CH6 A;  3ZMS A;  1XQ8 A;  5JVD A;  1NJI W;  3SPH A;  1Y74 B;  4O4I B;  3ABL B;  1F4M A;  4IHJ B;  3JAT A;  3ZRS A;  4O4H A;  2KG7 B;  4RO2 A;  2PI4 A;  3B2E E;  2HJD A;  2YI8 A;  3APO A;  2Q7H A;  5CBH A;  3CX5 F;  1EN4 A;  2M6Y A;  2Z5U A;  3ETD A;  1B06 A;  1Q86 W;  1N33 O;  1M57 C;  1PP9 H;  2ZDI A;  1HNX B;  4GKK B;  1S0V A;  2X6A A;  1OCZ B;  4MVO A;  1P84 F;  3HB3 B;  2ODM A;  4OPH A;  2YDE A;  1Y6X A;  1AP6 A;  1AR5 A;  3K58 A;  1EFR G;  3E83 A;  3QF7 A;  4J9Z B;  2OTL V;  1X59 A;  3BPZ A;  1HR0 B;  4DR2 B;  3AK3 A;  3OUF A;  3ML0 A;  2H94 A;  3I56 V;  4B7K A;  2GUZ B;  4D6T H;  4AQY O;  4LP8 A;  1IBM O;  2JGU A;  2ZR3 A;  2KB1 A;  4LNU A;  4JAV A;  5LMN O;  5LMU B;  3ASO B;  3TXQ A;  3RYI A;  2B1G A;  2QWN B;  1K34 A;  1PM9 A;  3OR6 C;  1NTZ H;  4DXW A;  2PY5 A;  2NLJ C;  5IWA O;  3UT5 B;  1FYJ A;  2JRI A;  4I9W A;  5IY5 C;  2ILM A;  1D2D A;  3NXS A;  1WPB A;  3EVK A;  1N34 B;  4X64 O;  2XOK G;  4UCV A;  5EZY B;  4BW5 A;  2ZKO A;  3A0H Z;  4XBF A;  4LF4 B;  3TET A;  1SQB H;  3K5O A;  5FNV B;  4FFB A;  1BHB A;  2UXC B;  2GSM B;  4CH4 A;  4KHP B;  5IE9 A;  2E3C A;  3D3Q A;  4MTF A;  4NYK A;  1K9M W;  2ZXW B;  1YCI A;  4DV1 B;  2UUB O;  1SQF A;  1L8D A;  1OCO C;  3CJH A;  3TK1 A;  5CBG A;  1M4U A;  4OPA A;  1G1X B;  3J80 N;  5KHI A;  3IFX A;  4PDV A;  2X7R B;  3DTU B;  3CB2 A;  4E2L A;  2HHH O;  4UVC A;  2A79 B;  1F23 A;  4JF3 A;  4B08 A;  3CME V;  5B1A B;  4B3M O;  3LSQ A;  2YXL A;  2UXB O;  1Q82 W;  1FXK B;  1KEC A;  1NTM H;  2YIC A;  2K9P A;  5IYC O;  1ZSP A;  3CCL V;  4GX0 A;  1GRJ A;  2HVJ C;  3SGI A;  1FKA O;  4K8Z A;  3ZS8 C;  4DR5 B;  5KHH A;  4JI3 O;  4JTA B;  3K5L A;  4RUE A;  4H33 A;  3J81 N;  1SET A;  4RAI A;  5LYJ B;  2P90 A;  4UB8 Z;  4I0X A;  2ZNJ A;  3BHP A;  1I94 O;  2ARH A;  5KHJ A;  4D7T A;  1P49 A;  3UQ8 A;  2QWO B;  1AIL A;  4EFB A;  5LBQ A;  2MW2 B;  1URF A;  5IYZ A;  5KHK A;  4DR6 O;  2OWO A;  1WP8 A;  3OEH G;  3O65 A;  3L72 H;  1R3I C;  2N05 A;  4JI1 O;  1IBL O;  4NVP A;  4I4T A;  4O2B B;  1MAB G;  1MZF A;  3FAV B;  1DK1 A;  4K0K O;  4GKJ O;  3MHH C;  4DR3 O;  3KG2 A;  4I50 B;  2VQF O;  1W59 A;  4OXS A;  3ZHU A;  2D3O W;  