3K9SA

Crystal structure of the peroxide-bound manganese superoxide dismutase.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structural Analysis of Peroxide-Soaked MnSOD Crystals Reveals Side-On Binding of Peroxide to Active-Site Manganese.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 75
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2009-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3k9sA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3k9sA02
1MNGA 2QKCA 4BR6A 1VARA 2QKAA 1N0NA 1JA8A 1PM9A 1BT8A 4JZGA 1VEWA 3OT7A 1GN2A 1ZTEA 3IC9A 3BFRA 1GN4A 1N0JA 4YIPA 4JYYA 1XUQA 4X9QA 1XDCA 3DC5A 1Y67A 1JR9A 1ZSPA 1XILA 1IDSA 1P7GA 1BS3A 2ADPA 1GN6A 2GDSA 1EN4A 4GUNA 1AP6A 1PL4A 1KKCA 1ZUQA 4JZ2A 3LSUA 1LUVA 1EN5A 4FFKA 3AK2A 1WB7A 1MA1A 1LUWA 1D5NA 3EVKA 1QNMA 2CE4A 4YIOA 1IXBA 1XREA 2P4KA 1MSDA 1AVMA 4F6EA 3C3SA 3AK1A 1I08A 3K9SA 1EM1A 5A9GA 1AR4A 1IX9A 3AK3A 1AR5A 3DC6A 3C3TA 2ADQB 4E4EA 1ZLZA 1AP5A 2CDYA 1SZXA 1MMMA 1BSMA 2AW9A 1EN6A 5AG2A 1GN3A 3TJTA 3CEIA 3QVNA 1I0HA 1WB8A 2RCVA 3KKYA 3RN4A 3MDSA 4C7UA 1B06A
chains in the Genus database with same CATH superfamily
3ETEA 2RN9A 4DV7B 4GX0A 5CN0A 2ZCEA 1FXVA 1JOYA 1GAXA 3BRCA 4NXNB 1YI2V 1Q81W 1XI1A 1JA8A 2VRZA 4KHPB 2X0LA 3LDEA 3FD9A 2WLJA 2WLHA 1EFRG 4X89A 4CBCA 3L74H 3CRQA 4Q20A 1SESA 4YJ3A 1BL8A 2B9ZA 3R65A 2OTJV 2WAMA 2YI8A 3HKCB 1MZFA 4JI3O 3JD0A 3CC2V 3ZBHA 3CCRV 1M57B 4YY3B 3AK2A 4LF4O 1XHZA 1SERA 1F23A 2VQEO 4EFBA 1ZWIC 1BGYH 4JI1B 1K7DA 2PGGA 3K3WA 3L72H 4ZI7A 1MSWD 4IYIA 1LR1A 5LGUA 3DXRA 2ATKC 1DF4A 3B77A 4WFHA 3JAMN 1HNXB 2Q8VA 3SPHA 2B1GA 4K8XA 2EZPA 4GKKO 2YI9A 4IYHA 2W0FC 4LH7A 5H5NA 4E4EA 2F66C 4UFZA 4B08A 4LF8O 3P32A 1KKDA 3I5DA 3VOUA 3UM7A 2KKWA 1K5QA 3ABKC 5AG2A 2QE7G 4RWUA 4DK1A 3RGBA 4I7ZB 1G8MA 3PN1A 3FB7C 1OCRC 4QE9A 1Y76A 4Z1VA 1AJPA 2CK3G 5EBWC 4DR6O 1IBKO 2JVDA 1NJIW 2UXBO 4O4HA 1I5YA 1IXMA 3OR6C 1Q8IA 4ZOLA 5D5QA 5CBHA 3FX7A 4DV2B 3U11A 2QGNA 5BXZA 2EIJC 1N36B 2BCCH 3A0BZ 2P06A 1JX9A 2F43G 1Y67A 2CGNA 2KB1A 4ZIBA 1Y66A 1IDSA 3A2FA 4J9ZB 1BS3A 1K97A 1SZTA 5KAIZ 2UUCB 4JF3A 3SPGA 1KD1W 3CRCA 2A7WA 2M7WA 3ZJZA 5KAFZ 3JSLA 1WP7A 5LP6C 4LFCO 4GUNA 1ZUQA 3DXRB 1TAEA 2GSMB 1FJGO 3FAVB 2EIMB 3BABA 1MZEA 3VQVA 2UXDO 4RUFA 3JALB 5A2QN 3L71H 3EVKA 3EXAA 3CMEV 4LBEC 4YIOA 5LA6A 4B3TB 2HHHO 4L8JA 3JCUZ 2F95B 4DV5B 1SQGA 1OCCB 3JSNA 1Z5WA 4H0LB 4WBNA 4DR4O 2QWNB 2KG7A 2NR5A 1YDXA 3O65A 2WLIA 4JI6O 4X65O 2P22C 1H2GA 1YTFB 1WLEA 2ZXWB 2DJVA 3ZMZA 4NXMB 1IBLB 4ZOLB 4NTYA 1QLEC 2ITCC 4CS2A 1K4DC 1XQ8A 4PI0A 2UUBB 2HKOA 3OMNB 1R3KC 4X20A 4DR3B 1HNZO 5FNVA 3T1CA 2ZIOA 4TSFG 2OT5A 2H8PC 2YIBD 2FTKA 4LR3A 1I94O 5JCOC 2Q4PA 1AI6A 2YIDA 2D3OW 1VF6C 3ASNC 1GTOA 4MTOA 2O57A 3ABKB 5FPOA 4B7KA 4I50A 5C93A 3LNMB 4LNUA 4DR2B 4B3SO 3JARA 1KB9F 5LA6B 1FXHA 1K92A 4PDRA 2ZINA 3B40A 4DV6O 1LNQA 3OD4A 1N8RW 4D6TH 5LOVB 4JV5O 4X66O 3BPZA 3LSUA 4I55A 4KXRA 2WLIB 2ZD9A 1M90W 5KMGA 1J5EO 2Q73A 3CCSV 5B1AB 5JWPA 1QR9A 2DOSA 3E8BA 4RAIA 4KP4A 2R70A 3BAAA 1XNQB 4LF7O 4F6RA 2EULA 4D7TA 2ZM6B 3AK1A 1BQ0A 4UXNA 3CSXA 4JAVA 3JYCA 3AG4C 1YEWA 2DE0X 1M56C 3K08A 1URFA 4FFBB 3DC6A 3T1YB 3BCCH 3ZRVA 1G4YB 1MMMA 5IWAO 1XBLA 4GLXA 1K33A 5KA6A 4O4LA 1OJHA 3SPCA 1GRJA 2QEXV 1THZA 2FB5A 2UXCO 2P6JA 2EBOA 4BAYA 1HR0B 1UPGA 2IM9A 5EC2C 5KHJA 4I50B 3F7YC 1H2SB 2Z0AA 4P9PA 4X1IA 1VARA 3ZN1A 4X1KB 3OAAG 3JARB 2Z3YA 1FYJA 1K8AW 4CH4A 4AQYO 5EBLC 3B4SA 2QWOB 1XNRB 1OCOC 3STLC 3SYAA 2HFEC 4HAMA 1YHQV 1UFIA 4I55B 1JR9A 2P5OA 3BY6A 2ZE8A 3L75H 4EB6A 1NR7A 5KMGB 4PV1B 1YJNV 4DR7O 4CS4A 3G6BA 2XT9A 4I4TA 2Y0IA 1AP6A 4DR7B 3OMIB 4YJ2A 2F4VB 3RYHB 1P4RA 2E5LB 1Q5OA 1FPOA 2AHZA 3K5OA 1SF9A 4BIZA 1X59A 5GONB 2N74A 4DR5B 4DRXA 4O4IA 4MTFA 3ABTA 3ABLC 1QVGU 1XMQO 2QDOA 3ZCCA 4WCEV 1WNSA 4ICGA 3A8TA 2ZNJA 1EM1A 4MS2A 2A3QA 4ZBMA 5LL6Y 4DO2A 4LF9O 4DR1O 4N21A 4RQEA 4TWKA 3ZHUA 1IZ3A 3OGCC 2YEVB 2Y48A 2PI5A 5IYZA 1CP9A 5JJEB 1SC5B 4X1IB 1GMGA 2AW9A 2ZIMA 3W7TA 2K9PA 1XOUA 1EN6A 3VQXA 4UB8Z 3J81N 3TJTA 3ABMC 5D5PA 4JI7B 2JS3A 3ZHRA 4LFAB 1FXKA 4JAUA 4DYLA 1PL0A 2R72A 4BR6A 2EILC 2LFRA 1M56B 2YIBA 4DUYO 3OTOO 5C8YB 2BOCC 