1PM9A

Crystal structure of human mnsod h30n, y166f mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Amino acid substitution at the dimeric interface of human manganese superoxide dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 75
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1pm9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1pm9A02
1LUWA 1ZTEA 1GN6A 1GN2A 1IX9A 1I08A 1XILA 2CE4A 3BFRA 1WB7A 4JZGA 1SZXA 3DC5A 1B06A 1LUVA 1QNMA 4E4EA 4JZ2A 1JA8A 3AK2A 3QVNA 2ADPA 2ADQB 1MSDA 1ZSPA 3KKYA 3AK1A 5A9GA 1VARA 1XREA 3TJTA 1AP5A 4C7UA 3RN4A 1AR4A 1XDCA 1KKCA 2AW9A 4F6EA 1PM9A 4YIOA 2QKCA 3MDSA 1N0NA 1BS3A 1XUQA 5AG2A 1BSMA 1AR5A 1WB8A 1AP6A 2GDSA 1MNGA 1PL4A 1D5NA 3C3SA 2CDYA 1GN3A 1EM1A 3DC6A 3EVKA 1ZLZA 3AK3A 1MA1A 4GUNA 4YIPA 1AVMA 1EN5A 1MMMA 4JYYA 1N0JA 4X9QA 1I0HA 1ZUQA 3OT7A 1EN6A 1GN4A 4BR6A 1VEWA 1BT8A 3IC9A 3C3TA 1IDSA 3K9SA 2P4KA 1P7GA 2RCVA 1IXBA 1EN4A 4FFKA 2QKAA 1Y67A 3LSUA 1JR9A 3CEIA
chains in the Genus database with same CATH superfamily
3ABKC 1MOFA 1T5EA 3F7YC 2BTQB 4XDJA 1ZTEA 2UU9O 4NXNO 2EIKB 3OR7C 3BHPA 1N32B 2CE4A 2ZXWC 2UUAO 4UB6Z 1JVMA 2YEVB 3KZIZ 1K4DC 1WB7A 1AJQA 3Q4HB 4HYOA 4JI3O 1WP8A 4HNAA 4ZHQB 2Y4TA 4LF4B 4OXSA 4WBNB 2GTSA 5BMVA 2FTKA 3GVMA 2XAQA 1QBZA 4JTDB 1M5IA 2PF4E 4E4EA 1Y4MA 4CS2A 2RJZA 4ZIBA 3AK2A 3LNMB 3ASNB 5JQGA 4DV6O 2FKXA 5IWAB 2QWQB 1HNZO 1R3JC 4D7SA 4JV5O 5E79Z 2IM9A 4DUYB 5EC2C 2OCCC 5GTIZ 1Z2GA 1XMOB 1N0NA 4MTOA 3RYHB 1XUQA 4NVPA 5IYZB 2BSKA 4DXWA 2W0XA 1SA0A 4MVRA 2N04A 3D3IA 1QR8A 1L0LH 3ZCCA 4YY3B 3CCQV 5LMUO 2ATKC 3BRCA 4I9QA 2VQFB 3RYCB 5H9CA 2HKOA 3D3QA 1Q7YW 3A0HZ 5L3EA 3IC7A 4CZZA 1K3EA 3ZHSA 3JATB 2Q9LA 3ETDA 1MSWD 4FFKA 5B1BC 2CK3G 3N2GB 2JK5C 2ZDIC 5KHIA 5KHJA 4J9YB 5EIBD 1W0KG 1I08A 1GN2A 1HDJA 1XHZA 1X59A 3APQA 3ZHUA 4EKWA 2XAHA 1D5AA 1J5EO 3BFRA 1PP9H 3T1CA 4LFBO 1OCOC 4GKKB 4P9OA 4YXWG 2HP8A 2BTQA 3VBBA 3DC5A 2WLIA 1GM7A 1HNXB 3E2EA 2M6YA 1F23A 2WA3A 2YEVA 1GRJA 1W2BU 3Q4HA 2WLLB 4JI1O 4UCTA 5L3CA 3JALB 2ADPA 4J9ZB 4LF7O 4WBNA 1AR1B 5KUKA 2Q7EA 2XTAA 4FMTA 1H8HG 3KDRA 4J7JA 2GSMB 5FPOA 3OW2U 1F7YA 5FNVB 3ZS8C 1KKCA 4TUYB 4GZRB 2E75B 3MD0A 5C93A 1Y74A 1FFTB 2WSSG 4AQYO 2RQ6A 1FOUA 1PPJH 3CHXA 1BHAA 1EZVH 2Y69B 3JD3A 5BXZA 4X65O 4FFBB 3T1YO 3AG7A 3L71H 1Q82W 2XUMA 5ITZB 1R3LC 3H1HH 1NQTA 3STLC 3OTOB 1R3IC 3K57A 2HR3A 1PV0A 2UXDB 3EVKA 3IAYA 1VQ7V 2N74A 1AVMA 4P30A 1E1RG 4JYYA 2CGNA 3N2KB 1XNRB 3J7AU 4DR7O 4WCEV 2PYLA 3RGBA 2DJVA 1AI6A 3FAVB 3HKDB 1I94O 5LXTB 1IXBA 2MW2B 3BVOA 1ZL8B 4I55B 3DXRA 1OCCC 4GX5A 3K08A 5B3SC 4DR2B 4LFAO 2HHHB 1LNQA 1NU1H 3JATA 2Q8VA 3WU2Z 2ZE5A 2F4VO 5EZYA 4O2BB 3THOA 2EILC 1WA8B 4QE7A 3ABLC 1LUVA 1M4UA 4X66B 1AJNA 4K8XA 1NI8A 2YXHA 3QG5A 1OJHA 3AG3C 3E8BA 4O4LB 1VF5B 2EIJC 2F43G 2OYQA 2Q5ZA 2CTPA 4CH3A 1VARA 4QPKA 3T1HO 4RAIA 3SJQC 3DSQA 1AP5A 2ZR2A 3LDDA 3P30A 1KU9A 1Q6HA 1AR4A 1XDCA 4JI7B 4DV7B 2PI5A 2ITCC 2QM7A 4X20B 4LP8A 5IJ0A 1BS3A 4A5UB 3G4SV 4MVMA 2OTLV 4JI4O 4JI8O 3WB0A 4GX0A 3H01A 4LF5B 4TUYA 2VWKA 4O4HB 3CCRV 4JI6O 1K34A 1EM1A 3ABMC 3FB5C 4EB6B 2WLKA 1Q3EA 2QM4A 4IHJA 4DRXB 4B3RB 2IJJA 4UB8Z 3LDEA 5GTHZ 4FFBA 1URFA 3QNEA 5ITZA 1SKVA 1UFIA 2EIKC 4W4KA 1GK9A 1IDSA 2V7QG 2UXBB 5KUMA 1BCCH 1RP3B 2PY5A 4KFMA 4E2LA 3ZRWB 3B8MA 2X7RB 2R9AA 2HEPA 2DYRB 1N32O 2VS0A 2YXLA 1ZAUA 1H2GA 5H6QA 4CC5A 4U3JB 3ZN0A 4TT3G 5LXTA 2UXXA 4YJ3B 2E5LB 4O2AB 5B5EZ 1M1KW 1SS3A 2P6JA 5J2TA 4LF4O 1HW7A 4I55A 3SPHA 5BR8B 5CBFA 4WFBV 4UFZA 5JH7A 3ASOB 1P7BA 2KSDA 5A2QN 2H94A 1VF6A 1YDXA 3RVYA 3SJAC 2QWNB 1JA8A 2GHYA 3X2QC 4O2BA 5IWAO 1IZ3A 3JAWB 3CRAA 2P5OA 5A9GA 4DUYO 1SQBH 4D6TH 3OR6C 3B4SA 2HLDG 4X1IB 4O4LA 5LOVA 5EK0A 1XMOO 1H2LA 2Y4UA 3TGUH 3SPCA 2Q69A 1R3KC 2N05A 2P22C 4FLXA 3H1KH 1QVGU 4D7TA 4X1KA 2XOKG 2B1IA 2ZNIA 4PDVA 3B40A 