1NH2 B;  1YIJ V;  1WA8 B;  1M1K W;  3N2G B;  4X62 O;  1BQZ A;  1P7G A;  4J7Z A;  4I55 B;  1VEW A;  5B66 Z;  2R9A A;  5C8Y B;  1BMF G;  1K33 A;  1K8A W;  1AI4 A;  1WJZ A;  2ZE6 A;  2VWJ A;  1KD1 W;  5EYP B;  1IXM A;  1FD9 A;  3RYF A;  3OTO B;  4KXR A;  5CBF A;  3T1Y O;  4ZOL A;  3SPJ A;  1T5E A;  4JI5 O;  4FK5 C;  1YJ9 V;  3E86 A;  2YS8 A;  1PNL A;  3IGA C;  3RFR A;  4CH3 A;  1N32 B;  3L74 H;  4DV4 O;  2DW4 A;  4B3R O;  4N21 A;  3WB2 A;  4MVU A;  4PDM A;  2EIL B;  5IJ0 B;  1IUR A;  3ZHT A;  4LFC O;  1SA0 B;  2P22 C;  4UVB A;  3T4Z A;  3WG7 C;  1ZTE A;  2Y0P A;  3TCU A;  4PA9 A;  2BCC H;  1KKD A;  1JFF A;  2OIE A;  4FM2 A;  2CE4 A;  5KAI Z;  3JYC A;  1OV9 A;  3R65 A;  5IYD O;  2F4V B;  4K3A A;  5KX5 A;  1MSW D;  5J2T A;  3K5N A;  4QE9 A;  4R50 A;  4X66 O;  1A32 A;  3I55 V;  3TGU H;  1D5N A;  4P9P A;  2EZO A;  2V7Q G;  4MSW C;  1P4R A;  3QTC A;  3BRC A;  3CHX A;  3JAM N;  1SC5 B;  2WSS G;  2CUG A;  3L70 H;  4TUY B;  5J2U B;  4AIL C;  2HKO A;  2P4K A;  2DE0 X;  5K1X A;  4IGG A;  4YIO A;  4DUY O;  2WLJ A;  3BAB A;  3CCJ V;  1GH6 A;  4G28 B;  5H6Q A;  1IXB A;  4LFB B;  3L73 H;  5LXT B;  4NXN O;  1ENV A;  2OIG A;  4J42 A;  2YXH A;  2VS0 A;  3WB1 A;  3H9V A;  1NS1 A;  1R3K C;  2W6I G;  3JAK B;  4E4E A;  4U3F H;  2EIL C;  1IJG A;  3OW2 U;  2QSA A;  1QNM A;  2XUM A;  1DGS A;  1VMG A;  3E8F A;  3JD3 A;  5JQG A;  5JJE B;  3K0G A;  4LC1 A;  2Q8V A;  4P9O A;  2Z0A A;  4X1I B;  3ABU A;  1N4C A;  2EIK C;  4KL1 A;  3OM3 B;  3K5M A;  3O9O A;  5BZB A;  2C2A A;  5LGN A;  3SYP A;  5ITZ A;  3RYH A;  1QQC A;  5B1B C;  2Q69 A;  3A0R A;  4G2K A;  1J95 A;  4PDR A;  2P6J A;  4PDL A;  4WFG A;  5CA0 A;  2OYQ A;  1AB3 A;  4B3S B;  3ZMV A;  1YEW A;  5FPR A;  2VQE B;  1XMO O;  3ABK B;  2GBO A;  5LL6 Y;  1V54 B;  4YHH B;  1G6U A;  3ZRW A;  1K3E A;  1KQS U;  2FML A;  3P3P A;  2LQT A;  1Z5V A;  4IYI A;  4NB5 A;  2P5O A;  3ZMT A;  4FLY A;  2DMX A;  2DYS C;  3RN4 A;  2JS5 A;  2YEV A;  1SQV H;  4JI7 O;  4UXN A;  3MAQ A;  1R6T A;  1XNQ O;  2CAZ C;  1VP7 A;  4WBN A;  1ZX3 A;  3SYQ A;  3UM7 A;  2ZT9 B;  4JI8 O;  1GM9 A;  1XRE A;  1PNM A;  1E1R G;  2FTK A;  5CA1 B;  4DUZ O;  3L71 H;  4DYL A;  3K57 