3K9SA

Crystal structure of the peroxide-bound manganese superoxide dismutase.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structural Analysis of Peroxide-Soaked MnSOD Crystals Reveals Side-On Binding of Peroxide to Active-Site Manganese.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 75
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3k9sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3k9sA02
1QNMA 1XREA 1AP6A 1JR9A 3LSUA 5AG2A 1PM9A 2QKAA 3AK2A 1PL4A 1WB7A 1ZTEA 4C7UA 3EVKA 3IC9A 1ZSPA 1GN2A 1IDSA 1P7GA 5A9GA 1WB8A 1GN6A 2CE4A 1LUWA 1BS3A 1AR5A 3K9SA 1AR4A 1MNGA 3KKYA 2CDYA 3BFRA 3AK1A 3TJTA 1VEWA 4JZGA 2P4KA 1B06A 3C3SA 1MSDA 1N0NA 1ZLZA 2ADQB 3DC5A 4BR6A 3MDSA 3CEIA 4E4EA 4GUNA 1EM1A 2RCVA 4YIPA 1GN3A 3C3TA 1JA8A 4JZ2A 1IXBA 3OT7A 4JYYA 1ZUQA 1I0HA 1MA1A 1EN6A 3DC6A 2GDSA 2ADPA 1KKCA 1XILA 1AP5A 1XUQA 1D5NA 1LUVA 4F6EA 4FFKA 1VARA 1GN4A 1SZXA 1N0JA 2AW9A 1EN4A 1MMMA 4X9QA 1EN5A 3AK3A 2QKCA 4YIOA 1AVMA 1XDCA 1I08A 3QVNA 1BSMA 1Y67A 1IX9A 1BT8A 3RN4A
chains in the Genus database with same CATH superfamily
2Q67A 4YHHO 4JI2B 1QNMA 4JF3A 4A5UB 3G67A 5L3FA 2UXCO 4JASA 4DV0O 3JAKA 3ZCCA 4AHCA 4DUYO 3JASA 3IC9A 3OW2U 1LNQA 3CC7V 4F6RA 3CRCA 1GN6A 4KFMA 2CUGA 2CH7B 2OCCC 4DV2O 4UXNA 2DQ0A 4LFBB 1JOYA 4Z2WA 1TVKA 1AR1B 1MZEA 3ML0A 3ZIAG 1AJPA 4MVMA 3HKCB 3VOUA 2JEXA 4EB6B 1OV9A 5IYDO 1JPXA 3APQA 3DC5A 2XNDG 4QPJA 2KKWA 3CB2A 1L0LH 5GONA 5CA1A 4U7OA 2EIKC 3P32A 5KHIA 1TAEA 1EM1A 1SZTA 4HYOA 1GN3A 4H37A 3CSXA 3K03A 2P06A 2EIMC 2LGWA 1IBMB 2XAHA 1IZ3A 4B08A 2L6LA 3I56V 4BIUA 4LR3A 2HVKC 1E1RG 3GB7C 2ZIOA 4DV6B 2GBOA 5K1XA 1E79G 4O4IB 2DJVA 1B6QA 3RW0A 1DLBA 3E89A 2D3OW 3A0BZ 3TETA 3E2EA 4FFKA 3OMIB 3N2GB 4R50A 2JGDB 2M6YA 2HJDA 2QWQB 1RPRA 1QVFU 3CJHB 4PD4F 2PI5A 1MSWD 1SERA 2V7QG 4F4LA 5L3DA 5EYPB 3JAWB 1IVSA 4WFGA 4MW3A 1TUBA 5KHHA 3H01A 4PA7A 3DTUB 2A06H 3SJBC 2Q0AA 1QLEB 1IXMA 3E8GA 4B3SB 2LFRA 5JCOA 4CC6A 4PV1B 3BPZA 1U96A 4G2KA 4DR4B 3OAAG 4UUJC 4J7JA 3AG1B 4KXRA 4FIPC 1K9MW 5B1AC 1ZSPA 2KB1A 3ASOC 2ZE8A 3I5DA 1XNRO 1IDSA 2R70A 1N36B 2LW1A 4ZKIA 1BS3A 1AJNA 1K5QA 1XL6A 1JVMA 4OPAA 3RFRA 4DYLA 3O9OA 1J5EB 1YVWA 2UUAO 3MHHC 1R3KC 4FPPA 1Z5VA 1B06A 2RMKB 4DV4B 2P67A 1NKDA 2ARHA 2P90A 3ZX6A 1G6UA 3BHPA 1AI7A 5FLXN 5JCOC 1OCZC 1KBHA 4I0XB 5IJ9B 5ITZB 2YI9A 5LA6B 4YY3B 1NVPB 3H1IH 4WFHA 4X66B 1IXBA 1CXZB 5LYJB 3SJAC 1MABG 4UCUA 1W0JG 1U97A 1X59A 1EN6A 4TUYB 2ZDIA 2B9ZA 4DR3B 4JI4O 5F2VO 4TOIA 5J2UB 4J41A 1XMQB 1F23A 1UPGA 1WAZA 2IH1C 2ODMA 4DR2O 5KHGA 4DV3O 2LFSA 4L8JA 5KX5B 2YXHA 2PY5A 1R73A 3KCXA 2EX3A 1N33O 1P7BA 2JDIG 2F93B 1M90W 4GLXA 4GT1A 3ASNB 2XAFA 4J7KA 5IJ0B 3TCUA 3HPLC 4W4KA 2ETNA 1PPJH 4JTDB 4H33A 1FFXB 2ZDIC 5FL7G 3CCLV 5HFLA 4DV7O 4PDMA 4XDKA 1WP7A 4LC1A 4JAVA 4GX1A 1CPYA 1RP3B 1FKAO 2EILC 1Y6XA 4B3TO 2PYLA 5EIBD 4PA6A 1L1FA 4I4TB 3VBBA 1S5JA 2F43G 3ZMSA 4PA3A 5A9GA 1VP7A 4UV8A 1Q6UA 3CC2V 3CWBH 1RFYA 1WN7A 2ZINA 4X1KB 5CBHA 5JJEB 5CMUA 2X6AA 2WWWA 5IY5B 3RYCA 1HNZB 4JV5B 3KKYA 4Z1MG 3CMEV 3WG7B 3THOA 3K0DA 2XOKG 4LF5O 2XAQA 1VF5B 2AHYA 1FXHA 5CA1B 4O4JA 4GUNA 3K57A 4FZ1A 4Z1VA 3E8BA 2WLIA 2FB5A 4U3FH 3OT7A 4NTYA 1ZUQA 2M7WA 3APOA 2UUCO 4GX5A 1NJIW 5LOVB 1IBKO 1I5XA 4I55A 4X20B 1YDXA 1Y74B 2KG7B 1SQQH 1N34B 1OCOC 1M93A 1XEQA 2HJFC 3SYCA 5KUKA 5LBQA 1VQMV 2VQEB 3IC7A 4GYCB 2VWKA 4MTOA 1I94O 4OPHA 2YDEA 4GKKB 1BGYH 1KP2A 2YSUB 4G28B 5E1AC 1EN4A 2JEUA 4MS2A 2BCCH 1AI4A 2JS3A 1XI1A 2IJKA 2QWNB 3ABMB 5LMNB 1SQGA 2YIBA 2DE0X 1BSMA 1TUBB 3ZRWA 4KHPB 4OX9B 2PZSA 2F66C 2WLLB 1QR8A 2UU9B 1HNXO 1AP6A 4TV9B 1JR9A 1K7DA 3OTOO 2IM9A 1PNMA 3L74H 4MTGA 2UUBB 2DYSC 1WB7A 1N32B 2QR4A 3EVKA 3ZHRA 1FXKA 3BVOA 4OXSA 2BTQB 1Q7YW 5IYZA 2Q73A 4IHJB 1HDJA 3GVMA 4DK1A 1VQPV 3BFRA 4DUZB 2P4KA 2ADQB 3G4SV 3CEIA 2IU0A 4LFBO 4GKJB 1N4CA 2QWPB 1IBLB 1T5EA 1XL4A 3K79A 4JI3B 1AJQA 2CH7A 3BABA 1UFIA 1FXKC 1H5WA 1DF4A 4O4LB 1H2MA 5KHJA 1VQ7V 1D5AA 1XBLA 2Y69C 2ZD9A 1Y4MA 2E76B 3HKCA 4EB6A 5B1BB 4CH6A 2YI8A 4TV8B 1SC5B 2JJ1G 3GWKC 3QTCA 1IBMO 4LF9B 3K9AA 3WB2A 2CAZC 2Q5ZA 1DF5A 1ZWIC 4FLZA 3MHSC 4QIWF 4XBFA 1MMMA 4NB5A 1VQNV 1ZX3A 1K5SA 