3SR2C 1OCZC 1JJOA 1S77D 4I4TB 3CC7V 3UQ8A 1G1XB 1N0JA 1XUQA 1SA0B 3BA9A 1YTFD 1V54C 3DC5A 5LMUO 3FB8C 3LSQA 2JGDA 1N33O 1HNWO 1YJ9V 2WLNA 4MVZA 4P9OA 2DMXA 4K0KO 4X64O 1H2KA 3HKEA 4DRXB 4PA3A 4YHHO 3QG5A 4PI2A 2Y69B 2PF4E 4LF6B 3RYCA 3THOA 1H2MA 2RQ6A 3ETDA 5JJJB 1OHHG 1WB7A 1UJWB 1MA1A 3CCMV 2UXXA 3CJHB 1DGSA 3JASA 2P90A 4JI5O 4DUZB 2LJ2A 1PV0A 5B1OA 5IYZB 1YZBA 3QO8A 1Q6HA 2WSSG 3JAWB 5H2FZ 5CBFA 1VQ8V 3Q4HB 3CXCU 2QWQB 4B3MB 2LFSA 3WB0A 5A9GA 1RP3B 2JEUA 3T1HO 4PDLA 3MHSC 3H1HH 3SDLA 2ARHA 4HNAA 1JFFB 2Y0PA 3HKCA 4FLZA 1FXKB 5H6QA 3SPIA 4K35A 1ZLZA 2ZT9B 3W7WA 2HP8A 3TGUH 3P3PA 4RQFA 3ETQA 4GX2A 3CEIA 5L3DA 4PELA 4PD4F 2LGQA 3ABLB 5GTIZ 1QCEA 4PA9A 4B7EA 3NXSA 2EX3A 3RVZA 4ZKIA 1DK1A 4JI2B 4JI4B 2XAGA 2GBOA 1JJ2U 1BT8A 3HKEB 1Q6IA 2UU9B 3OM3B 1S76D 4JYYA 4UVBA 2BE3A 4I5SA 1XDCA 1Q82W 4DV7O 4ZHQA 2EINC 2CTPA 3ZMTA 3ABMB 4NXNO 2D2CB 4UVCA 1XMOB 2MK3A 4LFBB 3H1KH 4K8ZA 4J9YB 5KX5A 4KHPO 1L0NH 3JASB 5ITZA 5JQGA 4X62B 4P30A 2HVKC 3E8HA 1S5JA 2DYSB 4LWSB 3FB6C 5B5EZ 2EILB 3AG2B 1R3IC 1KUQA 1EN5A 2YDEA 1OCZB 3SYPA 1K3EA 3DSQA 3G80A 4JYAB 4MVSA 2HR3A 5KHGA 4A5UB 2PYLA 2X6AA 2VWJA 4HNAB 1D5AA 2Q6AA 2V7QG 1V54B 4GX1A 5EIBD 3LDCA 1MSDA 3JATB 2RNBA 5KHKA 3CRRA 2Y4UA 3H1LH 2ILMA 4YY3O 1PD3A 3ZS8C 1I08A 4H33A 4H44B 2WLLB 1SQFA 4UCRA 3K0GA 4JI1O 1J95A 4CC6A 1YF2A 5KHIA 4IHJA 4FPPA 4P2ZA 2UUAB 1GH6A 1GK9A 1HNXO 3SGIA 2HVJC 1V55C 3CWBH 4EEQA 3FAVA 1R6NA 1GM9A 2BTQB 1L0LH 1CPYA 3UT5B 3CRAA 3GWOA 3O9OA 3JALA 1QLNA 5FL7G 3U10A 2JK5C 4UCUA 2Q7HA 3MDSA 3SYOA 3BVOA 4ZHQB 5JH7B 1RM1B 1WPBA 1F51A 4GCZA 1K4CC 2IJIA 2QKCA 3LDDA 1WPXA 5F2VO 3ASOC 2CTRA 5KX5B 1N0NA 1X4TA 5ITZB 5JQGB 3OT7A 1QR8A 2AGAA 4B3RB 1VQKV 4QJFB 2CH7A 5KA5A 2Y4TA 2EIKB 5KLVH 2DWEC 1EZVH 3ZHVA 2PI4A 1XL4A 4DV2O 4DW1A 3OEHG 2X6BA 1PL4A 3TK1A 1N36O 1KU9A 4DV4B 3OUSA 1KBHA 3F5TA 1GO3F 4KUMA 4QE7A 2Q5ZA 1GM7A 2AXTZ 2IJJA 2P4VA 1S0VA 4FM2A 4X88A 2ZR3A 4N23A 3K5LA 3J7AU 2UUCO 4LF5B 4MVUA 4PJ0Z 3RT3C 5K1PA 3WB2A 2XAJA 5E1AC 4JYCA 4IHJB 5B66Z 1AVMA 1AROP 1BMFG 3JD4A 2WA3A 3GB7C 5EBMC 1XL6A 1SQVH 4TOIA 2IJKA 1DLBA 1VP7A 1H8EG 4B3TO 3K58A 4DV5O 1AR5A 1AJNA 2ZDIC 4Z2WA 1JCHA 4JYBA 1AP5A 4RO2A 1SZXA 3APQA 1SKVA 5LGTA 4OXSA 3ZHQA 2MW2B 5L3GA 3OE7G 5LOVA 4GYCB 3H01A 3HKDA 4LCUC 5LGNA 1ZX3A 2FKXA 2CH7B 3E86A 3KCXA 4OPHA 4NXMO 4X1YA 2FL4A 1IBLO 2ZNIA 1WN7A 1MNGA 4UCSA 5IY5C 1VQLV 1AI4A 5CA1B 1SQQH 4F4LA 1VQMV 3WG7C 2V1DA 4JZGA 4R8CA 3ZRWA 3F7VC 1H38A 2B5UA 3L73H 4MVRA 4X9QA 2UUBO 3T4DA 4FLWA 3SYQA 3LUTB 1PP9H 4DR3O 1NU1H 4FFBA 1K73W 2IH3C 2XAQA 2ADPA 4QGPA 1S5HC 4MVOA 3A0RA 4JI0B 3I56V 1Q90D 5L3BA 1G6UA 1MABG 3ASOB 1TA8A 4DR2O 2PYJA 1D5NA 1KYOF 2JS5A 4FM0A 1OCRB 1XREA 2IBZH 4UUJC 1AILA 4X1KA 2ZR2A 1Z2GA 3RFRA 3RBZA 4MW3A 2XTAA 4QNHB 2Q0AA 1FS0G 1SS3A 4UCTA 3HKDB 4PDMA 3K0DA 4BW9A 3AK3A 3M8AA 2EIJB 3P3NA 4X1YB 1XNQO 1R6KA 4JGSA 4JPRA 2W6IG 1YSCA 4XDJA 1QVFU 2ZM6O 3VQWA 3RYHA 5J2TB 4DV1B 3ZRWB 5JCOA 4L87A 2QTSA 5LP6B 1EZJA 5GONA 1VF6A 1VQPV 4C7UA 1B06A 3T1YO 4AILC 4W4KA 4R6ZA 4DV0B 1P49A 4EFEA 3OTFA 3TXQA 2VS0A 1GN2A 2BSKA 2IU3A 4YIPA 2Q0OC 4BIOA 1HR0O 3APOA 4JI8B 1YIJV 2H94A 2YEVA 2F93B 5HFMA 1GN6A 4TUYB 1QBZA 1ORQC 3W7SA 1H5WA 1M93A 4O2AB 5CA3A 1XNRO 3D36C 1WAZA 3CXHF 4TQFA 1KKCA 2H3OA 3N27A 2PUSA 1PPJH 4XDKA 3WG7B 4BWAA 2PY5A 1QLEB 1S72V 3AEIA 2QSAA 4PA7A 2NNUA 2HLDG 2HG5C 3OFNG 3CPWU 1TUBA 1NQTA 5C8YA 2F4VO 3EFFK 1CEZA 2E5LO 3OUFA 4FLTA 1SA0A 1MG1A 1NZ6A 1Y6XA 1O9GA 1JQ0A 2DW4A 3MAQA 2GHYA 4DR5O 2DQ3A 1VQ6V 1TGOA 4PA6A 1IX9A 2OIEA 3BA8A 2ETNA 3C3TA 1VQ9V 3ASNB 4FJCC 4DXWA 3K59A 2JJ2G 4WFBV 3KDRA 3EHBB 2LGWA 5B1NA 3ZN0A 4AHCA 2Z5UA 2IH1C 1CXZB 2BSKB 3ZIAG 4IT5A 2M6YA 2X6CA 1RSOA 1BHAA 1K5SA 3CJHA 1H2LA 4J10A 3ZRXA 2K1EA 4G28B 2OIGA 4FLXA 1JPXA 1RPRA 3JAWA 2LW7A 3R66A 3CHXA 1JMKC 1VEWA 3AG3C 3Q4HA 4QPJA 1ZL8A 3ZEDA 3P30A 4JI7O 5CB4B 1N32B 2Q7EA 3ZRSA 4IL6Z 4LFAO 4CH5A 2OCHA 2IU0A 5IJ0B 1JFFA 1N4CA 4XDLA 3X2QC 4WFAV 1PNMA 1VQ7V 1HDJA 3AG4B 4OPAA 1YCIA 1QQCA 1TUBB 2GDSA 4DV3B 4OX9B 4J42A 4MTXA 4G27B 4G2KA 4KFMA 1SETA 1K9MW 3CYOA 1Q6UA 1T5EA 4E2LA 1WA8B 3BEHA 3VBBA 2LO1A 4CC5A 4FZ1A 4MVQA 4LF6O 1KP3A 1W0KG 2YXYA 