A;  1VQ6 V;  2YIB A;  1KUQ A;  4R7C A;  2QWP B;  3KCX A;  3AG4 C;  4U7N A;  4CBC A;  4HZ3 A;  1K97 A;  1H38 A;  4ICG A;  1HNZ O;  3CP1 A;  2HG5 C;  1F4N A;  2EZP A;  2L35 A;  1DLB A;  1VQK V;  3S3X A;  4TQF A;  1XNR B;  2AXT Z;  1RM1 B;  4OX9 B;  4CS4 A;  2IU0 A;  1FJG B;  1V54 C;  2AHY A;  3FD9 A;  1WNS A;  1KU9 A;  3FYE B;  1V55 B;  3FB8 C;  3HKB A;  1K73 W;  1GN6 A;  1NTK H;  4DR7 O;  1S76 D;  1FFX B;  4JI6 O;  4CS3 A;  1THZ A;  1IZ3 A;  2WLN A;  1R6K A;  3F7V C;  3CRQ A;  4YIP A;  4QGP A;  5GON A;  3RWR D;  2HJF C;  5JJN B;  2VRZ A;  1SER A;  3B8N A;  1BZK A;  4TV8 B;  3JSN A;  1G4Y B;  4JI4 B;  3H1K H;  1K7D A;  2X6B A;  5B3S C;  3CEI A;  5LGT A;  1FOU A;  1PKX A;  3W7S A;  3BA8 A;  4LF8 O;  5FLX N;  4FFK A;  2Q9L A;  3LDE A;  3CYO A;  2FYU H;  4WFA V;  4YY3 B;  4P30 A;  4QIW F;  1S77 D;  1D5A A;  2Q5Z A;  3CCV V;  4JI0 B;  4TOI A;  3SPI A;  4X1K A;  2WPD G;  4IYH A;  1Y76 B;  4CC6 A;  1TUE B;  1IBK B;  5D5P A;  1B3Q A;  4YJ3 B;  3B77 A;  2FKX A;  3APQ A;  1ZUQ A;  4LFA O;  2JK5 C;  4DRX A;  4LF6 B;  3G80 A;  4DV3 O;  2EX3 A;  2E5L B;  1XBL A;  1HR0 O;  4B3T B;  1JMK C;  4DR2 O;  2PTM A;  1ZL8 B;  4JV5 B;  3GWO A;  1HWY A;  4EB6 B;  2XAQ A;  2LFR A;  3M99 B;  4X1Y B;  4LR3 A;  4O4L A;  4HBN A;  3UO2 A;  5CN0 A;  2XAF A;  1H8E G;  2JS3 A;  5JH7 A;  1TAE A;  3UO3 A;  2EIJ C;  5EYP A;  3ETQ A;  5DED A;  3ETE A;  5IT9 N;  5LMU O;  3VQY A;  4GT1 A;  4L8J A;  1KB9 F;  4LH6 A;  3JAL A;  1NH2 D;  3OEE G;  4DW0 A;  1MSD A;  1H5W A;  1QR8 A;  4R8C A;  3TXS A;  4X20 B;  4ZI7 A;  4FLU A;  4CS2 A;  1XL4 A;  2IH3 C;  2DYR C;  1N34 O;  1VQ7 V;  1PV0 A;  2WLI A;  1YDX A;  2ZIN A;  4BW9 A;  2B9Z A;  2HLD G;  3OE7 G;  3CWB H;  1J5E O;  4QNH B;  1QLN A;  2OCC C;  3N2K A;  5LA6 B;  3ZMU A;  3DGE A;  3W7T A;  2G38 A;  1JJO A;  1Y66 A;  4RQF A;  4KHP O;  4GLX A;  1EZV H;  2JGD B;  4MTX A;  1VAR A;  1TVK A;  2ZCE A;  1KP3 A;  1EN5 A;  3E22 A;  1KP2 A;  5B1N A;  4EEQ A;  2A9H A;  1ZLZ A;  3SPC A;  2EIN B;  4ZKI A;  2BSK B;  1WPX A;  3DC6 A;  2QM7 A;  4BWA A;  4ZIB A;  1GN4 A;  3JAS A;  3PN1 A;  4PHZ A;  3ZN1 A;  3OMN B;  2ADQ B;  5B1O A;  1S5H C;  1R6N A;  4MS2 A;  3BA9 