2ILMA 3OEHG 3QO5A 4TT3G 4X62B 2PTMA 4O4IA 2VQFB 3OR6C 4RUEA 3ZMUA 4JI0B 2X6CA 1YJWV 2LGQA 1D2DA 2QEXV 3OE7G 4YJ2B 3N2GA 5K1PA 3CJHA 2OCHA 2QM4A 5EYPA 4B7EA 3TGUH 2ZM6B 3JAWA 5EZYB 1K73W 2Y0PA 4B3RO 2EJRA 1Q82W 3NXSA 1G4YB 1LUWA 4B3SO 4TWKA 4MTXA 3N27A 2YIAA 5GTHZ 2XTAA 4K3AA 1VEWA 4X1YB 4HZ3A 1PL0A 1Z5WA 1PKXA 4R6ZA 5LL6Y 2YICA 3CXHF 1N36O 1GK9A 3ETEA 4LP8A 1E1QG 2C2AA 1GM7A 5D5PA 1YJ9V 1J5EO 3CE2A 5FPRA 2Z3YA 2GTAA 5A2QN 3K5LA 5CBFA 3KG2A 3CC4V 5BY1A 4DV4O 4GZRB 3ZMTA 3G6EV 4BW5A 1VQKV 2Q8VA 5IWAB 2F95B 5LMUB 1QLEC 3BEHA 5LGUA 1AI6A 3K3WA 4YY3O 1XILA 4BW9A 3CRRA 4X66O 5KUMA 2AXTZ 3DGEA 2BSKB 4I0XA 5IJ9A 1PD3A 1NT2B 3JARB 2N05A 3T2MA 5ITZA 3AG1C 4DR5B 2AZ0A 2PF4E 2HR3A 2XHBA 4AI8A 5LHIA 1GH6A 1K92A 5LYJA 4DR3O 3U10A 3D8CA 3JALB 4TUYA 4IGGA 1NZ6A 4MTFA 3AG2B 3E35A 4ICGA 1XMQO 2QKCA 1R3LC 2IH3C 1I08A 1H2SB 2QM8A 4CBCA 4CS3A 4P2ZA 1QR9A 5J2UA 4FVMA 3R65A 4JI7B 2GSMB 4X64O 3OM3B 2DYRB 4NVPA 1VQ8V 3UQ8A 2P4VA 5EC2C 2DN9A 5KX5A 5AG2A 3FB8C 2QKAA 2QA4V 1JMKC 3T1YB 1PL4A 2JVDA 3A0HZ 3BCCH 4PELA 3RYFB 2X0LA 1OHHG 1YCIA 4YJ3B 5IJ0A 2EINB 2A3QA 1WPBA 2CE4A 4JYAO 3A0RA 1YTFB 1FFXA 2Q9LA 4EFEA 5B5EZ 4NKGB 1Q6IA 5B1OA 1FJGB 1ZAUA 3OR7C 5E79Z 2YC0A 4WFBV 4RO2A 1NH2B 3IFXA 4CH5A 1IURA 5L3EA 4I4TA 1W0KG 2A79B 3OMAB 2VRZA 1HNZO 2HG5C 4JV5O 1BMFG 1S76D 4X1KA 1GKFA 3ASNC 3SPCA 3IGAC 4WBNB 2UXXA 1BZKA 2MW2B 4PI2A 2A9HA 1VMGA 3R66A 1Z2GA 4W4LA 2F4VB 2F23A 3WU2Z 2XAJA 3ZMVA 4HBNA 5JH7A 3SJQC 2QWOB 2JIZG 3EFFK 1JFFB 1GO3F 3UO2A 3JCUZ 1K33A 1BCCH 3T1HB 4JI8B 1RSOB 4JI1O 1GM8A 5LOVA 2WLKA 2XASA 3UCSC 1SQFA 4K0KO 4X20A 3O65A 1Y74A 2VQEO 2KG7A 3UO3A 2OTLV 3ABLB 3QVNA 5IY5C 3ETQA 2E5LO 3ZRVA 3G80A 3S3XA 2PI4A 4EFBA 3HR0A 3LDEA 4GKKO 4TQDA 3PJSK 2OWOA 4FLWA 1KECA 1KB9F 3F7VC 4GX2A 3U11A 2H3OA 3TXSA 5LMNO 1L8DA 2R9AA 4KHPO 4OX9O 2NNUA 1WB8A 5HFMA 3G71V 1AR4A 2WLLA 2UUBO 1OCCB 4TV9A 2IW5A 4K8XA 1VQ9V 1KUQA 5KMGB 3JD3A 4MVQA 3SYQA 2QKSA 2WPDG 4B3MB 4I5SA 2BTQA 4PJ0Z 1MG1A 3CP1A 1V55B 2WLJA 1HR0B 1GMGA 4IHJA 4X8AA 1W59A 2FYUH 1JA8A 4LF4O 4DUZO 2E3CA 3ABMC 3H1LH 3JD4A 2HHHB 2WSSG 1H2LA 1S5LZ 4MSWC 3UKMA 3T4DA 4MVRA 4GKJO 1IBLO 4JI3O 4EEQA 1XQ8A 4LF7B 1OCRB 1XUQA 3T4ZA 1JQ0A 1LUVA 2BE3A 5EBWC 4LNUB 4CH4A 1Y76B 3CCUV 4O4LA 3CCMV 1Q8IA 4X9QA 1SS3A 1M9NA 4JAAA 2E75B 3L71H 4FFBB 1J95A 2CK3G 5LGNA 3IAYA 2ZCEA 1MZFA 3FKSG 3LNNA 3C90A 2ATKC 4FZ0A 3JD0A 5KAFZ 4TV8A 1FOUA 2EIJB 4QNHB 4DV5O 4TQFA 4FM2A 2GV9A 1YJNV 3JD1A 4X62O 2JK5C 2VQFO 3L70H 4JI0O 4ZOLB 5J9PC 1XMOB 1RM1B 2CTPA 3M8AA 1VQLV 1R6TA 1OJHA 1QQCA 3AEIA 5B66Z 4UVBA 4P9PA 2PYJA 2F1MA 1ZL8B 1AILA 2QTSA 4YJ2A 3CMAV 2OTJV 5B1BC 3P3PA 3NR7A 3GWOA 4ZBMA 4ZIBA 2ZKOA 2ZM6O 1HNWB 2QJ1A 3OGIB 1MSDA 1WLEA 4BR6A 4JI6O 2V4DA 1WA8B 4O4HB 5EZYA 4LWSB 3L72H 4H13B 2E74B 4B7KA 4YHHB 2ZR3A 5CN0A 1VF7A 3K58A 1S72V 2W6IG 3X2QB 4BIOA 4X1YA 4DV0B 5DM6V 1BQZA 4LCUC 1JCHA 1O9HA 4NXMB 4J80A 2H94A 3B2EE 5JH7B 4I7ZB 5BXZA 4HNAB 2JS5A 1FYJA 1GN4A 5BR8B 4DV2B 2AW9A 5IWAO 1X4TA 3HKBB 1QU7A 5LMUO 3B09A 5IT9N 1PNKA 3JCZA 3CCQV 4IT5A 4DR5O 4J42A 2BSKA 4UVAA 2Q69A 3BAAA 3JARA 3LSUA 2WAMA 2RNBA 2QE7G 2HVJC 1O9GA 4FLXA 1TUEB 1ZTEA 1S0VA 3RYHB 4IYHA 3J81N 3H1JH 2LQTA 3RGBA 4RQFA 2MK3A 3JALA 1V54B 1L0NH 1W2BU 4X88A 4JI7O 4PA9A 1R6NA 5BMVB 5B1AB 3EXAA 1AR5A 1H8HG 3T1YO 3RVYA 2OT5A 4BIZA 4DR7O 1XNQB 1N8RW 3RYFA 3B8MA 5CA0B 5KAIZ 3QO7A 4P30A 2QM7A 4YJ3A 4JI2O 4JI5B 1DTOA 2G38A 5EBLC 1M57B 4IIJB 1DK1A 4YIPA 1Q3EA 1FJGO 3AG2C 4BWAA 4FM0A 2NLJC 4UCTA 3DXRB 4MT8A 4J9YB 1KKDA 1KKCA 1NR7A 2DYRC 2QGNA 3HKEB 1M5IA 1AP5A 3KDRA 4DO2A 2Q7GA 4X1IA 1QVGU 1URFA 4LBEC 3QNEA 1NVPD 3ZS8C 4WBNA 2F4VO 3J80N 2AGAA 3HB3B 3JATB 4K8ZA 3FFQA 4YIOA 4ZI7B 3RN4A 1M4UA 3T1HO 4DW0A 4JI8O 3LNMB 4JYCA 1JFFA 4FMTA 2IJHA 4UCOA 1Q5OA 4DV6O 1RSOA 4C7UA 2CTRA 2GUZB 2A7WA 3AG3B 5H6QA 1CEZA 4GX0A 3F5TA 3CCRV 1R6KA 1H2GA 1RPOA 2RJZA 1NTMH 4HAMA 2Z5UA 3B77A 3MD0A 1FPOA 4DV3B 5LP6B 2DOSA 4LF8B 3TJTA 4BAYA 3ICXA 3K0GA 3WB1A 1WNSA 2ZR2A 2Y4UA 1KQSU 2ZXWB 1WJZA 4E4EA 1NS1A 3ZHSA 1AB3A 2CTWA 4NXNB 3CPWU 3C3TA 3QO8A 2R9IA 1COWG 1SA0B 4DR4O 4I50B 4DV7B 3ABLC 4D7SA 2EBOA 4B3MO 1F51A 5KMGA 4O2BB 2IU3A 2LP7A 