3L70H 1A32A 3UT5B 3E86A 5LP6B 1VQOV 4LH7A 4NXMB 4X20A 3SPIA 1J95A 3BABA 4YY3O 3ABUA 2JJ1G 2CDYA 4DV3B 1FXHA 3K0DA 2QTSA 4QE9A 2YSUB 1MZFA 1OV9A 4ABMA 1OHHG 1Y6XA 1KC8W 4LF9B 4DK0A 1ENVA 2Z0AA 1Y76B 3ZMZA 4LFCB 1BT8A 4X62B 5FLXN 2QWOB 3A2FA 2P4KA 4JAAA 1XL6A 4LWSB 1EN4A 1JOYA 1GM9A 2BCCH 2QKAA 4AI8A 5LHGA 1AILA 1S72V 1JFFB 2H3OA 4JYCA 1VQLV 1IX9A 1LR1A 4NYKA 2CTWA 3JCUZ 5KA6A 2ODMA 1HNXO 4GYCB 3ZHRA 4U3JA 1QNMA 2R9RB 3CSXA 1EBOA 4FVMA 4YJ3A 4O2AA 1SC5B 3O65A 2CH7B 3P3NA 1BGYH 2EJRA 4DV5B 3QVNA 4KXRA 5LGUA 2IU0A 1S3JA 4DV2O 3HB3B 3SYOA 2Y69C 3F5TA 2YDEA 2A0LA 4EEQA 5KHKA 5LYJB 3ZRXA 1JNBA 4Q20A 2OIEA 3JAWA 4RQEA 1WAZA 1EZJA 2F1MA 5IT9N 2ZM6O 3CC7V 1DF4A 2D2CB 5H2FZ 2ZDIA 1QLNA 4LNUA 1R1BA 3PJSK 3OTOO 4BW5A 3LDCA 3OMIB 2UXDO 4NTXA 1ROPA 2IU3A 2WA4A 2HVJC 1F51A 3OUSA 3AK3A 1CXZB 3O9OA 4GUNA 1XNRO 5LP6A 2OWOA 4R7CA 5TISZ 1N34B 1M56B 2KG7B 3RYFB 2X6BA 2ZIMA 1W0JG 5E1AC 3HKCA 2F93B 1JMKC 5KA5A 1P7GA 3W7XA 2Q0OC 5IE9A 3I56V 3LSUA 4DR2O 4U7NA 1AI4A 4JI6B 1YF2A 1IJGA 2QE7G 1S5JA 2LGQA 1XQ8A 2NN4A 4FM1A 1KQSU 1RPRA 3AG1B 3K5MA 1PD3A 3FYEB 1JFFA 2QSAA 2YUAA 2ZNJA 1QHTA 4X66O 2B9ZA 1K5QA 5JWPA 1QR9A 1B06A 1IBKB 2AGAA 4PELA 2W6IG 1E1QG 4I0XB 1UJWB 3ETGA 2UXNA 2ZR3A 5IYDO 1DTOA 3ZJZA 1QQCA 4MSWC 3SR2C 4JI7O 4DV7O 1TA8A 1U97A 2JS3A 4JASA 3E83A 1FYJA 3CCJV 2DQ0A 3CRMA 2B5UA 1M9NA 3TK1A 1YEWA 4QJFB 4LF5O 1JJOA 1WB8A 5JJEB 5CB4B 5LA6B 2JGDB 4QIWF 2QDOA 2GUZB 3D36A 4B3RO 3P3PA 3RW0A 2X6AA 1YCIA 3L73H 3D8CA 2PZSA 1EN5A 3W7SA 2OTJV 4IGGA 4R6ZA 5C8YA 4LF8B 1H2MA 3OE7G 1PKXA 4U3FH 3CJHB 2UXBO 2HJDA 2A9HA 4CH4A 5BY1A 1HR0O 1R6NA 4J42A 4TV9A 1I5XA 2C2AA 3CEIA 3K5LA 5CMUA 1X4TA 2XAFA 2KG7A 4BIUA 4PA3A 2QEXV 2E5LO 3CC2V 1DGSA 1VQNV 1GN6A 4P9PA 2G38A 3LNNA 4DW0A 5BR8O 2BE3A 4ZI7A 1SQQH 1OCRB 3G71V 1K8AW 2WLMA 1YIJV 4I50B 1XMQB 1IVSA 3A0RA 2BTOA 2YIDA 2QJ1A 1BE3H 3WB2A 2GBOA 3QO5A 1KMIZ 1H2KA 3WG7B 4PD4F 4NTYA 1RM1C 3K5OA 3B8NA 3OAAG 4Q6GA 1Y66A 1NTZH 3FX7A 3E8FA 3OGIB 3K9AA 3K58A 4BW9A 2Y48A 1JQ0A 5LP6C 4MVZA 2F23A 4I0XA 1SETA 4MW8A 3RN4A 3JD2A 5B66Z 2ZE8A 1YJWV 5IYBO 2Q0AA 5LMNO 2YI8A 4ZHQA 2IH1C 4NXMO 5KHGA 4LC1A 4WFHA 4B3TB 4DV3O 3TETA 4DV2B 3OFNG 1GN3A 3CCUV 1BQ0A 1FXKB 4LF9O 2F66C 3ZN1A 3K0GA 3QTCA 5LA6A 3OUFA 2JGDA 4LFCO 2JGUA 2A7WA 3OMNB 4X62O 2GUZA 4CC6A 1FJGB 4PDRA 4ZBMA 2UXCB 4NR1A 4Z1VA 2ZM6B 3K9SA 2JS5A 2K9PA 1F4NA 2E76B 4KHPB 2DYSB 1O9HA 3L75H 3RWRD 1V55C 3H1IH 3RYHA 1MZEA 5IYZA 2Q6AA 2YIBA 3CJHA 1EFRG 2DW4A 3JAKB 5EBWC 1YHQV 1K73W 5B1AC 3SYQA 2R72A 1R6TA 3FB7C 1BZKA 2R70A 1L0NH 3OEEG 4JI5B 5BZBA 3AG2C 3A8TA 4DR3O 5K1XA 1XHXA 3OM3B 3VOUA 1WPBA 3RYCA 4DV5O 1VQ8V 1KKDA 1K92A 1IBMB 3HPLC 1YITV 2PUSA 4H44B 3W7WA 3CCMV 1K5SA 3D36C 4IYIA 4I50A 4MVUA 3AK1A 4KP4A 3ABTA 4JAVA 2ZIOA 3N2GA 4Z2WA 1M57B 4IL6Z 3OMAB 1Q5OA 4DUZB 2AXTZ 3SPJA 3ICXA 1YTFB 4FLYA 2P7TC 5K1PA 1D2DA 3GWOA 1RSOB 3ZX6A 3EFFK 4HZ3A 2AHYA 5AG2A 3L72H 3SJCC 2Q68A 4H33A 2Q7GA 5KX5B 3E8GA 1D5NA 4FLVA 3K59A 3KCXA 2WLLA 1AI5A 4LBEC 1ZLZA 3QF7A 1HWYA 3JALA 3ZMVA 4B3SB 2E74B 1N34O 4MVQA 1W59A 1WP7A 4CS4A 1FXVA 1O9GA 2IJKA 1GN4A 3ZHTA 3JSLA 3AG1C 4ZOLB 3C90A 5FNVA 1FXKA 5HFLA 2EIMB 1G8MA 2P4VA 4RUFA 5LL6Y 1KECA 4MS2A 4JI2O 4DR4B 2XAGA 3JASB 2ZXWB 4ZKIA 4FZ1A 4BAYA 5IJ9B 2WPDG 3R65A 3APOA 3ZMSA 1F4MA 1MG1A 4CS3A 4GKJB 1NVPB 4FLZA 4FM0A 3QO7A 1YJNV 5CA1B 3HKEB 1IBKO 2YIBD 4CH6A 5GONB 3IJ4A 1HR0B 2L35A 1BL8A 1NR7A 1V9PA 5D5PA 3N2KA 3H1JH 5EC1C 3FAVA 3BA9A 3G6BA 4X89A 3HKDA 2NLJC 3JSNA 2ADQB 1ZSPA 3CCSV 3CRCA 1ZL8A 1BHBA 3ASNC 2AHZA 2PYJA 2HFEC 3LUTB 3NR7A 3UO2A 3SGIA 2YIAA 4DR6B 1VQ5V 3VQVA 3CP1A 5FPRA 3DGEA 1V54B 4N21A 1NT2B 4PV1B 1WA8A 3P32A 1KP2A 4G27B 4QGPA 4DO2A 2QWRB 3CMAV 4HBNA 3DC6A 4JYBA 2EZPA 2Z3YA 4XBFA 4JPRA 2ETNA 3ETQA 4RUEA 4LF8O 3F7VC 2KKWA 1YZBA 5KX5A 2Q67A 1IXMA 4DR1O 1EN6A 