A;  5LHG A;  2KKW A;  2ZE5 A;  1VF5 B;  4UCS A;  1OCC C;  1NI8 A;  3ZED A;  2RDC A;  3KKY A;  5KMG A;  4JAA A;  3OT7 A;  3R66 A;  3H1J H;  3C3S A;  1UPG A;  1U97 A;  2N04 A;  2ADP A;  1Q90 D;  3U0Z A;  5GW7 A;  3ABL C;  1GM7 A;  4MW8 A;  4DR1 B;  3STL C;  1K5Q A;  5BMV A;  5A2Q N;  2WWW A;  5BR8 O;  3HKE A;  5LOV B;  4X9Q A;  3ZHR A;  1N0J A;  4DK0 A;  4DV2 O;  2UXD B;  1S5J A;  1DTO A;  4I7Z B;  4U3J B;  3GVM A;  2A3Q A;  3LSS A;  1YZB A;  4GX1 A;  4WF9 V;  1OCZ C;  1XMQ B;  3VQV A;  4I9Q A;  3RYC B;  4JI2 B;  1VF6 C;  2GDS A;  5H2F Z;  1M5I A;  2OCH A;  2P7T C;  1NBM G;  4LF7 B;  1SES A;  3OMI B;  2CGN A;  4UVA A;  5DM6 V;  2XAH A;  2BE3 A;  4W4K A;  1OCR B;  2HEP A;  5FL7 G;  2DWD C;  3GWK C;  1BL8 A;  4PA4 A;  3VQW A;  1N33 B;  1JPX A;  3ASO C;  1IVS A;  2D2C B;  2PUS A;  2WLM A;  3AG7 A;  5AG2 A;  3X2Q B;  1NZ6 A;  1Q5O A;  2CH7 B;  3HKC B;  2ITD C;  2Y69 B;  2WAM A;  3QG5 A;  3ZRV A;  4F4L A;  1H8H G;  1VQP V;  4NR1 A;  5EK0 A;  4KFM A;  4PA6 A;  2EIM B;  3G6E V;  4FLX A;  3WFV A;  1JVM A;  4DV0 O;  1AJQ A;  1L1F A;  2QDO A;  2HVK C;  1M56 B;  4RUF A;  4AQY B;  1IBM B;  3D3I A;  2JDI G;  2ZQM A;  5LMN B;  1NKD A;  5F2V O;  4LWS B;  1S72 V;  1XHX A;  1NVP B;  1H2S B;  5IJ9 B;  4O2A B;  2WLL B;  4FJC C;  5IWA B;  2ZM6 O;  2ZXW C;  2YIA A;  3CSX A;  2QJ1 A;  2F95 B;  2Q4P A;  5CB4 A;  3DSQ A;  3JAR B;  4F6R A;  5FPO A;  3K08 A;  3WB0 A;  4X64 B;  2DOS A;  4GX2 A;  1O9G A;  3B8M A;  3AG1 B;  1QR9 A;  2OT5 A;  1SS3 A;  1FAF A;  1JNB A;  3SYC A;  2LFS A;  2R9I A;  3AG2 B;  3TJT A;  1GMG A;  1SKV A;  4NKG B;  5B1A C;  4YJ2 B;  1OZ0 A;  2ITC C;  3CC4 V;  4MVM A;  4X65 O;  1FXK C;  3ZRX A;  3H01 A;  2JEX A;  4WFE A;  3SDL A;  2QWQ B;  4KUM A;  1TUB A;  2B1I A;  4TQD A;  5LP6 B;  2UUB B;  2ETN A;  3JAW A;  4MVQ A;  2GV9 A;  2CTQ A;  2LW7 A;  2X6C A;  4ZHQ A;  3W7X A;  3G4S V;  3H1I H;  2HFE C;  2XT9 A;  3RVZ A;  1COW G;  4UCR A;  4JYA O;  5H9C A;  4H37 A;  2B5U A;  3HPL C;  4B3M B;  5KUK A;  3P3N A;  1WB8 A;  5C93 A;  2QTS A;  4ASU G;  4TSF G;  1RSO B;  5A9G A;  3T4D A;  1QVG U;  3AG3 B;  3CRM A;  2WLK A;  3D36 C;  3CXC U;  1W0J G;  2RN9 A;  4O4J B;  5K1P