3JSNA 4GCZA 4WFFA 2HHHO 1XHXA 5IYCO 4WCEV 3CCEV 2HFEC 1K34A 2ZE5A 3VQWA 3W7XA 2JGUA 5JJJB 1OCCC 2DMXA 1EZVH 1NR1A 2OIEA 3ETDA 3B8NA 5KLVH 4TSFG 1KD1W 1XREA 4PI0A 1K4DC 1Q86W 3MAQA 1PM9A 4LNUA 3CRMA 3ZBHA 3K5MA 1Y76A 3FB5C 4ABMA 2AZ2A 5DECA 1V55C 4FFBA 3FD9A 3E83A 4JGSA 5GW7A 3VQYA 4ZHQB 2WA3A 3BA9A 3CCJV 3CCVV 1MNGA 3L73H 2NN4A 1OCRC 2VS0A 5B1NA 5JWPA 1I94B 2CGOA 1XMOO 2YXYA 4RQEA 4DXWA 1NU1H 2ZQMA 2W0XA 4CZZA 3K04A 1NTKH 3LUTB 4ZOLA 4IL6Z 2P5OA 2YUAA 1SQXH 3SPHA 3ZEDA 1GTOA 4CS4A 1P49A 2LO1A 1ZL8A 4U3JA 2W6JG 1PNLA 4FLUA 1KYOF 2X6BA 1HNXB 1F4NA 1KU9A 5CB4B 2X7RB 3DC6A 3D36A 4UV9A 3SYAA 2ITDC 2EIJC 1F4MA 3SJCC 4PDRA 1EFRG 1SQVH 3UM7A 1WA8A 4O4HA 3ZRXA 2OYQA 3N2KB 1EZJA 4LWSA 4X1IB 4DRXB 2BOCC 2P22C 2UXBB 1BL8A 2H8PC 3AG4B 1SRYA 1LR1A 4XDJA 5LXTB 1RM1C 3ZRSA 1AROP 2WLHA 4UFZA 2B1GA 4NXMO 4RUFA 3OUFA 4DR1B 2PUSA 1PV0A 2P6JA 1R3IC 3SPJA 5D5QA 2QDOA 1Y67A 3M99B 4K35A 3E86A 1BT8A 4NTWA 3CHXA 5BR8O 3D36C 3Q4HB 4HNAA 1AI5A 3SGIA 4LH7A 1QCEA 2WLMA 1V9PA 2QTOA 3HKBA 3JYCA 1N34O 2ITCC 2FTKA 5C8YB 1YZBA 4OGQB 5CBGA 3ZHVA 3OMNB 4I9WA 4JTAB 2Y48A 3K9SA 3X2QC 3WG7C 2IBZH 1FS0G 1FFTB 3E22A 3JAMN 4WFAV 1M1KW 4DR6B 3AK1A 5B3SB 3RYHA 3W7SA 3ZN0A 4PDVA 1ZLZA 3MDSA 5CA3A 4DV1B 1YITV 5L3GA 2UU9O 3RYIB 3E8FA 4Q6GA 1B3QA 5BMVA 1H8EG 4WFEA 1Y66A 1XNQO 1EBOA 1H2NA 5JVDB 4MW8A 4FM1A 2V1DA 1YIJV 1N32O 3CS5A 1M56B 4RAIA 2Q4PA 4LF6B 1US6A 4MVOA 3LDDA 4JI5O 5CA0A 3ABKB 3BRCA 5JJNB 2DW4A 1GRJA 2YIDA 4UVCA 1VQ4V 1SESA 5C93A 4B3RB 2QSAA 1ORQC 4WF9V 1BHBA 4IIJA 3RVZA 3FAVB 2YEVB 4N21A 1V54C 1VQ6V 4LFAB 3ETGA 1KC8W 3DXRA 3ABTA 5EC1C 1OZ0A 1FD9A 5LHHA 3CXCU 3P3NA 5JQGB 1XDCA 3QF7A 4JPRA 3HKEA 4UB8Z 5FNVA 3UT5B 4J10A 4E2LA 2Q7EA 3K59A 2HKOA 2PGGA 2ZE7A 1XHZA 1S3JA 3AK2A 1VF6A 3RT3C 2HP8A 2A0LA 3J7AU 1UJWB 1VQ5V 1MOFA 3OGCC 1M57C 3JATA 1GN2A 2Q7HA 4CH3A 4LF9O 1HP8A 2YIBD 2BTOA 1H38A 4ZI7A 3CD6V 3SPGA 1THZA 4FLTA 2Q6AA 4QE9A 1YF2A 4J11A 2CTQA 2AHZA 3C3SA 4UCVA 5LGTA 1JJ2U 2GUZA 2UXDB 1NI8A 1A32A 1VF6C 2EZOA 2DWDC 4LF8O 4QGPA 4U3JB 1YTFD 4JZ2A 4UCRA 4X64B 5LP6A 4LFCB 3STLC 2OCCB 2ZT9B 3F5WC 1Q6HA 1P84F 4DW1A 3SYOA 4O2AB 5FPOA 5J2TB 3CRAA 2RN9A 3FB6C 1NH2D 4NXNO 2Y0IA 4X65B 4AQYB 1FXVA 3CX5F 1SF9A 4F6EA 1IJGA 4JYAB 4KP4A 5H5NA 3ZMZA 3M7MX 1SZXA 2XUMA 2YS8A 2ZNJA 3AG3C 1SA0A 2EIKB 1N0JA 3JAKB 4I50A 3ABUA 3FYIB 3JASB 2UXCB 1I7FA 3D3IA 3DSQA 3A8TA 3AK3A 4QPKA 2EIMB 4DUYB 4F6RB 3LSSA 1R1BA 4O2BA 5BZBA 1S5HC 1QLNA 5LP6C 1QBZA 4PDLA 1K4CC 1TVKB 3ZN1A 4L87A 1NTZH 3CCSV 2FL4A 2KQXA 2WLNA 2ZXWC 3OEEG 4PHZA 3P30A 3LSQA 1ROPA 4MVSA 4CS2A 2ZIMA 4UCSA 1NBMG 3JSLA 4H0LB 5GONB 3PN1A 3BA8A 3VQVA 3G6BA 1VIBA 2HEPA 4UB6Z 1SKVA 1B04A 4I9QA 4MVZA 3E22B 2CDYA 5L3CA 4QE7A 1H2KA 1GAXA 2N74A 3BY6A 4J7ZA 4JI1B 2JRIA 3HKDA 2FKXA 5DN6G 4G27B 4K0KB 3K5NA 4ZHQA 4H44B 2RQ6A 2E5LB 2B5UA 3A2FA 3ASOB 4FLYA 1QHTA 1XOUA 2RDCA 3CRQA 4CC5A 3AG7A 2BOBC 1R3JC 2W0FC 2ADPA 4EKWA 2EJ7A 5TISZ 2EULA 1YSCA 1FAFA 1K3EA 2GTSA 2L35A 1OCZB 3OD4A 5CB4A 4NTXA 4IYIA 1EN5A 4AILC 2KSDA 3I55V 3IJ4A 1CP9A 5GTIZ 2Z0AA 5FNVB 2UXBO 3N2KA 1XNRB 2ZNIA 2LW7A 4J9ZB 4DRXA 2P7TC 4XDLA 2EINC 5LXTA 4LF4B 3OFNG 4DR1O 2QWRB 2R72A 5EK0A 2FMLA 2UXNA 2XAGA 2UUAB 1WPXA 1P7GA 2IJJA 1SQPH 2B1IA 3Q4HA 2OIGA 2Q0OC 2D2CB 2EZPA 3SDLA 2DQ3A 1NQTA 4JZGA 5KA6A 5IDJA 4P9OA 3F7YC 5C8YA 2EILB 3AG4C 4R7CA 1GM9A 4JI4B 5KA5A 3STZC 3K08A 1YHQV 5EIBC 3H1HH 2IJIA 3KCYA 3OUSA 4DR6O 3ZHQA 1BQ0A 4DR2B 1Q81W 3ZHUA 4DV5B 4JYYA 1MA1A 4DV1O 1N33B 4X89A 4ASUG 4DK0A 1S77D 5KHKA 1YXBA 3WB0A 3RYIA 4RWUA 1P4RA 2GHYA 3ZJZA 1VARA 2JGDA 1F7YA 4MVUA 4LF6O 5JVDA 4LH6A 1VQOV 4QJFB 3U0ZA 3FX7A 5IYBO 3SPIA 2N04A 4R8CA 4D7TA 1ENVA 2NR5A 4B3TB 1TGOA 1HR0O 4JI6B 3H9VA 4JYBA 2WA4A 1K97A 1Q90D 5B3SC 2VWJA 1OCOB 4JTCB 3RYCB 3JD2A 1K8AW 4LFAO 3L9DA 3FAVA 2YEVA 4JAUA 2DWEC 4Q20A 3FB7C 3WFVA 5EBMC 3K5OA 4LF7O 5H6RA 4NR1A 2XT9A 1BE3H 4O4JB 5JQGA 1G1XB 4LF5B 1M56C 3UT5A 5H9CA 3W7WA 2WLIB 1YEWA 3EHBB 3D3QA 3FYEB 3W7TA 5DEDA 3ABKC 1YI2V 3ZHTA 1JNBA 5H2FZ 3RBZA 4KL1A 2Y4TA 3LDCA 3B40A 4I55B 1Q43A 3SYPA 2YXLA 1KMIZ 1N0NA 3H1KH 3S3WA 2UUCB 4FJCC 3CYOA 3HKDB 2ZE6A 3E8HA 1IBKB 2DYSB 3T1CA 3RWRD 1KP3A 2O57A 1SQBH 3L75H 3VQXA 4U7NA 2RCVA 5LA6A 1SETA 2K9PA 1HWYA 2LJ2A 1I0HA 4D6TH 1WP8A 2UXDO 4KUMA 1TA8A 1BHAA 2GDSA 5IE9A 3B4SA 4PA4A 3TXQA 3ZRWB 1I5YA 2Q68A 1HW7A 1D5NA 4N23A 5LHGA 2JJ2G 3QG5A 2HLDG 4FK5C 3KZIZ 4LFCO 1DGSA 4YXWG 1HNWO 5L3BA 1PP9H 1G8MA 3TK1A 3K06A 3SR2C 3OTOB 4DR7B 1FXKB 4NYKA 4X65O 4AQYO 3OTFA 4FLVA 1JX9A 2K1EA 3W7UA 1JJOA 4O2AA 5J2TA 5IYZB 2Y69B 1AVMA 2R9RB 2CGNA 1IX9A