4AILC 1R6KA 5LGTA 3OTFA 3JCZA 4U7OA 2IBZH 3FYIB 4B3MB 4G28B 5LMNB 4K0KB 3JD1A 3SPGA 2RCVA 3RVZA 2XHBA 1DF5A 1OCRC 3ZRSA 5IYCO 3I55V 3CCVV 1CPYA 2MK3A 3L9DA 2OT5A 1K7DA 1N36O 1H2SB 1WLEA 2EJ7A 2F95B 4O4HA 4UXNA 3M99B 5JJNB 3U0ZA 1VQ4V 1Q43A 2PI4A 1KYOF 4EB6A 4JZGA 1XMQO 1S0VA 4TQFA 3W7UA 4FLWA 4FM2A 2ITDC 4DRXA 4GX2A 3CYOA 4XDKA 3T4DA 1AI7A 5L3DA 4UVAA 5CA1A 5CA0B 5GONA 1AJPA 5L3BA 2LJ2A 3K04A 5LHIA 3U10A 3ZRWA 4DV4B 3TJTA 2LO1A 2Y0IA 4K3AA 1S5LZ 4BIZA 4LF6O 4P2ZA 1QU7A 4HAMA 3J81N 1TUBB 3N27A 4IIJB 1M90W 4DR3B 1AROP 2Q7HA 3MDSA 4UV9A 2QR4A 1VQMV 1PNMA 2WLNA 1FXKC 2P06A 3LSSA 4B3TO 1SF9A 3H1LH 2GTAA 1SQPH 1HP8A 5LBQA 3CB2A 1PL0A 4PA9A 2DYSC 4JYAO 5EYPB 4ICGA 2IJHA 3CX5F 1MMMA 4CBCA 4JI0B 1FJGO 2UXCO 3OT7A 4X1IA 4DV1O 2BOCC 3ZHVA 3ZHQA 1WNSA 5B1OA 5L3FA 4KHPO 3FD9A 4RQFA 2XNDG 3CCLV 3KCYA 2LFSA 4J7ZA 2AZ0A 1Q6UA 2OIGA 4L87A 3HR0A 5B3SB 2RNBA 2CTRA 1K4CC 3IGAC 3B09A 1LUWA 4OX9B 3SYCA 3WFVA 5KLVH 3UT5A 4IYHA 1NZ6A 4JI5O 2X0LA 1JPXA 4X8AA 2KB1A 3SJBC 3G6EV 3B2EE 3VQWA 2A3QA 3ABLB 2YC0A 1GH6A 3BY6A 2WLJA 4PI0A 4UVBA 1AB3A 1SZXA 1BQZA 1THZA 5DN6G 3AG3B 1IBMO 2NR5A 1M57C 1HNWB 1IBLB 4GX1A 3FB8C 1Y76A 4PA6A 2KQXA 4JZ2A 5CA3A 5IY5B 4JI2B 1KUQA 1NR1A 2VQEB 2EX3A 5IDJA 3CRRA 4LWSA 2YXYA 1ZWIC 3FB6C 4OPHA 1G6UA 1XOUA 4FJCC 4PDLA 4DUZO 3CS5A 4MW3A 3EHBB 1KD1W 3K79A 4F6EA 1NH2B 2QTOA 3CPWU 4H13B 1Q6IA 1JX9A 2M7WA 2QKCA 3CWBH 1KP3A 3CE2A 3ZBHA 3E89A 4WF9V 3JYCA 3TXSA 1WJZA 1GM8A 1FPOA 1XEQA 1B6QA 3ABMB 4DR5O 4GT1A 4YHHB 2H8PC 4B3SO 2CH7A 2FL4A 1N33B 1FFXB 1XL4A 5CBGA 2EIMC 3I5DA 4EFEA 2WLIB 4JF3A 3TXQA 5LHHA 5LYJA 1H2NA 4DR4O 1R73A 5EYPA 3A0BZ 3FFQA 3J80N 2Q73A 1FS0G 3U11A 3E8HA 3ETEA 2CUGA 3OD4A 1ORQC 3JD4A 4LH6A 2DYRC 5EBLC 4GKJO 1VQ9V 4I4TB 1Y74B 4RWUA 4DR1B 1JJ2U 4IT5A 1GTOA 5D5QA 3RFRA 1S5HC 3T4ZA 4OPAA 1QCEA 3ZEDA 4PI2A 3X2QB 2AZ2A 3S3XA 3ASOC 2WLHA 2XAJA 3RYFA 1FKAO 4BWAA 4TWKA 2ZE6A 2QWPB 5FL7G 1GKFA 1V54C 2RDCA 1N36B 4J80A 4DR6O 1JCHA 4X1YB 2QGNA 4F6RB 4K35A 4NB5A 3CCEV 3W7TA 2JJ2G 3OGCC 4YJ2B 4UV8A 2CGOA 2EBOA 4AHCA 3SYPA 3DXRB 4OGQB 1Z5VA 3FKSG 4B08A 2DMXA 5JVDB 1FD9A 2GDSA 1TVKB 5JCOA 2EULA 2ZQMA 4TSFG 2Q4PA 2Y0PA 5EZYB 1RFYA 2OCHA 4LF6B 3UM7A 4PJ0Z 4YIPA 2ZT9B 1N0JA 1OCZB 4FZ0A 4X9QA 1I0HA 3RBZA 4TV8B 4B3MO 4K0KO 1VMGA 3WB1A 3B77A 1FFXA 3IC9A 1G4YB 3STZC 3E35A 4W4LA 1QLEB 2UUCB 3K3WA 3ML0A 3E22B 2P67A 4DW1A 1YI2V 4JYAB 1YVWA 5CB4A 2JVDA 2EINB 2JEXA 5IJ0B 3G67A 4DV1B 4Z1MG 3BEHA 3AEIA 5EIBC 4FPPA 4FIPC 4I4TA 4UCRA 4J10A 4ASUG 5GW7A 1Q90D 1TAEA 2UUBO 4IHJB 3T2MA 3KKYA 3SYAA 4DV4O 4NKGB 1L1FA 3TCUA 3UKMA 3UQ8A 4X64B 1XREA 2EZOA 4KL1A 1ZX3A 1I7FA 4EFBA 1H38A 4DV0B 1M93A 1PM9A 1XNQO 2DOSA 4X1YA 1COWG 4JTCB 4F6RA 3SDLA 5DECA 2CTQA 3CXHF 2IH3C 4GLXA 1B04A 2CAZC 2LQTA 1KBHA 2XT9A 4YJ2A 4I9WA 4WFAV 5J2TB 3IFXA 2HJFC 4JI0O 2K1EA 2PGGA 5JH7B 3UO3A 5JVDA 1CEZA 2ZE7A 3CXCU 1TVKA 1RPOA 4UCOA 5B1NA 4BR6A 1VEWA 1NH2D 2HVKC 1M56C 1NTMH 1SQFA 3ZIAG 4OX9O 3HKBB 4DR5B 1G1XB 4TV8A 1DK1A 1SZTA 2BOBC 4X88A 3AG4B 4FLUA 5LOVB 1XI1A 2XASA 1NTKH 5EBMC 1XILA 5IY5C 1P84F 2UU9B 2A06H 4NXNB 1VQKV 4X1KB 4JGSA 3CMEV 2UUAB 3E22A 2HG5C 4MTFA 3K03A 3ABKB 1HNWO 1IBLO 4JI3B 4I5SA 3BAAA 2PTMA 2VQEO 1S77D 1YXBA 4GCZA 5KAIZ 2B1GA 5JCOC 4J41A 2ARHA 3S3WA 1H8EG 3F5WC 3K06A 4QPJA 3DTUB 1N4CA 1TGOA 4DV6B 3MHHC 3ZMTA 3JAKA 2W0FC 4QNHB 4UCSA 1HNZB 2A79B 1WPXA 4JV5B 2AW9A 2RMKB 1L8DA 1BSMA 2DN9A 1QVFU 2WAMA 2JDIG 4LR3A 4TOIA 4YHHO 3JD0A 4MTXA 3LSQA 1N33O 4UCUA 3EXAA 1VQ6V 2V1DA 2OCCB 4K8ZA 2DWEC 1NS1A 4UUJC 4PHZA 4F4LA 5L3GA 3PN1A 5LMUB 4MTGA 2V4DA 1ZUQA 1S76D 1OZ0A 3C3TA 4RO2A 5H6RA 1MABG 1WN7A 1SERA 1JR9A 4MT8A 1RSOA 3NXSA 1Q86W 2LW7A 4R50A 3VQXA 2QKSA 5J9PC 1UPGA 3OEHG 5JJJB 3HKBA 1SQXH 2YI9A 1K97A 3K5NA 5B1BB 1K33A 1J5EB 3JARB 4NTWA 4LFBB 4UCVA 1PNLA 3G80A 4LNUB 