A;  3HKD A;  3A0B Z;  3Q4H A;  4DV7 O;  4FZ0 A;  5HFL A;  4WFB V;  1I08 A;  3QNE A;  4HNA A;  2XAG A;  4JI3 B;  3CXH F;  4TV9 B;  3AG1 C;  1AR4 A;  4LH7 A;  2E74 B;  3K04 A;  5JVD B;  3DXR A;  3JAT B;  4O4H B;  1M93 A;  2M7W A;  1I94 B;  3SPG A;  2EJ7 A;  1QHT A;  4DR6 B;  1RP3 B;  4IIJ A;  2ZIO A;  1V9P A;  1IBL B;  4LF5 O;  1Q6I A;  1ORQ C;  2IJK A;  3BCC H;  4DV6 B;  1WN7 A;  5EBL C;  2VQF B;  4U7O A;  1H2L A;  4UCT A;  2JJ1 G;  1Y74 A;  4O4I A;  3GB7 C;  4IHJ A;  2KG7 A;  4X62 B;  2UU9 O;  2VWK A;  1ARO P;  4I5S A;  4UFZ A;  1VQL V;  1XUQ A;  2F66 C;  4D7S A;  3AG3 C;  5DN6 G;  2L6L A;  2Q0A A;  1AP5 A;  3ASN B;  1Q81 W;  4LNU B;  3ZHQ A;  3T1Y B;  1XNR O;  4OX9 O;  3RYI B;  1YXB A;  2YI9 A;  5L3D A;  1VF6 A;  3E8B A;  3H1L H;  3U10 A;  3C3T A;  4JI5 B;  1YTF D;  1AI5 A;  2GTA A;  2AZ0 A;  1H2M A;  2QR4 A;  1AJP A;  1YI2 V;  4AI8 A;  4DV4 B;  4B3R B;  4UCU A;  2UUC B;  2V4D A;  4LFC B;  4JZ2 A;  1M90 W;  4PI2 A;  1Q43 A;  2GUZ A;  1UJW B;  4MVZ A;  4LF9 O;  1B04 A;  1I5Y A;  4TT3 G;  4FFB B;  2EUL A;  2UUA O;  3KDR A;  2KSD A;  1EM1 A;  2PI5 A;  2PGG A;  4PA3 A;  5TIS Z;  1K92 A;  4IT5 A;  3UT5 A; 
#chains in the Genus database with same CATH homology
 3C3S A;  1XDC A;  1I0H A;  2ADP A;  1XIL A;  2RCV A;  2QKA A;  1AVM A;  4E4E A;  1P7G A;  1QNM A;  3AK1 A;  3MDS A;  1VEW A;  1IDS A;  1BS3 A;  1JR9 A;  1GN6 A;  4X9Q A;  1N0J A;  1EN4 A;  1SZX A;  2CDY A;  1JA8 A;  1MSD A;  1B06 A;  4YIP A;  2GDS A;  1GN3 A;  3AK2 A;  3TJT A;  1BT8 A;  2AW9 A;  3K9S A;  1AP6 A;  1AR5 A;  3QVN A;  1LUW A;  1PL4 A;  1XUQ A;  4F6E A;  3CEI A;  1AP5 A;  4GUN A;  4C7U A;  1MMM A;  3AK3 A;  1ZTE A;  1IX9 A;  1ZSP A;  1WB7 A;  1MA1 A;  2CE4 A;  4FFK A;  3C3T A;  1VAR A;  3RN4 A;  1EN5 A;  1MNG A;  4JYY A;  4BR6 A;  5AG2 A;  1D5N A;  1ZLZ A;  1WB8 A;  1XRE A;  4JZ2 A;  3DC6 A;  1PM9 A;  1GN2 A;  1GN4 A;  2QKC A;  3DC5 A;  5A9G A;  3LSU A;  1ZUQ A;  1EN6 A;  2ADQ B;  4JZG A;  2P4K A;  1LUV A;  1I08 A;  3EVK A;  1Y67 A;  4YIO A;  1KKC A;  3IC9 A;  3KDR A;  1EM1 A;  1AR4 A;  1BSM A;  1N0N A;  1IXB A;  3BFR A;  3OT7 A;  3KKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...