chains in the Genus database with same CATH topology
1QNMA 1XREA 1AP6A 1JR9A 3LSUA 5AG2A 1PM9A 2QKAA 3AK2A 1PL4A 1WB7A 1ZTEA 4C7UA 3EVKA 3IC9A 1ZSPA 1GN2A 1IDSA 1P7GA 5A9GA 1WB8A 1GN6A 2CE4A 1LUWA 1BS3A 1AR5A 3K9SA 1AR4A 1MNGA 3KKYA 2CDYA 3BFRA 3AK1A 3TJTA 1VEWA 4JZGA 2P4KA 1B06A 3C3SA 1MSDA 1N0NA 1ZLZA 2ADQB 3DC5A 4BR6A 3MDSA 3CEIA 4E4EA 4GUNA 1EM1A 2RCVA 4YIPA 1GN3A 3C3TA 1JA8A 4JZ2A 1IXBA 3OT7A 4JYYA 1ZUQA 1I0HA 1MA1A 1EN6A 3DC6A 2GDSA 2ADPA 1KKCA 1XILA 1AP5A 1XUQA 1D5NA 3KDRA 1LUVA 4F6EA 4FFKA 1VARA 1GN4A 1SZXA 1N0JA 2AW9A 1EN4A 1MMMA 4X9QA 1EN5A 3AK3A 2QKCA 4YIOA 1AVMA 1XDCA 1I08A 3QVNA 1BSMA 1Y67A 1IX9A 1BT8A 3RN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNM A;  1XRE A;  1AP6 A;  1JR9 A;  3LSU A;  5AG2 A;  1PM9 A;  2QKA A;  3AK2 A;  1PL4 A;  1WB7 A;  1ZTE A;  4C7U A;  3EVK A;  3IC9 A;  1ZSP A;  1GN2 A;  1IDS A;  1P7G A;  5A9G A;  1WB8 A;  1GN6 A;  2CE4 A;  1LUW A;  1BS3 A;  1AR5 A;  3K9S A;  1AR4 A;  1MNG A;  3KKY A;  2CDY A;  3BFR A;  3AK1 A;  3TJT A;  1VEW A;  4JZG A;  2P4K A;  1B06 A;  3C3S A;  1MSD A;  1N0N A;  1ZLZ A;  2ADQ B;  3DC5 A;  4BR6 A;  3MDS A;  3CEI A;  4E4E A;  4GUN A;  1EM1 A;  2RCV A;  4YIP A;  1GN3 A;  3C3T A;  1JA8 A;  4JZ2 A;  1IXB A;  3OT7 A;  4JYY A;  1ZUQ A;  1I0H A;  1MA1 A;  1EN6 A;  3DC6 A;  2GDS A;  2ADP A;  1KKC A;  1XIL A;  1AP5 A;  1XUQ A;  1D5N A;  1LUV A;  4F6E A;  4FFK A;  1VAR A;  1GN4 A;  1SZX A;  1N0J A;  2AW9 A;  1EN4 A;  1MMM A;  4X9Q A;  1EN5 A;  3AK3 A;  2QKC A;  4YIO A;  1AVM A;  1XDC A;  1I08 A;  3QVN A;  1BSM A;  1Y67 A;  1IX9 A;  1BT8 A;  3RN4 A; 
#chains in the Genus database with same CATH topology
 2Q67 A;  4YHH O;  4JI2 B;  1QNM A;  4JF3 A;  4A5U B;  3G67 A;  5L3F A;  2UXC O;  4JAS A;  4DV0 O;  3JAK A;  3ZCC A;  4AHC A;  4DUY O;  3JAS A;  3IC9 A;  3OW2 U;  1LNQ A;  3CC7 V;  4F6R A;  3CRC A;  1GN6 A;  4KFM A;  2CUG A;  2CH7 B;  2OCC C;  4DV2 O;  4UXN A;  2DQ0 A;  4LFB B;  1JOY A;  4Z2W A;  1TVK A;  1AR1 B;  1MZE A;  3ML0 A;  3ZIA G;  1AJP A;  4MVM A;  3HKC B;  3VOU A;  2JEX A;  4EB6 B;  1OV9 A;  5IYD O;  1JPX A;  3APQ A;  3DC5 A;  2XND G;  4QPJ A;  2KKW A;  3CB2 A;  1L0L H;  5GON A;  5CA1 A;  4U7O A;  2EIK C;  3P32 A;  5KHI A;  1TAE A;  1EM1 A;  1SZT A;  4HYO A;  1GN3 A;  4H37 A;  3CSX A;  3K03 A;  2P06 A;  2EIM C;  2LGW A;  1IBM B;  2XAH A;  1IZ3 A;  4B08 A;  2L6L A;  3I56 V;  4BIU A;  4LR3 A;  2HVK C;  1E1R G;  3GB7 C;  2ZIO A;  4DV6 B;  2GBO A;  5K1X A;  1E79 G;  4O4I B;  2DJV A;  1B6Q A;  3RW0 A;  1DLB A;  3E89 A;  2D3O W;  3A0B Z;  3TET A;  3E2E A;  4FFK A;  3OMI B;  3N2G B;  4R50 A;  2JGD B;  2M6Y A;  2HJD A;  2QWQ B;  1RPR A;  1QVF U;  3CJH B;  4PD4 F;  2PI5 A;  1MSW D;  1SER A;  2V7Q G;  4F4L A;  5L3D A;  5EYP B;  3JAW B;  1IVS A;  4WFG A;  4MW3 A;  1TUB A;  5KHH A;  3H01 A;  4PA7 A;  3DTU B;  2A06 H;  3SJB C;  2Q0A A;  1QLE B;  1IXM A;  3E8G A;  4B3S B;  2LFR A;  5JCO A;  4CC6 A;  4PV1 B;  3BPZ A;  1U96 A;  4G2K A;  4DR4 B;  3OAA G;  4UUJ C;  4J7J A;  3AG1 B;  4KXR A;  4FIP C;  1K9M W;  5B1A C;  1ZSP A;  2KB1 A;  3ASO C;  2ZE8 A;  3I5D A;  1XNR O;  1IDS A;  2R70 A;  1N36 B;  2LW1 A;  4ZKI A;  1BS3 A;  1AJN A;  1K5Q A;  1XL6 A;  1JVM A;  4OPA A;  3RFR A;  4DYL A;  3O9O A;  1J5E B;  1YVW A;  2UUA O;  3MHH C;  1R3K C;  4FPP A;  1Z5V A;  1B06 A;  2RMK B;  4DV4 B;  2P67 A;  1NKD A;  2ARH A;  2P90 A;  3ZX6 A;  1G6U A;  3BHP A;  1AI7 A;  5FLX N;  5JCO C;  1OCZ C;  1KBH A;  4I0X B;  5IJ9 B;  5ITZ B;  2YI9 A;  5LA6 B;  4YY3 B;  1NVP B;  3H1I H;  4WFH A;  4X66 B;  1IXB A;  1CXZ B;  5LYJ B;  3SJA C;  1MAB G;  4UCU A;  1W0J G;  1U97 A;  1X59 A;  1EN6 A;  4TUY B;  2ZDI A;  2B9Z A;  4DR3 B;  4JI4 