2RN9A 3UCSC 1U96A 3BCCH 5DM6V 1RM1B 2W6JG 4ZOLA 1VP7A 2LP7A 3GWKC 4MVOA 2FB5A 1SESA 1OCOB 5CN0A 4JI1B 4MVSA 1SQVH 1YJ9V 3WG7C 1FAFA 1Z5WA 4LF7B 3JASA 2FMLA 2ZCEA 3CD6V 1VF7A 4JAUA 5KMGB 4WFGA 2ZINA 1YSCA 4TQDA 3HKCB 2VQFO 4UVCA 1PNKA 5IJ9A 4YIOA 3RT3C 1Q8IA 1N8RW 5J2UB 2JEUA 1GAXA 3HKEA 1OCZC 4AQYB 3VQYA 2UUBB 4DYLA 3RYIB 1SQGA 3C3SA 1US6A 4X65B 3QO8A 4FK5C 3T1YB 2Z5UA 4WFFA 1VIBA 1I5YA 4JTAB 4O4JB 4J11A 4O4IB 5H5NA 1QLEC 5CBHA 4GKKO 3MAQA 4J7KA 2D3OW 1K9MW 4G2KA 1XNQB 3MHSC 3H9VA 4R8CA 2FYUH 4DR7B 2EINC 3JAMN 1V55B 2UUCO 1NJIW 1NBMG 3ZRVA 2O57A 1Y67A 1I94B 5B1AB 4HNAB 2L6LA 4PA4A 1GMGA 2GV9A 4CH5A 2X6CA 1SRYA 5HFMA 5BMVB 2LFRA 3AG2B 4LFAB 1XBLA 1DLBA 3KG2A 1P4RA 1YTFD 2WWWA 3BA8A 2DE0X 1NKDA 1E79G 2VWJA 5JQGB 2F4VB 1IURA 1OCCB 1Q81W 3R66A 4B7KA 2JRIA 5KHHA 2LGWA 2DQ3A 4H0LB 2IJIA 1VQPV 5KAFZ 2R9IA 4LCUC 3JARA 1MSDA 4X64O 2JIZG 2YICA 1TUEB 2ZD9A 1KB9F 1BMFG 2EILB 5C8YB 1H5WA 2BSKB 2QM8A 4C7UA 4DV0O 4L8JA 3T1HB 1SA0B 4I7ZB 1CP9A 4TV9B 4PDMA 2EIJB 5F2VO 2VRZA 4BIOA 2QA4V 2P90A 5LGNA 4XDLA 2LW1A 5DEDA 2ZKOA 1P49A 4H37A 4KUMA 5KMGA 1VF6C 2IW5A 1AR5A 4JI4B 4JI8B 2YS8A 1AP6A 1MNGA 1PL4A 2E3CA 2NNUA 4DK1A 2HHHO 3M8AA 4ZI7B 5J2UA 1B3QA 2DWDC 1NVPD 3L74H 3M7MX 1MA1A 5CA0A 4PA7A 3CRQA 1GO3F 3AG4C 3RYIA 3ZMUA 3CC4V 4B7EA 1TUBA 4IIJA 4O4JA 3GB7C 4O4IA 4WFEA 3BPZA 4N23A 4FLTA 2ILMA
chains in the Genus database with same CATH topology
1LUWA 1ZTEA 1GN6A 1GN2A 1IX9A 1I08A 1XILA 2CE4A 3BFRA 1WB7A 4JZGA 1SZXA 3DC5A 1B06A 1LUVA 1QNMA 4E4EA 4JZ2A 1JA8A 3AK2A 3QVNA 2ADPA 2ADQB 1MSDA 1ZSPA 3KKYA 3AK1A 5A9GA 1VARA 1XREA 3TJTA 3KDRA 1AP5A 4C7UA 3RN4A 1AR4A 1XDCA 1KKCA 2AW9A 4F6EA 1PM9A 4YIOA 2QKCA 3MDSA 1N0NA 1BS3A 1XUQA 5AG2A 1BSMA 1AR5A 1WB8A 1AP6A 2GDSA 1MNGA 1PL4A 1D5NA 3C3SA 2CDYA 1GN3A 1EM1A 3DC6A 3EVKA 1ZLZA 3AK3A 1MA1A 4GUNA 4YIPA 1AVMA 1EN5A 1MMMA 4JYYA 1N0JA 4X9QA 1I0HA 1ZUQA 3OT7A 1EN6A 1GN4A 4BR6A 1VEWA 1BT8A 3IC9A 3C3TA 1IDSA 3K9SA 2P4KA 1P7GA 2RCVA 1IXBA 1EN4A 4FFKA 2QKAA 1Y67A 3LSUA 1JR9A 3CEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LUW A;  1ZTE A;  1GN6 A;  1GN2 A;  1IX9 A;  1I08 A;  1XIL A;  2CE4 A;  3BFR A;  1WB7 A;  4JZG A;  1SZX A;  3DC5 A;  1B06 A;  1LUV A;  1QNM A;  4E4E A;  4JZ2 A;  1JA8 A;  3AK2 A;  3QVN A;  2ADP A;  2ADQ B;  1MSD A;  1ZSP A;  3KKY A;  3AK1 A;  5A9G A;  1VAR A;  1XRE A;  3TJT A;  1AP5 A;  4C7U A;  3RN4 A;  1AR4 A;  1XDC A;  1KKC A;  2AW9 A;  4F6E A;  1PM9 A;  4YIO A;  2QKC A;  3MDS A;  1N0N A;  1BS3 A;  1XUQ A;  5AG2 A;  1BSM A;  1AR5 A;  1WB8 A;  1AP6 A;  2GDS A;  1MNG A;  1PL4 A;  1D5N A;  3C3S A;  2CDY A;  1GN3 A;  1EM1 A;  3DC6 A;  3EVK A;  1ZLZ A;  3AK3 A;  1MA1 A;  4GUN A;  4YIP A;  1AVM A;  1EN5 A;  1MMM A;  4JYY A;  1N0J A;  4X9Q A;  1I0H A;  1ZUQ A;  3OT7 A;  1EN6 A;  1GN4 A;  4BR6 A;  1VEW A;  1BT8 A;  3IC9 A;  3C3T A;  1IDS A;  3K9S A;  2P4K A;  1P7G A;  2RCV A;  1IXB A;  1EN4 A;  4FFK A;  2QKA A;  1Y67 A;  3LSU A;  1JR9 A;  3CEI A; 
#chains in the Genus database with same CATH topology
 3ABK C;  1MOF A;  1T5E A;  3F7Y C;  2BTQ B;  4XDJ A;  1ZTE A;  2UU9 O;  4NXN O;  2EIK B;  3OR7 C;  3BHP A;  1N32 B;  2CE4 A;  2ZXW C;  2UUA O;  4UB6 Z;  1JVM A;  2YEV B;  3KZI Z;  1K4D C;  1WB7 A;  1AJQ A;  3Q4H B;  4HYO A;  4JI3 O;  1WP8 A;  4HNA A;  4ZHQ B;  2Y4T A;  4LF4 B;  4OXS A;  4WBN B;  2GTS A;  5BMV A;  2FTK A;  3GVM A;  2XAQ A;  1QBZ A;  4JTD B;  1M5I A;  2PF4 E;  4E4E A;  1Y4M A;  4CS2 A;  2RJZ A;  4ZIB A;  3AK2 A;  3LNM B;  3ASN B;  5JQG A;  4DV6 O;  2FKX A;  5IWA B;  2QWQ B;  1HNZ O;  1R3J C;  4D7S A;  4JV5 O;  5E79 Z;  2IM9 A;  4DUY B;  5EC2 C;  2OCC C;  5GTI Z;  1Z2G A;  1XMO B;  1N0N A;  4MTO A;  3RYH B;  1XUQ A;  4NVP A;  5IYZ B;  2BSK A;  4DXW A;  2W0X A;  1SA0 A;  4MVR A;  2N04 