5JVDA 4NB5A 2XUMA 2PZSA 2DWDC 5EK0A 2BTOA 3W7UA 1NVPD 3GWKC 1COWG 3U0ZA 3CCQV 5J2UB 3PJSK 4UB6Z 1RSOB 2JEXA 5L3FA 4DUZO 4I0XB 1OZ0A 4UCVA 1OCOB 2QWPB 2E76B 1K34A 1IBMB 1M57C 1VIBA 1YITV 4LWSA 1DF5A 1TVKB 3ICXA 4B3MO 2N04A 1WP8A 1ZL8B 4GKJB 3K5MA 3E35A 3JAKB 3JD2A 4D7SA 3E8GA 3K06A 2QKAA 3JATA 1SRYA 1BQZA 3IJ4A 1NTKH 1N34B 3WB1A 2DN9A 3E2EA 2EZOA 2A06H 2WLLA 1BCCH 4OGQB 1BZKA 3TXSA 3ZX6A 3IC7A 4JI2O 2YSUB 1ZSPA 5LYJB 4JI4O 4JTDB 1ENVA 3HR0A 1TUEB 3RYFB 2UU9O 2W0XA 4J11A 3FYEB 3UO2A 2BTQA 3UT5A 5JVDB 4NKGB 2CGOA 1VQOV 2JJ1G 5CMUA 3CCLV 1XMOO 3AG3B 3QO7A 5JH7A 4LFBO 4UCOA 2CE4A 1RPOA 5LMNB 3K79A 5BR8B 4X62O 4U3JB 3B8NA 2RMKB 1WJZA 5CBGA 2WLKA 1YXBA 4TT3G 4PHZA 1W0JG 3T4ZA 4ABMA 4JYAO 4FMTA 3HPLC 2OYQA 2L6LA 1H8HG 3AG7A 2FYUH 3OMAB 2NLJC 1U96A 4FK5C 1B3QA 1R3JC 2ODMA 4TV9B 4XBFA 4J80A 2CDYA 2UXNA 2EIMC 3OW2U 5GW7A 3FYIB 3CCUV 3A0HZ 1NT2B 1NH2B 4ASUG 4BW5A 5IJ9A 1OCCC 3G71V 4QIWF 4W4LA 3UO3A 2UUAO 2GTSA 3K9AA 2GUZB 4O2BA 1P7BA 2F1MA 2Q68A 5B3SC 5IYBO 4JI3B 3CS5A 3F5WC 2ZXWC 3ZHSA 2QJ1A 5H9CA 4O4JA 2A0LA 2QA4V 1M9NA 1HW7A 1BHBA 3OGIB 5LHGA 4LF4B 2E75B 3LSSA 2VQEB 1P7GA 4GZRB 4WFEA 1JNBA 3N2KB 4B3RO 1EN4A 2XAFA 1R73A 1Y74A 1KP2A 1A32A 1FOUA 1Q43A 1SQBH 4FFKA 4H13B 1NS1A 1GKFA 4MW8A 2CTQA 5CA1A 4H37A 5FLXN 1U97A 4GKKB 2A9HA 4NTXA 5FPRA 2GTAA 3HKBA 4JASA 4DV4O 2E3CA 1FFXA 4LF8B 1Y4MA 3SPJA 1IJGA 2OCCC 4LF5O 2Q7GA 1YVWA 2CTWA 1W59A 3H1JH 4IIJA 1S5LZ 1VQ4V 5IJ9B 4YJ3B 3ETGA 4NTWA 4CH6A 3DTUB 5LHHA 4DR6B 4NR1A 3VQYA 1IBKB 4O2BB 1US6A 2EINB 3CC4V 2UXBB 3K03A 4K3AA 3RVYA 2HJFC 4MVMA 1GN3A 2W6JG 2QM7A 5B1AC 5KHHA 3E22A 3OEEG 4J7JA 4O4JB 2RJZA 4I9QA 2LW1A 2AZ0A 4ZI7B 3I55V 1BE3H 1Y74B 3BFRA 4LFCB 1MOFA 3IGAC 1AB3A 1FJGB 3CX5F 4JTAB 3MHHC 2UXDB 2RDCA 3CD6V 2CUGA 5IE9A 4CS3A 4FLUA 2R9AA 4HYOA 2HHHB 1D2DA 4UV9A 1KMIZ 3HKBB 2EJ7A 2E74B 5J2TA 1FFXB 4TQDA 1LUVA 5B3SB 5LP6A 1M5IA 5LBQA 4DR4B 2JGUA 2ZE5A 2XNDG 2A79B 1NVPB 2OTLV 4JI6B 3CCEV 1Y76B 4X65B 5EIBC 1V55B 4IIJB 3SYCA 3CRMA 4JI0O 5LHIA 3ML0A 4O4HB 3GVMA 2XAHA 2YUAA 3SJBC 4GT1A 1GM8A 2ZDIA 3KCYA 4BIUA 4F6EA 2GV9A 4LC1A 3D3QA 5BMVA 2XHBA 4RUEA 3SJCC 3E22B 1YJWV 3CP1A 4TUYA 2IJHA 1SQPH 2DQ0A 1F4NA 5EYPA 4O2AA 1NI8A 3H1IH 1HNZB 2NN4A 4GX5A 2AZ2A 1PKXA 3BHPA 1I94B 4NVPA 1NTZH 3QF7A 1M4UA 4NYKA 2P67A 1WB8A 3G67A 2RCVA 3RN4A 2F23A 2FMLA 2OCCB 4FLYA 1E79G 4WF9V 4DV1O 1XEQA 3CMAV 4B3SB 4MT8A 5IYCO 4WBNB 5B1BC 3IC9A 4DV6B 1EBOA 2KG7B 3N2GA 1FKAO 2YC0A 4AI8A 5TISZ 3D8CA 1ROPA 1FFTB 1Q7YW 4JV5B 4X66B 3RW0A 3DGEA 2BOBC 1XILA 4DV0O 5EC1C 1OV9A 4FZ0A 3TCUA 1KC8W 4R50A 1J5EB 3KG2A 1AR1B 1KQSU 3UKMA 2DYRC 1R1BA 1RFYA 4LF7B 1H2NA 1QU7A 2N05A 1NH2D 4JI8O 4TV8A 1IURA 5BZBA 1LUWA 5L3EA 5BMVB 2JDIG 5GTHZ 3S3WA 4PDVA 3ZMSA 3ZMVA 4X20B 2QM8A 5FNVB 3TETA 2XASA 5HFLA 5EYPB 3WU2Z 5IY5B 5CB4A 5IWAB 4U7OA 3RWRD 5IJ0A 2QTOA 3CB2A 1I5XA 5J9PC 1AR4A 2UXCB 3B2EE 5LXTA 2ADQB 1VF5B 4LNUB 2Y69C 1B6QA 2IW5A 1QHTA 4FM1A 3ZHTA 4J41A 2R9RB 4R7CA 2JIZG 5L3CA 1R6TA 4EKWA 3L70H 3QVNA 3N2GB 4AQYB 3FKSG 3W7XA 3IAYA 2JRIA 4UV8A 1WA8A 4J7ZA 1B04A 5KUKA 2YS8A 1E1QG 1ZTEA 4F6RB 4HZ3A 1P84F 1FXKC 1PNKA 3D36A 4FIPC 5CA0A 5J2UA 3CCVV 4TV8B 2LQTA 2CAZC 3IFXA 4I0XA 1VQ5V 3AG1C 2HJDA 2YXLA 3G4SV 1I7FA 2WA4A 4MSWC 5BY1A 3E89A 1TVKA 3B8MA 1W2BU 1VF7A 1AJQA 2Q9LA 1F4MA 3WFVA 1E1RG 4DW0A 1N32O 3SJAC 2B1IA 5IDJA 3K57A 1Q86W 4O4LB 1FAFA 2X7RB 1XMQB 3JAKA 3JD1A 3S3XA 4FVMA 4HBNA 5B1BB 1AI7A 2ZKOA 1QNMA 4WFFA 4UVAA 1IXBA 4I9WA 4DV3O 4LF9B 4OX9O 4DR1B 2P4KA 5LXTB 1KECA 3ZMUA 4JAAA 2QKSA 2WWWA 3NR7A 1R3LC 2QWRB 5DECA 2G38A 4LH6A 1O9HA 2ZQMA 1F7YA 1NR1A 5EZYA 3KZIZ 2AHYA 2DYRB 2HEPA 1HWYA 5LYJA 2KSDA 2WPDG 4KL1A 2DYSC 4EB6B 3H9VA 3JD3A 3RYFA 3AG2C 1L1FA 4JTCB 2ITDC 1BSMA 1PNLA 4YXWG 3STZC 4J7KA 4DUYB 3OTOB 4YJ2B 4QPKA 1DTOA 3UCSC 1XHXA 3CE2A 2LP7A 3HB3B 5JJNB 3CCJV 3RYIA 3QO5A 1I0HA 5DM6V 1L8DA 5CA0B 3E8FA 1IBMO 3QNEA 4U3JA 1HP8A 3T2MA 5LMUB 1N33B 1HNWB 3MD0A 1PM9A 4O4IB 1Z5VA 2XOKG 4GKJO 2L35A 4K0KB 4X64B 3G6EV 3C90A 3K04A 1GN4A 2VQFO 4YHHB 3LNNA 1NBMG 5H6RA 4LP8A 2VQFB 2YIAA 3ABUA 4TV9A 1N34O 3FB5C 5KUMA 2PTMA 4Q6GA 2QM4A 3M99B 2V4DA 3D3IA 4FLVA 5IT9N 4JI5B 5E79Z 4JZ2A 2WLMA 1RM1C 4U7NA 2QR4A 1JVMA 4X8AA 2OWOA 1ZAUA 2YICA 5EZYB 2Q69A 1AI5A 3T1HB 2GUZA 1FD9A 4Z1MG 2EJRA 4DK0A 3QTCA 1Q3EA 3AG1B 1VMGA 2C2AA 4PA4A 2ZE7A 2EIKC 3C3SA 3K9SA 2R9IA 1S3JA 1VQNV 1IVSA 5DN6G 5LMNO 1V9PA 5BR8O 3RYIB 3OR7C 4CH3A 4WFGA 4IGGA 5IYDO 2JGDB 2ZE6A 4U3FH 3J80N 3K5NA 3N2KA 2YXHA 1NKDA 1NTMH 3FFQA 3B09A 3X2QB 4CZZA 3M7MX 3E83A 3L9DA 3RYCB 2P7TC 5DEDA 3SJQC 2VWKA 2Q67A 3KKYA 1SQXH 2KQXA 1M1KW 4MTGA 3JCZA 5K1XA