O;  5F2V O;  4TOI A;  5J2U B;  4J41 A;  1XMQ B;  1F23 A;  1UPG A;  1WAZ A;  2IH1 C;  2ODM A;  4DR2 O;  5KHG A;  4DV3 O;  2LFS A;  4L8J A;  5KX5 B;  2YXH A;  2PY5 A;  1R73 A;  3KCX A;  2EX3 A;  1N33 O;  1P7B A;  2JDI G;  2F93 B;  1M90 W;  4GLX A;  4GT1 A;  3ASN B;  2XAF A;  4J7K A;  5IJ0 B;  3TCU A;  3HPL C;  4W4K A;  2ETN A;  1PPJ H;  4JTD B;  4H33 A;  1FFX B;  2ZDI C;  5FL7 G;  3CCL V;  5HFL A;  4DV7 O;  4PDM A;  4XDK A;  1WP7 A;  4LC1 A;  4JAV A;  4GX1 A;  1CPY A;  1RP3 B;  1FKA O;  2EIL C;  1Y6X A;  4B3T O;  2PYL A;  5EIB D;  4PA6 A;  1L1F A;  4I4T B;  3VBB A;  1S5J A;  2F43 G;  3ZMS A;  4PA3 A;  5A9G A;  1VP7 A;  4UV8 A;  1Q6U A;  3CC2 V;  3CWB H;  1RFY A;  1WN7 A;  2ZIN A;  4X1K B;  5CBH A;  5JJE B;  5CMU A;  2X6A A;  2WWW A;  5IY5 B;  3RYC A;  1HNZ B;  4JV5 B;  3KKY A;  4Z1M G;  3CME V;  3WG7 B;  3THO A;  3K0D A;  2XOK G;  4LF5 O;  2XAQ A;  1VF5 B;  2AHY A;  1FXH A;  5CA1 B;  4O4J A;  4GUN A;  3K57 A;  4FZ1 A;  4Z1V A;  3E8B A;  2WLI A;  2FB5 A;  4U3F H;  3OT7 A;  4NTY A;  1ZUQ A;  2M7W A;  3APO A;  2UUC O;  4GX5 A;  1NJI W;  5LOV B;  1IBK O;  1I5X A;  4I55 A;  4X20 B;  1YDX A;  1Y74 B;  2KG7 B;  1SQQ H;  1N34 B;  1OCO C;  1M93 A;  1XEQ A;  2HJF C;  3SYC A;  5KUK A;  5LBQ A;  1VQM V;  2VQE B;  3IC7 A;  4GYC B;  2VWK A;  4MTO A;  1I94 O;  4OPH A;  2YDE A;  4GKK B;  1BGY H;  1KP2 A;  2YSU B;  4G28 B;  5E1A C;  1EN4 A;  2JEU A;  4MS2 A;  2BCC H;  1AI4 A;  2JS3 A;  1XI1 A;  2IJK A;  2QWN B;  3ABM B;  5LMN B;  1SQG A;  2YIB A;  2DE0 X;  1BSM A;  1TUB B;  3ZRW A;  4KHP B;  4OX9 B;  2PZS A;  2F66 C;  2WLL B;  1QR8 A;  2UU9 B;  1HNX O;  1AP6 A;  4TV9 B;  1JR9 A;  1K7D A;  3OTO O;  2IM9 A;  1PNM A;  3L74 H;  4MTG A;  2UUB B;  2DYS C;  1WB7 A;  1N32 B;  2QR4 A;  3EVK A;  3ZHR A;  1FXK A;  3BVO A;  4OXS A;  2BTQ B;  1Q7Y W;  5IYZ A;  2Q73 A;  4IHJ B;  1HDJ A;  3GVM A;  4DK1 A;  1VQP V;  3BFR A;  4DUZ B;  2P4K A;  2ADQ B;  3G4S V;  3CEI A;  2IU0 A;  4LFB O;  4GKJ B;  1N4C A;  2QWP B;  1IBL B;  1T5E A;  1XL4 A;  3K79 A;  4JI3 B;  1AJQ A;  2CH7 A;  3BAB A;  1UFI A;  1FXK C;  1H5W A;  1DF4 A;  4O4L B;  1H2M A;  5KHJ A;  1VQ7 V;  1D5A A;  1XBL A;  2Y69 C;  2ZD9 A;  1Y4M A;  2E76 B;  3HKC A;  4EB6 A;  5B1B B;  4CH6 A;  2YI8 A;  4TV8 B;  1SC5 B;  2JJ1 G;  3GWK C;  3QTC A;  1IBM O;  4LF9 B;  3K9A A;  3WB2 A;  2CAZ C;  2Q5Z A;  1DF5 A;  1ZWI C;  4FLZ A;  3MHS C;  4QIW F;  4XBF A;  1MMM A;  4NB5 A;  1VQN V;  1ZX3 A;  1K5S A;  2ILM A;  3OEH G;  3QO5 A;  4TT3 G;  4X62 B;  2PTM A;  4O4I A;  2VQF B;  3OR6 C;  4RUE A;  3ZMU A;  4JI0 B;  2X6C A;  1YJW V;  2LGQ A;  1D2D A;  2QEX V;  3OE7 G;  4YJ2 B;  3N2G A;  5K1P A;  3CJH A;  2OCH A;  2QM4 A;  5EYP A;  4B7E A;  3TGU H;  2ZM6 B;  3JAW A;  5EZY B;  1K73 W;  2Y0P A;  4B3R O;  2EJR A;  1Q82 W;  3NXS A;  1G4Y B;  1LUW A;  4B3S O;  4TWK A;  4MTX A;  3N27 A;  2YIA A;  5GTH Z;  2XTA A;  4K3A A;  1VEW A;  4X1Y B;  4HZ3 A;  1PL0 A;  1Z5W A;  1PKX A;  4R6Z A;  5LL6 Y;  2YIC A;  3CXH F;  1N36 O;  1GK9 A;  3ETE A;  4LP8 A;  1E1Q G;  2C2A A;  1GM7 A;  5D5P A;  1YJ9 V;  1J5E O;  3CE2 A;  5FPR A;  2Z3Y A;  2GTA A;  5A2Q N;  3K5L A;  5CBF A;  3KG2 A;  3CC4 V;  5BY1 A;  4DV4 O;  4GZR B;  3ZMT A;  3G6E V;  4BW5 A;  1VQK V;  2Q8V A;  5IWA B;  2F95 B;  5LMU B;  1QLE C;  3BEH A;  5LGU A;  1AI6 A;  3K3W A;  4YY3 O;  1XIL A;  4BW9 A;  3CRR A;  4X66 O;  5KUM A;  2AXT Z;  3DGE A;  2BSK B;  4I0X A;  5IJ9 A;  1PD3 A;  1NT2 B;  3JAR B;  2N05 A;  3T2M A;  5ITZ A;  3AG1 C;  4DR5 B;  2AZ0 A;  2PF4 E;  2HR3 A;  2XHB A;  4AI8 A;  5LHI A;  1GH6 A;  1K92 A;  5LYJ A;  4DR3 O;  3U10 A;  3D8C A;  3JAL B;  4TUY A;  4IGG A;  1NZ6 A;  4MTF A;  3AG2 B;  3E35 A;  4ICG A;  1XMQ O;  2QKC A;  1R3L C;  2IH3 C;  1I08 A;  1H2S B;  2QM8 A;  4CBC A;  4CS3 A;  4P2Z A;  1QR9 A;  5J2U A;  4FVM A;  3R65 A;  4JI7 B;  2GSM B;  4X64 O;  3OM3 B;  2DYR B;  4NVP A;  1VQ8 V;  3UQ8 A;  2P4V A;  5EC2 C;  2DN9 A;  5KX5 A;  5AG2 A;  3FB8 C;  2QKA A;  2QA4 V;  1JMK C;  3T1Y B;  1PL4 A;  2JVD A;  3A0H Z;  3BCC H;  4PEL A;  3RYF B;  2X0L A;  1OHH G;  1YCI A;  4YJ3 B;  5IJ0 