A;  3D3I A;  1QR8 A;  1L0L H;  3ZCC A;  4YY3 B;  3CCQ V;  5LMU O;  2ATK C;  3BRC A;  4I9Q A;  2VQF B;  3RYC B;  5H9C A;  2HKO A;  3D3Q A;  1Q7Y W;  3A0H Z;  5L3E A;  3IC7 A;  4CZZ A;  1K3E A;  3ZHS A;  3JAT B;  2Q9L A;  3ETD A;  1MSW D;  4FFK A;  5B1B C;  2CK3 G;  3N2G B;  2JK5 C;  2ZDI C;  5KHI A;  5KHJ A;  4J9Y B;  5EIB D;  1W0K G;  1I08 A;  1GN2 A;  1HDJ A;  1XHZ A;  1X59 A;  3APQ A;  3ZHU A;  4EKW A;  2XAH A;  1D5A A;  1J5E O;  3BFR A;  1PP9 H;  3T1C A;  4LFB O;  1OCO C;  4GKK B;  4P9O A;  4YXW G;  2HP8 A;  2BTQ A;  3VBB A;  3DC5 A;  2WLI A;  1GM7 A;  1HNX B;  3E2E A;  2M6Y A;  1F23 A;  2WA3 A;  2YEV A;  1GRJ A;  1W2B U;  3Q4H A;  2WLL B;  4JI1 O;  4UCT A;  5L3C A;  3JAL B;  2ADP A;  4J9Z B;  4LF7 O;  4WBN A;  1AR1 B;  5KUK A;  2Q7E A;  2XTA A;  4FMT A;  1H8H G;  3KDR A;  4J7J A;  2GSM B;  5FPO A;  3OW2 U;  1F7Y A;  5FNV B;  3ZS8 C;  1KKC A;  4TUY B;  4GZR B;  2E75 B;  3MD0 A;  5C93 A;  1Y74 A;  1FFT B;  2WSS G;  4AQY O;  2RQ6 A;  1FOU A;  1PPJ H;  3CHX A;  1BHA A;  1EZV H;  2Y69 B;  3JD3 A;  5BXZ A;  4X65 O;  4FFB B;  3T1Y O;  3AG7 A;  3L71 H;  1Q82 W;  2XUM A;  5ITZ B;  1R3L C;  3H1H H;  1NQT A;  3STL C;  3OTO B;  1R3I C;  3K57 A;  2HR3 A;  1PV0 A;  2UXD B;  3EVK A;  3IAY A;  1VQ7 V;  2N74 A;  1AVM A;  4P30 A;  1E1R G;  4JYY A;  2CGN A;  3N2K B;  1XNR B;  3J7A U;  4DR7 O;  4WCE V;  2PYL A;  3RGB A;  2DJV A;  1AI6 A;  3FAV B;  3HKD B;  1I94 O;  5LXT B;  1IXB A;  2MW2 B;  3BVO A;  1ZL8 B;  4I55 B;  3DXR A;  1OCC C;  4GX5 A;  3K08 A;  5B3S C;  4DR2 B;  4LFA O;  2HHH B;  1LNQ A;  1NU1 H;  3JAT A;  2Q8V A;  3WU2 Z;  2ZE5 A;  2F4V O;  5EZY A;  4O2B B;  3THO A;  2EIL C;  1WA8 B;  4QE7 A;  3ABL C;  1LUV A;  1M4U A;  4X66 B;  1AJN A;  4K8X A;  1NI8 A;  2YXH A;  3QG5 A;  1OJH A;  3AG3 C;  3E8B A;  4O4L B;  1VF5 B;  2EIJ C;  2F43 G;  2OYQ A;  2Q5Z A;  2CTP A;  4CH3 A;  1VAR A;  4QPK A;  3T1H O;  4RAI A;  3SJQ C;  3DSQ A;  1AP5 A;  2ZR2 A;  3LDD A;  3P30 A;  1KU9 A;  1Q6H A;  1AR4 A;  1XDC A;  4JI7 B;  4DV7 B;  2PI5 A;  2ITC C;  2QM7 A;  4X20 B;  4LP8 A;  5IJ0 A;  1BS3 A;  4A5U B;  3G4S V;  4MVM A;  2OTL V;  4JI4 O;  4JI8 O;  3WB0 A;  4GX0 A;  3H01 A;  4LF5 B;  4TUY A;  2VWK A;  4O4H B;  3CCR V;  4JI6 O;  1K34 A;  1EM1 A;  3ABM C;  3FB5 C;  4EB6 B;  2WLK A;  1Q3E A;  2QM4 A;  4IHJ A;  4DRX B;  4B3R B;  2IJJ A;  4UB8 Z;  3LDE A;  5GTH Z;  4FFB A;  1URF A;  3QNE A;  5ITZ A;  1SKV A;  1UFI A;  2EIK C;  4W4K A;  1GK9 A;  1IDS A;  2V7Q G;  2UXB B;  5KUM A;  1BCC H;  1RP3 B;  2PY5 A;  4KFM A;  4E2L A;  3ZRW B;  3B8M A;  2X7R B;  2R9A A;  2HEP A;  2DYR B;  1N32 O;  2VS0 A;  2YXL A;  1ZAU A;  1H2G A;  5H6Q A;  4CC5 A;  4U3J B;  3ZN0 A;  4TT3 G;  5LXT A;  2UXX A;  4YJ3 B;  2E5L B;  4O2A B;  5B5E Z;  1M1K W;  1SS3 A;  2P6J A;  5J2T A;  4LF4 O;  1HW7 A;  4I55 A;  3SPH A;  5BR8 B;  5CBF A;  4WFB V;  4UFZ A;  5JH7 A;  3ASO B;  1P7B A;  2KSD A;  5A2Q N;  2H94 A;  1VF6 A;  1YDX A;  3RVY A;  3SJA C;  2QWN B;  1JA8 A;  2GHY A;  3X2Q C;  4O2B A;  5IWA O;  1IZ3 A;  3JAW B;  3CRA A;  2P5O A;  5A9G A;  4DUY O;  1SQB H;  4D6T H;  3OR6 C;  3B4S A;  2HLD G;  4X1I B;  4O4L A;  5LOV A;  5EK0 A;  1XMO O;  1H2L A;  2Y4U A;  3TGU H;  3SPC A;  2Q69 A;  1R3K C;  2N05 A;  2P22 C;  4FLX A;  3H1K H;  1QVG U;  4D7T A;  4X1K A;  2XOK G;  2B1I A;  2ZNI A;  4PDV A;  3B40 A;  3L70 H;  1A32 A;  3UT5 B;  3E86 A;  5LP6 B;  1VQO V;  4LH7 A;  4NXM B;  4X20 A;  3SPI A;  1J95 A;  3BAB A;  4YY3 O;  3ABU A;  2JJ1 G;  2CDY A;  4DV3 B;  1FXH A;  3K0D A;  2QTS A;  4QE9 A;  2YSU B;  1MZF A;  1OV9 A;  4ABM A;  1OHH G;  1Y6X A;  1KC8 W;  4LF9 B;  4DK0 A;  1ENV A;  2Z0A A;  1Y76 B;  3ZMZ A;  4LFC B;  1BT8 A;  4X62 B;  5FLX N;  2QWO B;  3A2F A;  2P4K A;  4JAA A;  1XL6 A;  4LWS B;  