chains in the Genus database with same CATH topology
1MNGA 2QKCA 4BR6A 1VARA 2QKAA 1N0NA 1JA8A 1PM9A 1BT8A 4JZGA 1VEWA 3OT7A 1GN2A 1ZTEA 3IC9A 3BFRA 1GN4A 1N0JA 4YIPA 4JYYA 1XUQA 4X9QA 1XDCA 3DC5A 1Y67A 1JR9A 1ZSPA 1XILA 1IDSA 1P7GA 1BS3A 2ADPA 1GN6A 2GDSA 1EN4A 4GUNA 1AP6A 1PL4A 1KKCA 1ZUQA 4JZ2A 3LSUA 1LUVA 1EN5A 4FFKA 3AK2A 1WB7A 1MA1A 1LUWA 1D5NA 3EVKA 1QNMA 2CE4A 4YIOA 1IXBA 1XREA 2P4KA 1MSDA 1AVMA 4F6EA 3C3SA 3AK1A 1I08A 3K9SA 1EM1A 5A9GA 1AR4A 1IX9A 3AK3A 1AR5A 3DC6A 3C3TA 2ADQB 4E4EA 1ZLZA 1AP5A 2CDYA 1SZXA 1MMMA 1BSMA 3KDRA 2AW9A 1EN6A 5AG2A 1GN3A 3TJTA 3CEIA 3QVNA 1I0HA 1WB8A 2RCVA 3KKYA 3RN4A 3MDSA 4C7UA 1B06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MNG A;  2QKC A;  4BR6 A;  1VAR A;  2QKA A;  1N0N A;  1JA8 A;  1PM9 A;  1BT8 A;  4JZG A;  1VEW A;  3OT7 A;  1GN2 A;  1ZTE A;  3IC9 A;  3BFR A;  1GN4 A;  1N0J A;  4YIP A;  4JYY A;  1XUQ A;  4X9Q A;  1XDC A;  3DC5 A;  1Y67 A;  1JR9 A;  1ZSP A;  1XIL A;  1IDS A;  1P7G A;  1BS3 A;  2ADP A;  1GN6 A;  2GDS A;  1EN4 A;  4GUN A;  1AP6 A;  1PL4 A;  1KKC A;  1ZUQ A;  4JZ2 A;  3LSU A;  1LUV A;  1EN5 A;  4FFK A;  3AK2 A;  1WB7 A;  1MA1 A;  1LUW A;  1D5N A;  3EVK A;  1QNM A;  2CE4 A;  4YIO A;  1IXB A;  1XRE A;  2P4K A;  1MSD A;  1AVM A;  4F6E A;  3C3S A;  3AK1 A;  1I08 A;  3K9S A;  1EM1 A;  5A9G A;  1AR4 A;  1IX9 A;  3AK3 A;  1AR5 A;  3DC6 A;  3C3T A;  2ADQ B;  4E4E A;  1ZLZ A;  1AP5 A;  2CDY A;  1SZX A;  1MMM A;  1BSM A;  2AW9 A;  1EN6 A;  5AG2 A;  1GN3 A;  3TJT A;  3CEI A;  3QVN A;  1I0H A;  1WB8 A;  2RCV A;  3KKY A;  3RN4 A;  3MDS A;  4C7U A;  1B06 A; 
#chains in the Genus database with same CATH topology
 3ETE A;  2RN9 A;  4DV7 B;  4GX0 A;  5CN0 A;  2ZCE A;  1FXV A;  1JOY A;  1GAX A;  3BRC A;  4NXN B;  1YI2 V;  1Q81 W;  1XI1 A;  1JA8 A;  2VRZ A;  4KHP B;  2X0L A;  3LDE A;  3FD9 A;  2WLJ A;  2WLH A;  1EFR G;  4X89 A;  4CBC A;  3L74 H;  3CRQ A;  4Q20 A;  1SES A;  4YJ3 A;  1BL8 A;  2B9Z A;  3R65 A;  2OTJ V;  2WAM A;  2YI8 A;  3HKC B;  1MZF A;  4JI3 O;  3JD0 A;  3CC2 V;  3ZBH A;  3CCR V;  1M57 B;  4YY3 B;  3AK2 A;  4LF4 O;  1XHZ A;  1SER A;  1F23 A;  2VQE O;  4EFB A;  1ZWI C;  1BGY H;  4JI1 B;  1K7D A;  2PGG A;  3K3W A;  3L72 H;  4ZI7 A;  1MSW D;  4IYI A;  1LR1 A;  5LGU A;  3DXR A;  2ATK C;  1DF4 A;  3B77 A;  4WFH A;  3JAM N;  1HNX B;  2Q8V A;  3SPH A;  2B1G A;  4K8X A;  2EZP A;  4GKK O;  2YI9 A;  4IYH A;  2W0F C;  4LH7 A;  5H5N A;  4E4E A;  2F66 C;  4UFZ A;  4B08 A;  4LF8 O;  3P32 A;  1KKD A;  3I5D A;  3VOU A;  3UM7 A;  2KKW A;  1K5Q A;  3ABK C;  5AG2 A;  2QE7 G;  4RWU A;  4DK1 A;  3RGB A;  4I7Z B;  1G8M A;  3PN1 A;  3FB7 C;  1OCR C;  4QE9 A;  1Y76 A;  4Z1V A;  1AJP A;  2CK3 G;  5EBW C;  4DR6 O;  1IBK O;  2JVD A;  1NJI W;  2UXB O;  4O4H A;  1I5Y A;  1IXM A;  3OR6 C;  1Q8I A;  4ZOL A;  5D5Q A;  5CBH A;  3FX7 A;  4DV2 B;  3U11 A;  2QGN A;  5BXZ A;  2EIJ C;  1N36 B;  2BCC H;  3A0B Z;  2P06 A;  1JX9 A;  2F43 G;  1Y67 A;  2CGN A;  2KB1 A;  4ZIB A;  1Y66 A;  1IDS A;  3A2F A;  4J9Z B;  1BS3 A;  1K97 A;  1SZT A;  5KAI Z;  2UUC B;  4JF3 A;  3SPG A;  1KD1 W;  3CRC A;  2A7W A;  2M7W A;  3ZJZ A;  5KAF Z;  3JSL A;  1WP7 A;  5LP6 C;  4LFC O;  4GUN A;  1ZUQ A;  3DXR B;  1TAE A;  2GSM B;  1FJG O;  3FAV B;  2EIM B;  3BAB A;  1MZE A;  3VQV A;  2UXD O;  4RUF A;  3JAL B;  5A2Q N;  3L71 H;  3EVK A;  3EXA A;  3CME V;  4LBE C;  4YIO A;  5LA6 A;  4B3T B;  2HHH O;  4L8J A;  3JCU Z;  2F95 B;  4DV5 B;  1SQG A;  1OCC B;  3JSN A;  1Z5W A;  4H0L B;  4WBN A;  4DR4 O;  2QWN B;  2KG7 A;  2NR5 A;  1YDX A;  3O65 A;  2WLI A;  4JI6 O;  4X65 O;  2P22 C;  1H2G A;  1YTF B;  1WLE A;  2ZXW B;  2DJV A;  3ZMZ A;  4NXM