A;  2EIN B;  2A3Q A;  1WPB A;  2CE4 A;  4JYA O;  3A0R A;  1YTF B;  1FFX A;  2Q9L A;  4EFE A;  5B5E Z;  4NKG B;  1Q6I A;  5B1O A;  1FJG B;  1ZAU A;  3OR7 C;  5E79 Z;  2YC0 A;  4WFB V;  4RO2 A;  1NH2 B;  3IFX A;  4CH5 A;  1IUR A;  5L3E A;  4I4T A;  1W0K G;  2A79 B;  3OMA B;  2VRZ A;  1HNZ O;  2HG5 C;  4JV5 O;  1BMF G;  1S76 D;  4X1K A;  1GKF A;  3ASN C;  3SPC A;  3IGA C;  4WBN B;  2UXX A;  1BZK A;  2MW2 B;  4PI2 A;  2A9H A;  1VMG A;  3R66 A;  1Z2G A;  4W4L A;  2F4V B;  2F23 A;  3WU2 Z;  2XAJ A;  3ZMV A;  4HBN A;  5JH7 A;  3SJQ C;  2QWO B;  2JIZ G;  3EFF K;  1JFF B;  1GO3 F;  3UO2 A;  3JCU Z;  1K33 A;  1BCC H;  3T1H B;  4JI8 B;  1RSO B;  4JI1 O;  1GM8 A;  5LOV A;  2WLK A;  2XAS A;  3UCS C;  1SQF A;  4K0K O;  4X20 A;  3O65 A;  1Y74 A;  2VQE O;  2KG7 A;  3UO3 A;  2OTL V;  3ABL B;  3QVN A;  5IY5 C;  3ETQ A;  2E5L O;  3ZRV A;  3G80 A;  3S3X A;  2PI4 A;  4EFB A;  3HR0 A;  3LDE A;  4GKK O;  4TQD A;  3PJS K;  2OWO A;  4FLW A;  1KEC A;  1KB9 F;  3F7V C;  4GX2 A;  3U11 A;  2H3O A;  3TXS A;  5LMN O;  1L8D A;  2R9A A;  4KHP O;  4OX9 O;  2NNU A;  1WB8 A;  5HFM A;  3G71 V;  1AR4 A;  2WLL A;  2UUB O;  1OCC B;  4TV9 A;  2IW5 A;  4K8X A;  1VQ9 V;  1KUQ A;  5KMG B;  3JD3 A;  4MVQ A;  3SYQ A;  2QKS A;  2WPD G;  4B3M B;  4I5S A;  2BTQ A;  4PJ0 Z;  1MG1 A;  3CP1 A;  1V55 B;  2WLJ A;  1HR0 B;  1GMG A;  4IHJ A;  4X8A A;  1W59 A;  2FYU H;  1JA8 A;  4LF4 O;  4DUZ O;  2E3C A;  3ABM C;  3H1L H;  3JD4 A;  2HHH B;  2WSS G;  1H2L A;  1S5L Z;  4MSW C;  3UKM A;  3T4D A;  4MVR A;  4GKJ O;  1IBL O;  4JI3 O;  4EEQ A;  1XQ8 A;  4LF7 B;  1OCR B;  1XUQ A;  3T4Z A;  1JQ0 A;  1LUV A;  2BE3 A;  5EBW C;  4LNU B;  4CH4 A;  1Y76 B;  3CCU V;  4O4L A;  3CCM V;  1Q8I A;  4X9Q A;  1SS3 A;  1M9N A;  4JAA A;  2E75 B;  3L71 H;  4FFB B;  1J95 A;  2CK3 G;  5LGN A;  3IAY A;  2ZCE A;  1MZF A;  3FKS G;  3LNN A;  3C90 A;  2ATK C;  4FZ0 A;  3JD0 A;  5KAF Z;  4TV8 A;  1FOU A;  2EIJ B;  4QNH B;  4DV5 O;  4TQF A;  4FM2 A;  2GV9 A;  1YJN V;  3JD1 A;  4X62 O;  2JK5 C;  2VQF O;  3L70 H;  4JI0 O;  4ZOL B;  5J9P C;  1XMO B;  1RM1 B;  2CTP A;  3M8A A;  1VQL V;  1R6T A;  1OJH A;  1QQC A;  3AEI A;  5B66 Z;  4UVB A;  4P9P A;  2PYJ A;  2F1M A;  1ZL8 B;  1AIL A;  2QTS A;  4YJ2 A;  3CMA V;  2OTJ V;  5B1B C;  3P3P A;  3NR7 A;  3GWO A;  4ZBM A;  4ZIB A;  2ZKO A;  2ZM6 O;  1HNW B;  2QJ1 A;  3OGI B;  1MSD A;  1WLE A;  4BR6 A;  4JI6 O;  2V4D A;  1WA8 B;  4O4H B;  5EZY A;  4LWS B;  3L72 H;  4H13 B;  2E74 B;  4B7K A;  4YHH B;  2ZR3 A;  5CN0 A;  1VF7 A;  3K58 A;  1S72 V;  2W6I G;  3X2Q B;  4BIO A;  4X1Y A;  4DV0 B;  5DM6 V;  1BQZ A;  4LCU C;  1JCH A;  1O9H A;  4NXM B;  4J80 A;  2H94 A;  3B2E E;  5JH7 B;  4I7Z B;  5BXZ A;  4HNA B;  2JS5 A;  1FYJ A;  1GN4 A;  5BR8 B;  4DV2 B;  2AW9 A;  5IWA O;  1X4T A;  3HKB B;  1QU7 A;  5LMU O;  3B09 A;  5IT9 N;  1PNK A;  3JCZ A;  3CCQ V;  4IT5 A;  4DR5 O;  4J42 A;  2BSK A;  4UVA A;  2Q69 A;  3BAA A;  3JAR A;  3LSU A;  2WAM A;  2RNB A;  2QE7 G;  2HVJ C;  1O9G A;  4FLX A;  1TUE B;  1ZTE A;  1S0V A;  3RYH B;  4IYH A;  3J81 N;  3H1J H;  2LQT A;  3RGB A;  4RQF A;  2MK3 A;  3JAL A;  1V54 B;  1L0N H;  1W2B U;  4X88 A;  4JI7 O;  4PA9 A;  1R6N A;  5BMV B;  5B1A B;  3EXA A;  1AR5 A;  1H8H G;  3T1Y O;  3RVY A;  2OT5 A;  4BIZ A;  4DR7 O;  1XNQ B;  1N8R W;  3RYF A;  3B8M A;  5CA0 B;  5KAI Z;  3QO7 A;  4P30 A;  2QM7 A;  4YJ3 A;  4JI2 O;  4JI5 B;  1DTO A;  2G38 A;  5EBL C;  1M57 B;  4IIJ B;  1DK1 A;  4YIP A;  1Q3E A;  1FJG O;  3AG2 C;  4BWA A;  4FM0 A;  2NLJ C;  4UCT A;  3DXR B;  4MT8 A;  4J9Y B;  1KKD A;  1KKC A;  1NR7 A;  2DYR C;  2QGN A;  3HKE B;  1M5I A;  1AP5 A;  3KDR A;  4DO2 A;  2Q7G A;  4X1I A;  1QVG U;  1URF A;  4LBE C;  3QNE A;  1NVP D;  3ZS8 C;  4WBN A;  2F4V O;  3J80 N;  2AGA A;  3HB3 B;  3JAT B;  4K8Z A;  3FFQ A;  4YIO A;  4ZI7 B;  3RN4 A;  1M4U A;  3T1H O;  4DW0 A;  4JI8 O;  3LNM B;  4JYC A;  1JFF A;  4FMT A;  2IJH A;  4UCO A;  1Q5O A;  4DV6 O;  1RSO A;  4C7U A;  2CTR A;  2GUZ B;  2A7W A;  3AG3 B;  5H6Q A;  1CEZ A;  4GX0 A;  3F5T A;  3CCR V;  1R6K A;  1H2G A;  1RPO A;  2RJZ A;  1NTM H;  4HAM A;  2Z5U A;  3B77 A;  3MD0 A;  1FPO A;  4DV3 B;  5LP6 B;  2DOS A;  4LF8 B;  3TJT A;  4BAY A;  3ICX A;  3K0G A;  3WB1 A;  1WNS A;  2ZR2 A;  2Y4U A;  1KQS U;  2ZXW B;  1WJZ A;  4E4E A;  1NS1 A;  3ZHS A;  1AB3 A;  2CTW A;  4NXN B;  3CPW U;  3C3T A;  3QO8 A;  2R9I A;  1COW G;  1SA0 B;  4DR4 O;  4I50 B;  4DV7 B;  3ABL C;  4D7S A;  2EBO A;  4B3M O;  1F51 A;  5KMG A;  4O2B B;  2IU3 A;  2LP7 A;  3JSN A;  4GCZ A;  4WFF A;  2HHH O;  1XHX A;  5IYC O;  4WCE V;  3CCE V;  2HFE C;  1K34 A;  2ZE5 A;  3VQW A;  3W7X A;  2JGU A;  5JJJ B;  1OCC C;  2DMX A;  1EZV H;  1NR1 A;  2OIE A;  3ETD A;  3B8N A;  5KLV H;  4TSF G;  1KD1 W;  1XRE A;  4PI0 A;  1K4D C;  1Q86 W;  3MAQ A;  1PM9 A;  4LNU A;  3CRM A;  3ZBH A;  3K5M A;  1Y76 A;  3FB5 C;  4ABM A;  2AZ2 A;  5DEC A;  1V55 C;  4FFB A;  3FD9 A;  3E83 A;  4JGS A;  5GW7 A;  3VQY A;  4ZHQ B;  2WA3 A;  3BA9 A;  3CCJ V;  3CCV V;  1MNG A;  3L73 H;  2NN4 A;  1OCR C;  2VS0 A;  5B1N A;  5JWP A;  1I94 B;  2CGO A;  1XMO O;  2YXY A;  4RQE A;  4DXW A;  1NU1 H;  2ZQM A;  2W0X A;  4CZZ A;  3K04 A;  1NTK H;  3LUT B;  4ZOL A;  4IL6 Z;  2P5O A;  2YUA A;  1SQX H;  3SPH A;  3ZED A;  1GTO A;  4CS4 A;  1P49 A;  2LO1 A;  1ZL8 A;  4U3J A;  2W6J G;  1PNL A;  4FLU A;  1KYO F;  2X6B A;  1HNX B;  1F4N A;  1KU9 A;  5CB4 B;  2X7R B;  3DC6 A;  3D36 A;  4UV9 A;  3SYA A;  2ITD C;  2EIJ C;  1F4M A;  3SJC C;  4PDR A;  1EFR G;  1SQV H;  3UM7 A;  1WA8 A;  4O4H A;  3ZRX A;  2OYQ A;  3N2K B;  1EZJ A;  4LWS A;  4X1I B;  4DRX B;  2BOC C;  2P22 C;  2UXB B;  1BL8 A;  2H8P C;  3AG4 B;  1SRY A;  1LR1 A;  4XDJ A;  5LXT B;  1RM1 C;  3ZRS A;  1ARO P;  2WLH A;  4UFZ A;  2B1G A;  4NXM O;  4RUF A;  3OUF A;  4DR1 B;  2PUS A;  1PV0 A;  2P6J A;  1R3I C;  3SPJ A;  5D5Q A;  2QDO A;  1Y67 A;  3M99 B;  4K35 A;  3E86 A;  1BT8 A;  4NTW A;  3CHX A;  5BR8 O;  3D36 C;  3Q4H B;  4HNA A;  1AI5 A;  3SGI A;  4LH7 A;  1QCE A;  2WLM A;  1V9P A;  2QTO A;  3HKB A;  3JYC A;  1N34 O;  2ITC C;  2FTK A;  5C8Y B;  1YZB A;  4OGQ B;  5CBG A;  3ZHV A;  3OMN B;  4I9W A;  4JTA B;  2Y48 A;  3K9S A;  3X2Q C;  3WG7 C;  2IBZ H;  1FS0 G;  1FFT B;  3E22 A;  3JAM N;  4WFA V;  1M1K W;  4DR6 B;  3AK1 A;  5B3S B;  3RYH A;  3W7S A;  3ZN0 A;  4PDV A;  1ZLZ A;  3MDS A;  5CA3 A;  4DV1 B;  1YIT V;  5L3G A;  2UU9 O;  3RYI B;  3E8F A;  4Q6G A;  1B3Q A;  5BMV A;  1H8E G;  4WFE A;  1Y66 A;  1XNQ O;  1EBO A;  1H2N A;  5JVD B;  4MW8 A;  4FM1 A;  2V1D A;  1YIJ V;  1N32 O;  3CS5 A;  1M56 B;  4RAI A;  2Q4P A;  4LF6 B;  1US6 A;  4MVO A;  3LDD A;  4JI5 O;  5CA0 A;  3ABK B;  3BRC A;  5JJN B;  2DW4 A;  1GRJ A;  2YID A;  4UVC A;  1VQ4 V;  1SES A;  5C93 A;  4B3R B;  2QSA A;  1ORQ C;  4WF9 V;  1BHB A;  4IIJ A;  3RVZ A;  3FAV B;  2YEV B;  4N21 A;  1V54 C;  1VQ6 V;  4LFA B;  3ETG A;  1KC8 W;  3DXR A;  3ABT A;  5EC1 C;  1OZ0 A;  1FD9 A;  5LHH A;  3CXC U;  3P3N A;  5JQG B;  1XDC A;  3QF7 A;  4JPR A;  3HKE A;  4UB8 Z;  5FNV A;  3UT5 B;  4J10 A;  4E2L A;  2Q7E A;  3K59 A;  2HKO A;  2PGG A;  2ZE7 A;  1XHZ A;  1S3J A;  3AK2 A;  1VF6 A;  3RT3 C;  2HP8 A;  2A0L A;  3J7A U;  1UJW B;  1VQ5 V;  1MOF A;  3OGC C;  1M57 C;  3JAT A;  1GN2 A;  2Q7H A;  4CH3 A;  4LF9 O;  1HP8 A;  2YIB D;  2BTO A;  1H38 A;  4ZI7 A;  3CD6 V;  3SPG A;  1THZ A;  4FLT A;  2Q6A A;  4QE9 A;  1YF2 A;  4J11 A;  2CTQ A;  2AHZ A;  3C3S A;  4UCV A;  5LGT A;  1JJ2 U;  2GUZ A;  2UXD B;  1NI8 A;  1A32 A;  1VF6 C;  2EZO A;  2DWD C;  4LF8 O;  4QGP A;  4U3J B;  1YTF D;  4JZ2 A;  4UCR A;  4X64 B;  5LP6 A;  4LFC B;  3STL C;  2OCC B;  2ZT9 B;  3F5W C;  1Q6H A;  1P84 F;  4DW1 A;  3SYO A;  4O2A B;  5FPO A;  5J2T B;  3CRA A;  2RN9 A;  3FB6 C;  1NH2 D;  4NXN O;  2Y0I A;  4X65 B;  4AQY B;  1FXV A;  3CX5 F;  1SF9 A;  4F6E A;  1IJG A;  4JYA B;  4KP4 A;  5H5N A;  3ZMZ A;  3M7M X;  1SZX A;  2XUM A;  2YS8 A;  2ZNJ A;  3AG3 C;  1SA0 A;  2EIK B;  1N0J A;  3JAK B;  4I50 A;  3ABU A;  3FYI B;  3JAS B;  2UXC B;  1I7F A;  3D3I A;  3DSQ A;  3A8T A;  3AK3 A;  4QPK A;  2EIM B;  4DUY B;  4F6R B;  3LSS A;  1R1B A;  4O2B A;  5BZB A;  1S5H C;  1QLN A;  5LP6 C;  1QBZ A;  4PDL A;  1K4C C;  1TVK