1EN4 A;  1JOY A;  1GM9 A;  2BCC H;  2QKA A;  4AI8 A;  5LHG A;  1AIL A;  1S72 V;  1JFF B;  2H3O A;  4JYC A;  1VQL V;  1IX9 A;  1LR1 A;  4NYK A;  2CTW A;  3JCU Z;  5KA6 A;  2ODM A;  1HNX O;  4GYC B;  3ZHR A;  4U3J A;  1QNM A;  2R9R B;  3CSX A;  1EBO A;  4FVM A;  4YJ3 A;  4O2A A;  1SC5 B;  3O65 A;  2CH7 B;  3P3N A;  1BGY H;  2EJR A;  4DV5 B;  3QVN A;  4KXR A;  5LGU A;  2IU0 A;  1S3J A;  4DV2 O;  3HB3 B;  3SYO A;  2Y69 C;  3F5T A;  2YDE A;  2A0L A;  4EEQ A;  5KHK A;  5LYJ B;  3ZRX A;  1JNB A;  4Q20 A;  2OIE A;  3JAW A;  4RQE A;  1WAZ A;  1EZJ A;  2F1M A;  5IT9 N;  2ZM6 O;  3CC7 V;  1DF4 A;  2D2C B;  5H2F Z;  2ZDI A;  1QLN A;  4LNU A;  1R1B A;  3PJS K;  3OTO O;  4BW5 A;  3LDC A;  3OMI B;  2UXD O;  4NTX A;  1ROP A;  2IU3 A;  2WA4 A;  2HVJ C;  1F51 A;  3OUS A;  3AK3 A;  1CXZ B;  3O9O A;  4GUN A;  1XNR O;  5LP6 A;  2OWO A;  4R7C A;  5TIS Z;  1N34 B;  1M56 B;  2KG7 B;  3RYF B;  2X6B A;  2ZIM A;  1W0J G;  5E1A C;  3HKC A;  2F93 B;  1JMK C;  5KA5 A;  1P7G A;  3W7X A;  2Q0O C;  5IE9 A;  3I56 V;  3LSU A;  4DR2 O;  4U7N A;  1AI4 A;  4JI6 B;  1YF2 A;  1IJG A;  2QE7 G;  1S5J A;  2LGQ A;  1XQ8 A;  2NN4 A;  4FM1 A;  1KQS U;  1RPR A;  3AG1 B;  3K5M A;  1PD3 A;  3FYE B;  1JFF A;  2QSA A;  2YUA A;  2ZNJ A;  1QHT A;  4X66 O;  2B9Z A;  1K5Q A;  5JWP A;  1QR9 A;  1B06 A;  1IBK B;  2AGA A;  4PEL A;  2W6I G;  1E1Q G;  4I0X B;  1UJW B;  3ETG A;  2UXN A;  2ZR3 A;  5IYD O;  1DTO A;  3ZJZ A;  1QQC A;  4MSW C;  3SR2 C;  4JI7 O;  4DV7 O;  1TA8 A;  1U97 A;  2JS3 A;  4JAS A;  3E83 A;  1FYJ A;  3CCJ V;  2DQ0 A;  3CRM A;  2B5U A;  1M9N A;  3TK1 A;  1YEW A;  4QJF B;  4LF5 O;  1JJO A;  1WB8 A;  5JJE B;  5CB4 B;  5LA6 B;  2JGD B;  4QIW F;  2QDO A;  2GUZ B;  3D36 A;  4B3R O;  3P3P A;  3RW0 A;  2X6A A;  1YCI A;  3L73 H;  3D8C A;  2PZS A;  1EN5 A;  3W7S A;  2OTJ V;  4IGG A;  4R6Z A;  5C8Y A;  4LF8 B;  1H2M A;  3OE7 G;  1PKX A;  4U3F H;  3CJH B;  2UXB O;  2HJD A;  2A9H A;  4CH4 A;  5BY1 A;  1HR0 O;  1R6N A;  4J42 A;  4TV9 A;  1I5X A;  2C2A A;  3CEI A;  3K5L A;  5CMU A;  1X4T A;  2XAF A;  2KG7 A;  4BIU A;  4PA3 A;  2QEX V;  2E5L O;  3CC2 V;  1DGS A;  1VQN V;  1GN6 A;  4P9P A;  2G38 A;  3LNN A;  4DW0 A;  5BR8 O;  2BE3 A;  4ZI7 A;  1SQQ H;  1OCR B;  3G71 V;  1K8A W;  2WLM A;  1YIJ V;  4I50 B;  1XMQ B;  1IVS A;  3A0R A;  2BTO A;  2YID A;  2QJ1 A;  1BE3 H;  3WB2 A;  2GBO A;  3QO5 A;  1KMI Z;  1H2K A;  3WG7 B;  4PD4 F;  4NTY A;  1RM1 C;  3K5O A;  3B8N A;  3OAA G;  4Q6G A;  1Y66 A;  1NTZ H;  3FX7 A;  3E8F A;  3OGI B;  3K9A A;  3K58 A;  4BW9 A;  2Y48 A;  1JQ0 A;  5LP6 C;  4MVZ A;  2F23 A;  4I0X A;  1SET A;  4MW8 A;  3RN4 A;  3JD2 A;  5B66 Z;  2ZE8 A;  1YJW V;  5IYB O;  2Q0A A;  5LMN O;  2YI8 A;  4ZHQ A;  2IH1 C;  4NXM O;  5KHG A;  4LC1 A;  4WFH A;  4B3T B;  4DV3 O;  3TET A;  4DV2 B;  3OFN G;  1GN3 A;  3CCU V;  1BQ0 A;  1FXK B;  4LF9 O;  2F66 C;  3ZN1 A;  3K0G A;  3QTC A;  5LA6 A;  3OUF A;  2JGD A;  4LFC O;  2JGU A;  2A7W A;  3OMN B;  4X62 O;  2GUZ A;  4CC6 A;  1FJG B;  4PDR A;  4ZBM A;  2UXC B;  4NR1 A;  4Z1V A;  2ZM6 B;  3K9S A;  2JS5 A;  2K9P A;  1F4N A;  2E76 B;  4KHP B;  2DYS B;  1O9H A;  3L75 H;  3RWR D;  1V55 C;  3H1I H;  3RYH A;  1MZE A;  5IYZ A;  2Q6A A;  2YIB A;  3CJH A;  1EFR G;  2DW4 A;  3JAK B;  5EBW C;  1YHQ V;  1K73 W;  5B1A C;  3SYQ A;  2R72 A;  1R6T A;  3FB7 C;  1BZK A;  2R70 A;  1L0N H;  3OEE G;  4JI5 B;  5BZB A;  3AG2 C;  3A8T A;  4DR3 O;  5K1X A;  1XHX A;  3OM3 B;  3VOU A;  1WPB A;  3RYC A;  4DV5 O;  1VQ8 V;  1KKD A;  1K92 A;  1IBM B;  3HPL C;  1YIT V;  2PUS A;  4H44 B;  3W7W A;  3CCM V;  1K5S A;  3D36 C;  4IYI A;  4I50 A;  4MVU A;  3AK1 A;  4KP4 A;  3ABT A;  4JAV A;  2ZIO A;  3N2G A;  4Z2W A;  1M57 B;  4IL6 Z;  3OMA B;  1Q5O A;  4DUZ B;  2AXT Z;  3SPJ A;  3ICX A;  1YTF B;  4FLY A;  2P7T C;  5K1P A;  1D2D A;  3GWO A;  1RSO B;  3ZX6 A;  3EFF K;  4HZ3 A;  2AHY A;  5AG2 A;  3L72 H;  3SJC C;  2Q68 A;  4H33 A;  2Q7G A;  5KX5 B;  3E8G A;  1D5N A;  4FLV A;  3K59 A;  3KCX A;  2WLL A;  1AI5 A;  4LBE C;  1ZLZ A;  3QF7 A;  1HWY A;  3JAL A;  3ZMV A;  4B3S B;  2E74 B;  1N34 O;  4MVQ A;  1W59 A;  1WP7 A;  4CS4 A;  1FXV A;  1O9G A;  2IJK A;  1GN4 A;  3ZHT A;  3JSL A;  3AG1 C;  4ZOL B;  3C90 A;  5FNV A;  1FXK A;  5HFL A;  2EIM B;  1G8M A;  2P4V A;  4RUF A;  5LL6 Y;  1KEC A;  4MS2 A;  4JI2 O;  4DR4 B;  2XAG A;  3JAS B;  2ZXW B;  4ZKI A;  4FZ1 A;  4BAY A;  5IJ9 B;  2WPD G;  3R65 A;  3APO A;  3ZMS A;  1F4M A;  1MG1 A;  4CS3 A;  4GKJ B;  1NVP B;  4FLZ A;  4FM0 A;  3QO7 A;  1YJN V;  5CA1 B;  3HKE B;  1IBK O;  2YIB D;  4CH6 A;  5GON B;  3IJ4 A;  1HR0 B;  2L35 A;  1BL8 A;  1NR7 A;  1V9P A;  5D5P A;  3N2K A;  3H1J H;  5EC1 C;  3FAV A;  3BA9 A;  3G6B A;  4X89 A;  3HKD A;  2NLJ C;  3JSN A;  2ADQ B;  1ZSP A;  3CCS V;  3CRC A;  1ZL8 A;  1BHB A;  3ASN C;  2AHZ A;  2PYJ A;  2HFE C;  3LUT B;  3NR7 A;  3UO2 A;  3SGI A;  2YIA A;  4DR6 B;  1VQ5 V;  3VQV A;  3CP1 A;  5FPR A;  3DGE A;  1V54 B;  4N21 A;  1NT2 B;  4PV1 B;  1WA8 A;  3P32 A;  1KP2 A;  4G27 B;  4QGP A;  4DO2 A;  2QWR B;  3CMA V;  4HBN A;  3DC6 A;  4JYB A;  2EZP A;  2Z3Y A;  4XBF A;  4JPR A;  2ETN A;  3ETQ A;  4RUE A;  4LF8 O;  3F7V C;  2KKW A;  1YZB A;  5KX5 A;  2Q67 A;  1IXM A;  4DR1 O;  1EN6 A;  4AIL C;  1R6K A;  5LGT A;  3OTF A;  3JCZ A;  4U7O A;  2IBZ H;  3FYI B;  4B3M B;  4G28 B;  5LMN B;  4K0K B;  3JD1 A;  3SPG A;  2RCV A;  3RVZ A;  2XHB A;  1DF5 A;  1OCR C;  3ZRS A;  5IYC O;  3I55 V;  3CCV V;  1CPY A;  2MK3 A;  3L9D A;  2OT5 A;  1K7D A;  1N36 O;  1H2S B;  1WLE A;  2EJ7 A;  2F95 B;  4O4H A;  4UXN A;  3M99 B;  5JJN B;  3U0Z A;  1VQ4 V;  1Q43 A;  2PI4 A;  1KYO F;  4EB6 A;  4JZG A;  1XMQ O;  1S0V A;  4TQF A;  3W7U A;  4FLW A;  4FM2 A;  2ITD C;  4DRX A;  4GX2 A;  3CYO A;  4XDK A;  3T4D A;  1AI7 A;  5L3D A;  4UVA A;  5CA1 A;  5CA0 B;  5GON A;  1AJP A;  5L3B A;  2LJ2 A;  3K04 A;  5LHI A;  3U10 A;  3ZRW A;  4DV4 B;  3TJT A;  2LO1 A;  2Y0I A;  4K3A A;  1S5L Z;  4BIZ A;  4LF6 O;  4P2Z A;  1QU7 A;  4HAM A;  3J81 N;  1TUB B;  3N27 A;  4IIJ B;  1M90 W;  4DR3 B;  1ARO P;  2Q7H A;  3MDS A;  4UV9 A;  2QR4 A;  1VQM V;  1PNM A;  2WLN A;  1FXK C;  2P06 A;  3LSS A;  4B3T O;  1SF9 A;  3H1L H;  2GTA A;  1SQP H;  1HP8 A;  5LBQ A;  3CB2 A;  1PL0 A;  4PA9 A;  2DYS C;  4JYA O;  5EYP B;  4ICG A;  2IJH A;  3CX5 F;  1MMM A;  4CBC A;  4JI0 B;  1FJG O;  2UXC O;  3OT7 A;  4X1I A;  4DV1 O;  2BOC C;  3ZHV A;  3ZHQ A;  1WNS A;  5B1O A;  5L3F A;  4KHP O;  3FD9 A;  4RQF A;  2XND G;  3CCL V;  3KCY A;  2LFS A;  4J7Z A;  2AZ0 A;  1Q6U A;  2OIG A;  4L87 A;  3HR0 A;  5B3S B;  2RNB A;  2CTR A;  1K4C C;  3IGA C;  3B09 A;  1LUW A;  4OX9 B;  3SYC A;  3WFV A;  5KLV H;  3UT5 A;  4IYH A;  1NZ6 A;  4JI5 O;  2X0L A;  1JPX A;  4X8A A;  2KB1 A;  3SJB C;  3G6E V;  3B2E E;  3VQW A;  2A3Q A;  3ABL B;  2YC0 A;  1GH6 A;  3BY6 A;  2WLJ A;  4PI0 A;  4UVB A;  1AB3 A;  1SZX A;  1BQZ A;  1THZ A;  5DN6 G;  3AG3 B;  1IBM O;  2NR5 A;  1M57 C;  1HNW B;  1IBL B;  4GX1 A;  3FB8 C;  1Y76 A;  4PA6 A;  2KQX A;  4JZ2 A;  5CA3 A;  5IY5 B;  4JI2 B;  1KUQ A;  1NR1 A;  2VQE B;  2EX3 A;  5IDJ A;  3CRR A;  4LWS A;  2YXY A;  1ZWI C;  3FB6 C;  4OPH A;  1G6U A;  1XOU A;  4FJC C;  4PDL A;  4DUZ O;  3CS5 A;  4MW3 A;  3EHB B;  1KD1 W;  3K79 A;  4F6E A;  1NH2 B;  2QTO A;  3CPW U;  4H13 B;  1Q6I A;  1JX9 A;  2M7W A;  2QKC A;  3CWB H;  1KP3 A;  3CE2 A;  3ZBH A;  3E89 A;  4WF9 V;  3JYC A;  3TXS A;  1WJZ A;  1GM8 A;  1FPO A;  1XEQ A;  1B6Q A;  3ABM B;  4DR5 O;  4GT1 A;  4YHH B;  2H8P C;  4B3S O;  2CH7 A;  2FL4 A;  1N33 B;  