B;  1IBL B;  4ZOL B;  4NTY A;  1QLE C;  2ITC C;  4CS2 A;  1K4D C;  1XQ8 A;  4PI0 A;  2UUB B;  2HKO A;  3OMN B;  1R3K C;  4X20 A;  4DR3 B;  1HNZ O;  5FNV A;  3T1C A;  2ZIO A;  4TSF G;  2OT5 A;  2H8P C;  2YIB D;  2FTK A;  4LR3 A;  1I94 O;  5JCO C;  2Q4P A;  1AI6 A;  2YID A;  2D3O W;  1VF6 C;  3ASN C;  1GTO A;  4MTO A;  2O57 A;  3ABK B;  5FPO A;  4B7K A;  4I50 A;  5C93 A;  3LNM B;  4LNU A;  4DR2 B;  4B3S O;  3JAR A;  1KB9 F;  5LA6 B;  1FXH A;  1K92 A;  4PDR A;  2ZIN A;  3B40 A;  4DV6 O;  1LNQ A;  3OD4 A;  1N8R W;  4D6T H;  5LOV B;  4JV5 O;  4X66 O;  3BPZ A;  3LSU A;  4I55 A;  4KXR A;  2WLI B;  2ZD9 A;  1M90 W;  5KMG A;  1J5E O;  2Q73 A;  3CCS V;  5B1A B;  5JWP A;  1QR9 A;  2DOS A;  3E8B A;  4RAI A;  4KP4 A;  2R70 A;  3BAA A;  1XNQ B;  4LF7 O;  4F6R A;  2EUL A;  4D7T A;  2ZM6 B;  3AK1 A;  1BQ0 A;  4UXN A;  3CSX A;  4JAV A;  3JYC A;  3AG4 C;  1YEW A;  2DE0 X;  1M56 C;  3K08 A;  1URF A;  4FFB B;  3DC6 A;  3T1Y B;  3BCC H;  3ZRV A;  1G4Y B;  1MMM A;  5IWA O;  1XBL A;  4GLX A;  1K33 A;  5KA6 A;  4O4L A;  1OJH A;  3SPC A;  1GRJ A;  2QEX V;  1THZ A;  2FB5 A;  2UXC O;  2P6J A;  2EBO A;  4BAY A;  1HR0 B;  1UPG A;  2IM9 A;  5EC2 C;  5KHJ A;  4I50 B;  3F7Y C;  1H2S B;  2Z0A A;  4P9P A;  4X1I A;  1VAR A;  3ZN1 A;  4X1K B;  3OAA G;  3JAR B;  2Z3Y A;  1FYJ A;  1K8A W;  4CH4 A;  4AQY O;  5EBL C;  3B4S A;  2QWO B;  1XNR B;  1OCO C;  3STL C;  3SYA A;  2HFE C;  4HAM A;  1YHQ V;  1UFI A;  4I55 B;  1JR9 A;  2P5O A;  3BY6 A;  2ZE8 A;  3L75 H;  4EB6 A;  1NR7 A;  5KMG B;  4PV1 B;  1YJN V;  4DR7 O;  4CS4 A;  3G6B A;  2XT9 A;  4I4T A;  2Y0I A;  1AP6 A;  4DR7 B;  3OMI B;  4YJ2 A;  2F4V B;  3RYH B;  1P4R A;  2E5L B;  1Q5O A;  1FPO A;  2AHZ A;  3K5O A;  1SF9 A;  4BIZ A;  1X59 A;  5GON B;  2N74 A;  4DR5 B;  4DRX A;  4O4I A;  4MTF A;  3ABT A;  3ABL C;  1QVG U;  1XMQ O;  2QDO A;  3ZCC A;  4WCE V;  1WNS A;  4ICG A;  3A8T A;  2ZNJ A;  1EM1 A;  4MS2 A;  2A3Q A;  4ZBM A;  5LL6 Y;  4DO2 A;  4LF9 O;  4DR1 O;  4N21 A;  4RQE A;  4TWK A;  3ZHU A;  1IZ3 A;  3OGC C;  2YEV B;  2Y48 A;  2PI5 A;  5IYZ A;  1CP9 A;  5JJE B;  1SC5 B;  4X1I B;  1GMG A;  2AW9 A;  2ZIM A;  3W7T A;  2K9P A;  1XOU A;  1EN6 A;  3VQX A;  4UB8 Z;  3J81 N;  3TJT A;  3ABM C;  5D5P A;  4JI7 B;  2JS3 A;  3ZHR A;  4LFA B;  1FXK A;  4JAU A;  4DYL A;  1PL0 A;  2R72 A;  4BR6 A;  2EIL C;  2LFR A;  1M56 B;  2YIB A;  4DUY O;  3OTO O;  5C8Y B;  2BOC C;  3SR2 C;  1OCZ C;  1JJO A;  1S77 D;  4I4T B;  3CC7 V;  3UQ8 A;  1G1X B;  1N0J A;  1XUQ A;  1SA0 B;  3BA9 A;  1YTF D;  1V54 C;  3DC5 A;  5LMU O;  3FB8 C;  3LSQ A;  2JGD A;  1N33 O;  1HNW O;  1YJ9 V;  2WLN A;  4MVZ A;  4P9O A;  2DMX A;  4K0K O;  4X64 O;  1H2K A;  3HKE A;  4DRX B;  4PA3 A;  4YHH O;  3QG5 A;  4PI2 A;  2Y69 B;  2PF4 E;  4LF6 B;  3RYC A;  3THO A;  1H2M A;  2RQ6 A;  3ETD A;  5JJJ B;  1OHH G;  1WB7 A;  1UJW B;  1MA1 A;  3CCM V;  2UXX A;  3CJH B;  1DGS A;  3JAS A;  2P90 A;  4JI5 O;  4DUZ B;  2LJ2 A;  1PV0 A;  5B1O A;  5IYZ B;  1YZB A;  3QO8 A;  1Q6H A;  2WSS G;  3JAW B;  5H2F Z;  5CBF A;  1VQ8 V;  3Q4H B;  3CXC U;  2QWQ B;  4B3M B;  2LFS A;  3WB0 A;  5A9G A;  1RP3 B;  2JEU A;  3T1H O;  4PDL A;  3MHS C;  3H1H H;  3SDL A;  2ARH A;  4HNA A;  1JFF B;  2Y0P A;  3HKC A;  4FLZ A;  1FXK B;  5H6Q A;  3SPI A;  4K35 A;  1ZLZ A;  2ZT9 B;  3W7W A;  2HP8 A;  3TGU H;  3P3P A;  4RQF A;  3ETQ A;  4GX2 A;  3CEI A;  5L3D A;  4PEL A;  4PD4 F;  2LGQ A;  3ABL B;  5GTI Z;  1QCE A;  4PA9 A;  4B7E A;  3NXS A;  2EX3 A;  3RVZ A;  4ZKI A;  1DK1 A;  4JI2 B;  4JI4 B;  2XAG A;  2GBO A;  1JJ2 U;  1BT8 A;  3HKE B;  1Q6I A;  2UU9 B;  3OM3 B;  1S76 D;  4JYY A;  4UVB A;  2BE3 A;  4I5S A;  1XDC A;  1Q82 W;  4DV7 O;  4ZHQ A;  2EIN C;  2CTP A;  3ZMT A;  3ABM B;  4NXN O;  2D2C B;  4UVC A;  1XMO B;  2MK3 A;  4LFB B;  3H1K H;  4K8Z A;  4J9Y B;  5KX5 A;  4KHP O;  1L0N H;  3JAS B;  5ITZ A;  5JQG A;  4X62 B;  4P30 A;  2HVK C;  3E8H A;  1S5J A;  2DYS B;  4LWS B;  3FB6 C;  5B5E Z;  2EIL B;  3AG2 B;  1R3I C;  1KUQ A;  1EN5 A;  2YDE A;  1OCZ B;  3SYP A;  1K3E A;  3DSQ A;  3G80 A;  4JYA B;  4MVS A;  2HR3 A;  5KHG A;  