B;  3ZN1 A;  4L87 A;  1NTZ H;  3CCS V;  2FL4 A;  2KQX A;  2WLN A;  2ZXW C;  3OEE G;  4PHZ A;  3P30 A;  3LSQ A;  1ROP A;  4MVS A;  4CS2 A;  2ZIM A;  4UCS A;  1NBM G;  3JSL A;  4H0L B;  5GON B;  3PN1 A;  3BA8 A;  3VQV A;  3G6B A;  1VIB A;  2HEP A;  4UB6 Z;  1SKV A;  1B04 A;  4I9Q A;  4MVZ A;  3E22 B;  2CDY A;  5L3C A;  4QE7 A;  1H2K A;  1GAX A;  2N74 A;  3BY6 A;  4J7Z A;  4JI1 B;  2JRI A;  3HKD A;  2FKX A;  5DN6 G;  4G27 B;  4K0K B;  3K5N A;  4ZHQ A;  4H44 B;  2RQ6 A;  2E5L B;  2B5U A;  3A2F A;  3ASO B;  4FLY A;  1QHT A;  1XOU A;  2RDC A;  3CRQ A;  4CC5 A;  3AG7 A;  2BOB C;  1R3J C;  2W0F C;  2ADP A;  4EKW A;  2EJ7 A;  5TIS Z;  2EUL A;  1YSC A;  1FAF A;  1K3E A;  2GTS A;  2L35 A;  1OCZ B;  3OD4 A;  5CB4 A;  4NTX A;  4IYI A;  1EN5 A;  4AIL C;  2KSD A;  3I55 V;  3IJ4 A;  1CP9 A;  5GTI Z;  2Z0A A;  5FNV B;  2UXB O;  3N2K A;  1XNR B;  2ZNI A;  2LW7 A;  4J9Z B;  4DRX A;  2P7T C;  4XDL A;  2EIN C;  5LXT A;  4LF4 B;  3OFN G;  4DR1 O;  2QWR B;  2R72 A;  5EK0 A;  2FML A;  2UXN A;  2XAG A;  2UUA B;  1WPX A;  1P7G A;  2IJJ A;  1SQP H;  2B1I A;  3Q4H A;  2OIG A;  2Q0O C;  2D2C B;  2EZP A;  3SDL A;  2DQ3 A;  1NQT A;  4JZG A;  5KA6 A;  5IDJ A;  4P9O A;  3F7Y C;  5C8Y A;  2EIL B;  3AG4 C;  4R7C A;  1GM9 A;  4JI4 B;  5KA5 A;  3STZ C;  3K08 A;  1YHQ V;  5EIB C;  3H1H H;  2IJI A;  3KCY A;  3OUS A;  4DR6 O;  3ZHQ A;  1BQ0 A;  4DR2 B;  1Q81 W;  3ZHU A;  4DV5 B;  4JYY A;  1MA1 A;  4DV1 O;  1N33 B;  4X89 A;  4ASU G;  4DK0 A;  1S77 D;  5KHK A;  1YXB A;  3WB0 A;  3RYI A;  4RWU A;  1P4R A;  2GHY A;  3ZJZ A;  1VAR A;  2JGD A;  1F7Y A;  4MVU A;  4LF6 O;  5JVD A;  4LH6 A;  1VQO V;  4QJF B;  3U0Z A;  3FX7 A;  5IYB O;  3SPI A;  2N04 A;  4R8C A;  4D7T A;  1ENV A;  2NR5 A;  4B3T B;  1TGO A;  1HR0 O;  4JI6 B;  3H9V A;  4JYB A;  2WA4 A;  1K97 A;  1Q90 D;  5B3S C;  2VWJ A;  1OCO B;  4JTC B;  3RYC B;  3JD2 A;  1K8A W;  4LFA O;  3L9D A;  3FAV A;  2YEV A;  4JAU A;  2DWE C;  4Q20 A;  3FB7 C;  3WFV A;  5EBM C;  3K5O A;  4LF7 O;  5H6R A;  4NR1 A;  2XT9 A;  1BE3 H;  4O4J B;  5JQG A;  1G1X B;  4LF5 B;  1M56 C;  3UT5 A;  5H9C A;  3W7W A;  2WLI B;  1YEW A;  3EHB B;  3D3Q A;  3FYE B;  3W7T A;  5DED A;  3ABK C;  1YI2 V;  3ZHT A;  1JNB A;  5H2F Z;  3RBZ A;  4KL1 A;  2Y4T A;  3LDC A;  3B40 A;  4I55 B;  1Q43 A;  3SYP A;  2YXL A;  1KMI Z;  1N0N A;  3H1K H;  3S3W A;  2UUC B;  4FJC C;  3CYO A;  3HKD B;  2ZE6 A;  3E8H A;  1IBK B;  2DYS B;  3T1C A;  3RWR D;  1KP3 A;  2O57 A;  1SQB H;  3L75 H;  3VQX A;  4U7N A;  2RCV A;  5LA6 A;  1SET A;  2K9P A;  1HWY A;  2LJ2 A;  1I0H A;  4D6T H;  1WP8 A;  2UXD O;  4KUM A;  1TA8 A;  1BHA A;  2GDS A;  5IE9 A;  3B4S A;  4PA4 A;  3TXQ A;  3ZRW B;  1I5Y A;  2Q68 A;  1HW7 A;  1D5N A;  4N23 A;  5LHG A;  2JJ2 G;  3QG5 A;  2HLD G;  4FK5 C;  3KZI Z;  4LFC O;  1DGS A;  4YXW G;  1HNW O;  5L3B A;  1PP9 H;  1G8M A;  3TK1 A;  3K06 A;  3SR2 C;  3OTO B;  4DR7 B;  1FXK B;  4NYK A;  4X65 O;  4AQY O;  3OTF A;  4FLV A;  1JX9 A;  2K1E A;  3W7U A;  1JJO A;  4O2A A;  5J2T A;  5IYZ B;  2Y69 B;  1AVM A;  2R9R B;  2CGN A;  1IX9 A; 
#chains in the Genus database with same CATH homology
 1QNM A;  1XRE A;  1AP6 A;  1JR9 A;  3LSU A;  5AG2 A;  1PM9 A;  2QKA A;  3AK2 A;  1PL4 A;  1WB7 A;  1ZTE A;  4C7U A;  3EVK A;  3IC9 A;  1ZSP A;  1GN2 A;  1IDS A;  1P7G A;  5A9G A;  1WB8 A;  1GN6 A;  2CE4 A;  1LUW A;  1BS3 A;  1AR5 A;  3K9S A;  1AR4 A;  1MNG A;  3KKY A;  2CDY A;  3BFR A;  3AK1 A;  3TJT A;  1VEW A;  4JZG A;  2P4K A;  1B06 A;  3C3S A;  1MSD A;  1N0N A;  1ZLZ A;  2ADQ B;  3DC5 A;  4BR6 A;  3MDS A;  3CEI A;  4E4E A;  4GUN A;  1EM1 A;  2RCV A;  4YIP A;  1GN3 A;  3C3T A;  1JA8 A;  4JZ2 A;  1IXB A;  3OT7 A;  4JYY A;  1ZUQ A;  1I0H A;  1MA1 A;  1EN6 A;  3DC6 A;  2GDS A;  2ADP A;  1KKC A;  1XIL A;  1AP5 A;  1XUQ A;  1D5N A;  3KDR A;  1LUV A;  4F6E A;  4FFK A;  1VAR A;  1GN4 A;  1SZX A;  1N0J A;  2AW9 A;  1EN4 A;  1MMM A;  4X9Q A;  1EN5 A;  3AK3 A;  2QKC A;  4YIO A;  1AVM A;  1XDC A;  1I08 A;  3QVN A;  1BSM A;  1Y67 A;  1IX9 A;  1BT8 A;  3RN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...