4A5U B;  2PYL A;  2X6A A;  2VWJ A;  4HNA B;  1D5A A;  2Q6A A;  2V7Q G;  1V54 B;  4GX1 A;  5EIB D;  3LDC A;  1MSD A;  3JAT B;  2RNB A;  5KHK A;  3CRR A;  2Y4U A;  3H1L H;  2ILM A;  4YY3 O;  1PD3 A;  3ZS8 C;  1I08 A;  4H33 A;  4H44 B;  2WLL B;  1SQF A;  4UCR A;  3K0G A;  4JI1 O;  1J95 A;  4CC6 A;  1YF2 A;  5KHI A;  4IHJ A;  4FPP A;  4P2Z A;  2UUA B;  1GH6 A;  1GK9 A;  1HNX O;  3SGI A;  2HVJ C;  1V55 C;  3CWB H;  4EEQ A;  3FAV A;  1R6N A;  1GM9 A;  2BTQ B;  1L0L H;  1CPY A;  3UT5 B;  3CRA A;  3GWO A;  3O9O A;  3JAL A;  1QLN A;  5FL7 G;  3U10 A;  2JK5 C;  4UCU A;  2Q7H A;  3MDS A;  3SYO A;  3BVO A;  4ZHQ B;  5JH7 B;  1RM1 B;  1WPB A;  1F51 A;  4GCZ A;  1K4C C;  2IJI A;  2QKC A;  3LDD A;  1WPX A;  5F2V O;  3ASO C;  2CTR A;  5KX5 B;  1N0N A;  1X4T A;  5ITZ B;  5JQG B;  3OT7 A;  1QR8 A;  2AGA A;  4B3R B;  1VQK V;  4QJF B;  2CH7 A;  5KA5 A;  2Y4T A;  2EIK B;  5KLV H;  2DWE C;  1EZV H;  3ZHV A;  2PI4 A;  1XL4 A;  4DV2 O;  4DW1 A;  3OEH G;  2X6B A;  1PL4 A;  3TK1 A;  1N36 O;  1KU9 A;  4DV4 B;  3OUS A;  1KBH A;  3F5T A;  1GO3 F;  4KUM A;  4QE7 A;  2Q5Z A;  1GM7 A;  2AXT Z;  2IJJ A;  2P4V A;  1S0V A;  4FM2 A;  4X88 A;  2ZR3 A;  4N23 A;  3K5L A;  3J7A U;  2UUC O;  4LF5 B;  4MVU A;  4PJ0 Z;  3RT3 C;  5K1P A;  3WB2 A;  2XAJ A;  5E1A C;  4JYC A;  4IHJ B;  5B66 Z;  1AVM A;  1ARO P;  1BMF G;  3JD4 A;  2WA3 A;  3GB7 C;  5EBM C;  1XL6 A;  1SQV H;  4TOI A;  2IJK A;  1DLB A;  1VP7 A;  1H8E G;  4B3T O;  3K58 A;  4DV5 O;  1AR5 A;  1AJN A;  2ZDI C;  4Z2W A;  1JCH A;  4JYB A;  1AP5 A;  4RO2 A;  1SZX A;  3APQ A;  1SKV A;  5LGT A;  4OXS A;  3ZHQ A;  2MW2 B;  5L3G A;  3OE7 G;  5LOV A;  4GYC B;  3H01 A;  3HKD A;  4LCU C;  5LGN A;  1ZX3 A;  2FKX A;  2CH7 B;  3E86 A;  3KCX A;  4OPH A;  4NXM O;  4X1Y A;  2FL4 A;  1IBL O;  2ZNI A;  1WN7 A;  1MNG A;  4UCS A;  5IY5 C;  1VQL V;  1AI4 A;  5CA1 B;  1SQQ H;  4F4L A;  1VQM V;  3WG7 C;  2V1D A;  4JZG A;  4R8C A;  3ZRW A;  3F7V C;  1H38 A;  2B5U A;  3L73 H;  4MVR A;  4X9Q A;  2UUB O;  3T4D A;  4FLW A;  3SYQ A;  3LUT B;  1PP9 H;  4DR3 O;  1NU1 H;  4FFB A;  1K73 W;  2IH3 C;  2XAQ A;  2ADP A;  4QGP A;  1S5H C;  4MVO A;  3A0R A;  4JI0 B;  3I56 V;  1Q90 D;  5L3B A;  1G6U A;  1MAB G;  3ASO B;  1TA8 A;  4DR2 O;  2PYJ A;  1D5N A;  1KYO F;  2JS5 A;  4FM0 A;  1OCR B;  1XRE A;  2IBZ H;  4UUJ C;  1AIL A;  4X1K A;  2ZR2 A;  1Z2G A;  3RFR A;  3RBZ A;  4MW3 A;  2XTA A;  4QNH B;  2Q0A A;  1FS0 G;  1SS3 A;  4UCT A;  3HKD B;  4PDM A;  3K0D A;  4BW9 A;  3AK3 A;  3M8A A;  2EIJ B;  3P3N A;  4X1Y B;  1XNQ O;  1R6K A;  4JGS A;  4JPR A;  2W6I G;  1YSC A;  4XDJ A;  1QVF U;  2ZM6 O;  3VQW A;  3RYH A;  5J2T B;  4DV1 B;  3ZRW B;  5JCO A;  4L87 A;  2QTS A;  5LP6 B;  1EZJ A;  5GON A;  1VF6 A;  1VQP V;  4C7U A;  1B06 A;  3T1Y O;  4AIL C;  4W4K A;  4R6Z A;  4DV0 B;  1P49 A;  4EFE A;  3OTF A;  3TXQ A;  2VS0 A;  1GN2 A;  2BSK A;  2IU3 A;  4YIP A;  2Q0O C;  4BIO A;  1HR0 O;  3APO A;  4JI8 B;  1YIJ V;  2H94 A;  2YEV A;  2F93 B;  5HFM A;  1GN6 A;  4TUY B;  1QBZ A;  1ORQ C;  3W7S A;  1H5W A;  1M93 A;  4O2A B;  5CA3 A;  1XNR O;  3D36 C;  1WAZ A;  3CXH F;  4TQF A;  1KKC A;  2H3O A;  3N27 A;  2PUS A;  1PPJ H;  4XDK A;  3WG7 B;  4BWA A;  2PY5 A;  1QLE B;  1S72 V;  3AEI A;  2QSA A;  4PA7 A;  2NNU A;  2HLD G;  2HG5 C;  3OFN G;  3CPW U;  1TUB A;  1NQT A;  5C8Y A;  2F4V O;  3EFF K;  1CEZ A;  2E5L O;  3OUF A;  4FLT A;  1SA0 A;  1MG1 A;  1NZ6 A;  1Y6X A;  1O9G A;  1JQ0 A;  2DW4 A;  3MAQ A;  2GHY A;  4DR5 O;  2DQ3 A;  1VQ6 V;  1TGO A;  4PA6 A;  1IX9 A;  2OIE A;  3BA8 A;  2ETN A;  3C3T A;  1VQ9 V;  3ASN B;  4FJC C;  4DXW A;  3K59 A;  2JJ2 G;  4WFB V;  3KDR A;  3EHB B;  2LGW A;  5B1N A;  3ZN0 A;  4AHC A;  2Z5U A;  2IH1 C;  1CXZ B;  2BSK B;  3ZIA G;  4IT5 A;  2M6Y A;  2X6C A;  1RSO A;  1BHA A;  1K5S A;  3CJH A;  1H2L A;  4J10 A;  3ZRX A;  2K1E A;  4G28 B;  2OIG A;  4FLX A;  1JPX A;  1RPR A;  3JAW A;  2LW7 A;  3R66 A;  3CHX A;  1JMK C;  1VEW A;  3AG3 C;  3Q4H A;  4QPJ A;  1ZL8 A;  3ZED A;  3P30 A;  4JI7 O;  5CB4 B;  1N32 B;  2Q7E A;  3ZRS A;  4IL6 Z;  4LFA O;  4CH5 A;  2OCH A;  2IU0 A;  5IJ0 B;  1JFF A;  1N4C A;  4XDL A;  3X2Q C;  4WFA V;  1PNM A;  1VQ7 V;  1HDJ A;  3AG4 B;  4OPA A;  1YCI A;  1QQC A;  1TUB B;  2GDS A;  4DV3 B;  4OX9 B;  4J42 A;  4MTX A;  4G27 B;  4G2K A;  4KFM A;  1SET A;  1K9M W;  3CYO A;  1Q6U A;  1T5E A;  4E2L A;  1WA8 B;  3BEH A;  3VBB A;  2LO1 A;  4CC5 A;  4FZ1 A;  4MVQ A;  4LF6 O;  1KP3 A;  1W0K G;  2YXY A;  5JVD A;  4NB5 A;  2XUM A;  2PZS A;  2DWD C;  5EK0 A;  2BTO A;  3W7U A;  1NVP D;  3GWK C;  1COW G;  3U0Z A;  3CCQ V;  5J2U B;  3PJS K;  4UB6 Z;  1RSO B;  2JEX A;  5L3F A;  4DUZ O;  4I0X B;  1OZ0 A;  4UCV A;  1OCO B;  2QWP B;  2E76 B;  1K34 A;  1IBM B;  1M57 C;  1VIB A;  1YIT V;  4LWS A;  1DF5 A;  1TVK B;  3ICX A;  4B3M O;  2N04 A;  1WP8 A;  1ZL8 B;  4GKJ B;  3K5M A;  3E35 A;  3JAK B;  3JD2 A;  4D7S A;  3E8G A;  3K06 A;  2QKA A;  3JAT A;  1SRY A;  1BQZ A;  3IJ4 A;  1NTK H;  1N34 B;  3WB1 A;  2DN9 A;  3E2E A;  2EZO A;  2A06 H;  2WLL A;  1BCC H;  4OGQ B;  1BZK A;  3TXS A;  3ZX6 A;  3IC7 A;  4JI2 O;  2YSU B;  1ZSP A;  5LYJ B;  4JI4 O;  4JTD B;  1ENV A;  3HR0 A;  1TUE B;  3RYF B;  2UU9 O;  2W0X A;  4J11 A;  3FYE B;  3UO2 A;  2BTQ A;  3UT5 A;  5JVD B;  4NKG B;  2CGO A;  1VQO V;  2JJ1 G;  5CMU A;  3CCL V;  1XMO O;  3AG3 B;  3QO7 A;  5JH7 A;  4LFB O;  4UCO A;  2CE4 A;  1RPO A;  5LMN B;  3K79 A;  5BR8 B;  4X62 O;  4U3J B;  3B8N A;  2RMK B;  1WJZ A;  5CBG A;  2WLK A;  1YXB A;  4TT3 G;  4PHZ A;  1W0J G;  3T4Z A;  4ABM A;  4JYA O;  4FMT A;  3HPL C;  2OYQ A;  2L6L A;  1H8H G;  3AG7 A;  2FYU H;  3OMA B;  2NLJ C;  1U96 A;  4FK5 C;  1B3Q A;  1R3J C;  2ODM A;  4TV9 B;  4XBF A;  4J80 A;  2CDY A;  2UXN A;  2EIM C;  3OW2 U;  5GW7 A;  3FYI B;  3CCU V;  3A0H Z;  1NT2 B;  1NH2 B;  4ASU G;  4BW5 A;  5IJ9 A;  1OCC C;  3G71 V;  4QIW F;  4W4L A;  3UO3 A;  2UUA O;  2GTS A;  3K9A A;  2GUZ B;  4O2B A;  1P7B A;  2F1M A;  2Q68 A;  5B3S C;  5IYB O;  4JI3 B;  3CS5 A;  3F5W C;  2ZXW C;  3ZHS A;  2QJ1 A;  5H9C A;  4O4J A;  2A0L A;  2QA4 V;  1M9N A;  1HW7 A;  1BHB A;  3OGI B;  5LHG A;  4LF4 B;  2E75 B;  3LSS A;  2VQE B;  1P7G A;  4GZR B;  4WFE A;  1JNB A;  3N2K B;  4B3R O;  1EN4 A;  2XAF A;  1R73 A;  1Y74 A;  1KP2 A;  1A32 A;  1FOU A;  1Q43 A;  1SQB H;  4FFK A;  4H13 B;  1NS1 A;  1GKF A;  4MW8 A;  2CTQ A;  5CA1 A;  4H37 A;  5FLX N;  1U97 A;  4GKK B;  2A9H A;  4NTX A;  5FPR A;  2GTA A;  3HKB A;  4JAS A;  4DV4 O;  2E3C A;  1FFX A;  4LF8 B;  1Y4M A;  3SPJ A;  1IJG A;  2OCC C;  4LF5 O;  2Q7G A;  1YVW A;  2CTW A;  1W59 A;  3H1J H;  4IIJ A;  1S5L Z;  1VQ4 V;  5IJ9 B;  4YJ3 B;  3ETG A;  4NTW A;  4CH6 A;  3DTU B;  5LHH A;  4DR6 B;  4NR1 A;  3VQY A;  1IBK B;  4O2B B;  1US6 A;  2EIN B;  3CC4 V;  2UXB B;  3K03 A;  4K3A A;  3RVY A;  2HJF C;  4MVM A;  1GN3 A;  2W6J G;  2QM7 A;  5B1A C;  5KHH A;  3E22 A;  3OEE G;  4J7J A;  4O4J B;  2RJZ A;  4I9Q A;  2LW1 A;  2AZ0 A;  4ZI7 B;  3I55 V;  1BE3 H;  1Y74 B;  3BFR A;  4LFC B;  1MOF A;  3IGA C;  1AB3 A;  1FJG B;  3CX5 F;  4JTA B;  3MHH C;  2UXD B;  2RDC A;  3CD6 V;  2CUG A;  5IE9 A;  4CS3 A;  4FLU A;  2R9A A;  4HYO A;  2HHH B;  1D2D A;  4UV9 A;  1KMI Z;  3HKB B;  2EJ7 A;  2E74 B;  5J2T A;  1FFX B;  4TQD A;  1LUV A;  5B3S B;  5LP6 A;  1M5I A;  5LBQ A;  4DR4 B;  2JGU A;  2ZE5 A;  2XND G;  2A79 B;  1NVP B;  2OTL V;  4JI6 B;  3CCE V;  1Y76 B;  4X65 B;  5EIB C;  1V55 B;  4IIJ B;  3SYC A;  3CRM A;  4JI0 O;  5LHI A;  3ML0 A;  4O4H B;  3GVM A;  2XAH A;  2YUA A;  3SJB C;  4GT1 A;  1GM8 A;  2ZDI A;  3KCY A;  4BIU A;  4F6E A;  2GV9 A;  4LC1 A;  3D3Q A;  5BMV A;  2XHB A;  4RUE A;  3SJC C;  3E22 B;  1YJW V;  3CP1 A;  4TUY A;  2IJH A;  1SQP H;  2DQ0 A;  1F4N A;  5EYP A;  4O2A A;  1NI8 A;  3H1I H;  1HNZ B;  2NN4 A;  4GX5 A;  2AZ2 A;  1PKX A;  3BHP A;  1I94 B;  4NVP A;  1NTZ H;  3QF7 A;  1M4U A;  4NYK A;  2P67 A;  1WB8 A;  3G67 A;  2RCV A;  3RN4 A;  2F23 A;  2FML A;  2OCC B;  4FLY A;  1E79 G;  4WF9 V;  4DV1 O;  1XEQ A;  3CMA V;  4B3S B;  4MT8 A;  5IYC O;  4WBN B;  5B1B C;  3IC9 A;  4DV6 B;  1EBO A;  2KG7 B;  3N2G A;  1FKA O;  2YC0 A;  4AI8 A;  5TIS Z;  3D8C A;  1ROP A;  1FFT B;  1Q7Y W;  4JV5 B;  4X66 B;  3RW0 A;  3DGE A;  2BOB C;  1XIL A;  4DV0 O;  5EC1 C;  1OV9 A;  4FZ0 A;  3TCU A;  1KC8 W;  4R50 A;  1J5E B;  3KG2 A;  1AR1 B;  1KQS U;  3UKM A;  2DYR C;  1R1B A;  1RFY A;  4LF7 B;  1H2N A;  1QU7 A;  2N05 A;  1NH2 D;  4JI8 O;  4TV8 A;  1IUR A;  5BZB A;  1LUW A;  5L3E A;  5BMV B;  2JDI G;  5GTH Z;  3S3W A;  4PDV A;  3ZMS A;  3ZMV A;  4X20 B;  2QM8 A;  5FNV B;  3TET A;  2XAS A;  5HFL A;  5EYP B;  3WU2 Z;  5IY5 B;  5CB4 A;  5IWA B;  4U7O A;  3RWR D;  5IJ0 A;  2QTO A;  3CB2 A;  1I5X A;  5J9P C;  1AR4 A;  2UXC B;  3B2E E;  5LXT A;  2ADQ B;  1VF5 B;  4LNU B;  2Y69 C;  1B6Q A;  2IW5 A;  1QHT A;  4FM1 A;  3ZHT A;  4J41 A;  2R9R B;  4R7C A;  2JIZ G;  5L3C A;  1R6T A;  4EKW A;  3L70 H;  3QVN A;  3N2G B;  4AQY B;  3FKS G;  3W7X A;  3IAY A;  2JRI A;  4UV8 A;  1WA8 A;  4J7Z A;  1B04 A;  5KUK A;  2YS8 A;  1E1Q G;  1ZTE A;  4F6R B;  4HZ3 A;  1P84 F;  1FXK C;  1PNK A;  3D36 A;  4FIP C;  5CA0 A;  5J2U A;  3CCV V;  4TV8 B;  2LQT A;  2CAZ C;  3IFX A;  4I0X A;  1VQ5 V;  3AG1 C;  2HJD A;  2YXL A;  3G4S V;  1I7F A;  2WA4 A;  4MSW C;  5BY1 A;  3E89 A;  1TVK A;  3B8M A;  1W2B U;  1VF7 A;  1AJQ A;  2Q9L A;  1F4M A;  3WFV A;  1E1R G;  4DW0 A;  1N32 O;  3SJA C;  2B1I A;  5IDJ A;  3K57 A;  1Q86 W;  4O4L B;  1FAF A;  2X7R B;  1XMQ B;  3JAK A;  3JD1 A;  3S3X A;  4FVM A;  4HBN A;  5B1B B;  1AI7 A;  2ZKO A;  1QNM A;  4WFF A;  4UVA A;  1IXB A;  4I9W A;  4DV3 O;  4LF9 B;  4OX9 O;  4DR1 B;  2P4K A;  5LXT B;  1KEC A;  3ZMU A;  4JAA A;  2QKS A;  2WWW A;  3NR7 A;  1R3L C;  2QWR B;  5DEC A;  2G38 A;  4LH6 A;  1O9H A;  2ZQM A;  1F7Y A;  1NR1 A;  5EZY A;  3KZI Z;  2AHY A;  2DYR B;  2HEP A;  1HWY A;  5LYJ A;  2KSD A;  2WPD G;  4KL1 A;  2DYS C;  4EB6 B;  3H9V A;  3JD3 A;  3RYF A;  3AG2 C;  1L1F A;  4JTC B;  2ITD C;  1BSM A;  1PNL A;  4YXW G;  3STZ C;  4J7K A;  4DUY B;  3OTO B;  4YJ2 B;  4QPK A;  1DTO A;  3UCS C;  1XHX A;  3CE2 A;  2LP7 A;  3HB3 B;  5JJN B;  3CCJ V;  3RYI A;  3QO5 A;  1I0H A;  5DM6 V;  1L8D A;  5CA0 B;  3E8F A;  1IBM O;  3QNE A;  4U3J A;  1HP8 A;  3T2M A;  5LMU B;  1N33 B;  1HNW B;  3MD0 A;  1PM9 A;  4O4I B;  1Z5V A;  2XOK G;  4GKJ O;  2L35 A;  4K0K B;  4X64 B;  3G6E V;  3C90 A;  3K04 A;  1GN4 A;  2VQF O;  4YHH B;  3LNN A;  1NBM G;  5H6R A;  4LP8 A;  2VQF B;  2YIA A;  3ABU A;  4TV9 A;  1N34 O;  3FB5 C;  5KUM A;  2PTM A;  4Q6G A;  2QM4 A;  3M99 B;  2V4D A;  3D3I A;  4FLV A;  5IT9 N;  4JI5 B;  5E79 Z;  4JZ2 A;  2WLM A;  1RM1 C;  4U7N A;  2QR4 A;  1JVM A;  4X8A A;  2OWO A;  1ZAU A;  2YIC A;  5EZY B;  2Q69 A;  1AI5 A;  3T1H B;  2GUZ A;  1FD9 A;  4Z1M G;  2EJR A;  4DK0 A;  3QTC A;  1Q3E A;  3AG1 B;  1VMG A;  2C2A A;  4PA4 A;  2ZE7 A;  2EIK C;  3C3S A;  3K9S A;  2R9I A;  1S3J A;  1VQN V;  1IVS A;  5DN6 G;  5LMN O;  1V9P A;  5BR8 O;  3RYI B;  3OR7 C;  4CH3 A;  4WFG A;  4IGG A;  5IYD O;  2JGD B;  2ZE6 A;  4U3F H;  3J80 N;  3K5N A;  3N2K A;  2YXH A;  1NKD A;  1NTM H;  3FFQ A;  3B09 A;  3X2Q B;  4CZZ A;  3M7M X;  3E83 A;  3L9D A;  3RYC B;  2P7T C;  5DED A;  3SJQ C;  2VWK A;  2Q67 A;  3KKY A;  1SQX H;  2KQX A;  1M1K W;  4MTG A;  3JCZ A;  5K1X A; 
#chains in the Genus database with same CATH homology
 1MNG A;  2QKC A;  4BR6 A;  1VAR A;  2QKA A;  1N0N A;  1JA8 A;  1PM9 A;  1BT8 A;  4JZG A;  1VEW A;  3OT7 A;  1GN2 A;  1ZTE A;  3IC9 A;  3BFR A;  1GN4 A;  1N0J A;  4YIP A;  4JYY A;  1XUQ A;  4X9Q A;  1XDC A;  3DC5 A;  1Y67 A;  1JR9 A;  1ZSP A;  1XIL A;  1IDS A;  1P7G A;  1BS3 A;  2ADP A;  1GN6 A;  2GDS A;  1EN4 A;  4GUN A;  1AP6 A;  1PL4 A;  1KKC A;  1ZUQ A;  4JZ2 A;  3LSU A;  1LUV A;  1EN5 A;  4FFK A;  3AK2 A;  1WB7 A;  1MA1 A;  1LUW A;  1D5N A;  3EVK A;  1QNM A;  2CE4 A;  4YIO A;  1IXB A;  1XRE A;  2P4K A;  1MSD A;  1AVM A;  4F6E A;  3C3S A;  3AK1 A;  1I08 A;  3K9S A;  1EM1 A;  5A9G A;  1AR4 A;  1IX9 A;  3AK3 A;  1AR5 A;  3DC6 A;  3C3T A;  2ADQ B;  4E4E A;  1ZLZ A;  1AP5 A;  2CDY A;  1SZX A;  1MMM A;  1BSM A;  3KDR A;  2AW9 A;  1EN6 A;  5AG2 A;  1GN3 A;  3TJT A;  3CEI A;  3QVN A;  1I0H A;  1WB8 A;  2RCV A;  3KKY A;  3RN4 A;  3MDS A;  4C7U A;  1B06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...