1FFX B;  1XL4 A;  5CBG A;  2EIM C;  3I5D A;  4EFE A;  2WLI B;  4JF3 A;  3TXQ A;  5LHH A;  5LYJ A;  1H2N A;  4DR4 O;  1R73 A;  5EYP A;  3A0B Z;  3FFQ A;  3J80 N;  2Q73 A;  1FS0 G;  3U11 A;  3E8H A;  3ETE A;  2CUG A;  3OD4 A;  1ORQ C;  3JD4 A;  4LH6 A;  2DYR C;  5EBL C;  4GKJ O;  1VQ9 V;  4I4T B;  1Y74 B;  4RWU A;  4DR1 B;  1JJ2 U;  4IT5 A;  1GTO A;  5D5Q A;  3RFR A;  1S5H C;  3T4Z A;  4OPA A;  1QCE A;  3ZED A;  4PI2 A;  3X2Q B;  2AZ2 A;  3S3X A;  3ASO C;  2WLH A;  2XAJ A;  3RYF A;  1FKA O;  4BWA A;  4TWK A;  2ZE6 A;  2QWP B;  5FL7 G;  1GKF A;  1V54 C;  2RDC A;  1N36 B;  4J80 A;  4DR6 O;  1JCH A;  4X1Y B;  2QGN A;  4F6R B;  4K35 A;  4NB5 A;  3CCE V;  3W7T A;  2JJ2 G;  3OGC C;  4YJ2 B;  4UV8 A;  2CGO A;  2EBO A;  4AHC A;  3SYP A;  3DXR B;  4OGQ B;  1Z5V A;  3FKS G;  4B08 A;  2DMX A;  5JVD B;  1FD9 A;  2GDS A;  1TVK B;  5JCO A;  2EUL A;  2ZQM A;  4TSF G;  2Q4P A;  2Y0P A;  5EZY B;  1RFY A;  2OCH A;  4LF6 B;  3UM7 A;  4PJ0 Z;  4YIP A;  2ZT9 B;  1N0J A;  1OCZ B;  4FZ0 A;  4X9Q A;  1I0H A;  3RBZ A;  4TV8 B;  4B3M O;  4K0K O;  1VMG A;  3WB1 A;  3B77 A;  1FFX A;  3IC9 A;  1G4Y B;  3STZ C;  3E35 A;  4W4L A;  1QLE B;  2UUC B;  3K3W A;  3ML0 A;  3E22 B;  2P67 A;  4DW1 A;  1YI2 V;  4JYA B;  1YVW A;  5CB4 A;  2JVD A;  2EIN B;  2JEX A;  5IJ0 B;  3G67 A;  4DV1 B;  4Z1M G;  3BEH A;  3AEI A;  5EIB C;  4FPP A;  4FIP C;  4I4T A;  4UCR A;  4J10 A;  4ASU G;  5GW7 A;  1Q90 D;  1TAE A;  2UUB O;  4IHJ B;  3T2M A;  3KKY A;  3SYA A;  4DV4 O;  4NKG B;  1L1F A;  3TCU A;  3UKM A;  3UQ8 A;  4X64 B;  1XRE A;  2EZO A;  4KL1 A;  1ZX3 A;  1I7F A;  4EFB A;  1H38 A;  4DV0 B;  1M93 A;  1PM9 A;  1XNQ O;  2DOS A;  4X1Y A;  1COW G;  4JTC B;  4F6R A;  3SDL A;  5DEC A;  2CTQ A;  3CXH F;  2IH3 C;  4GLX A;  1B04 A;  2CAZ C;  2LQT A;  1KBH A;  2XT9 A;  4YJ2 A;  4I9W A;  4WFA V;  5J2T B;  3IFX A;  2HJF C;  4JI0 O;  2K1E A;  2PGG A;  5JH7 B;  3UO3 A;  5JVD A;  1CEZ A;  2ZE7 A;  3CXC U;  1TVK A;  1RPO A;  4UCO A;  5B1N A;  4BR6 A;  1VEW A;  1NH2 D;  2HVK C;  1M56 C;  1NTM H;  1SQF A;  3ZIA G;  4OX9 O;  3HKB B;  4DR5 B;  1G1X B;  4TV8 A;  1DK1 A;  1SZT A;  2BOB C;  4X88 A;  3AG4 B;  4FLU A;  5LOV B;  1XI1 A;  2XAS A;  1NTK H;  5EBM C;  1XIL A;  5IY5 C;  1P84 F;  2UU9 B;  2A06 H;  4NXN B;  1VQK V;  4X1K B;  4JGS A;  3CME V;  2UUA B;  3E22 A;  2HG5 C;  4MTF A;  3K03 A;  3ABK B;  1HNW O;  1IBL O;  4JI3 B;  4I5S A;  3BAA A;  2PTM A;  2VQE O;  1S77 D;  1YXB A;  4GCZ A;  5KAI Z;  2B1G A;  5JCO C;  4J41 A;  2ARH A;  3S3W A;  1H8E G;  3F5W C;  3K06 A;  4QPJ A;  3DTU B;  1N4C A;  1TGO A;  4DV6 B;  3MHH C;  3ZMT A;  3JAK A;  2W0F C;  4QNH B;  4UCS A;  1HNZ B;  2A79 B;  1WPX A;  4JV5 B;  2AW9 A;  2RMK B;  1L8D A;  1BSM A;  2DN9 A;  1QVF U;  2WAM A;  2JDI G;  4LR3 A;  4TOI A;  4YHH O;  3JD0 A;  4MTX A;  3LSQ A;  1N33 O;  4UCU A;  3EXA A;  1VQ6 V;  2V1D A;  2OCC B;  4K8Z A;  2DWE C;  1NS1 A;  4UUJ C;  4PHZ A;  4F4L A;  5L3G A;  3PN1 A;  5LMU B;  4MTG A;  2V4D A;  1ZUQ A;  1S76 D;  1OZ0 A;  3C3T A;  4RO2 A;  5H6R A;  1MAB G;  1WN7 A;  1SER A;  1JR9 A;  4MT8 A;  1RSO A;  3NXS A;  1Q86 W;  2LW7 A;  4R50 A;  3VQX A;  2QKS A;  5J9P C;  1UPG A;  3OEH G;  5JJJ B;  3HKB A;  1SQX H;  2YI9 A;  1K97 A;  3K5N A;  5B1B B;  1K33 A;  1J5E B;  3JAR B;  4NTW A;  4LFB B;  4UCV A;  1PNL A;  3G80 A;  4LNU B;  2RN9 A;  3UCS C;  1U96 A;  3BCC H;  5DM6 V;  1RM1 B;  2W6J G;  4ZOL A;  1VP7 A;  2LP7 A;  3GWK C;  4MVO A;  2FB5 A;  1SES A;  1OCO B;  5CN0 A;  4JI1 B;  4MVS A;  1SQV H;  1YJ9 V;  3WG7 C;  1FAF A;  1Z5W A;  4LF7 B;  3JAS A;  2FML A;  2ZCE A;  3CD6 V;  1VF7 A;  4JAU A;  5KMG B;  4WFG A;  2ZIN A;  1YSC A;  4TQD A;  3HKC B;  2VQF O;  4UVC A;  1PNK A;  5IJ9 A;  4YIO A;  3RT3 C;  1Q8I A;  1N8R W;  5J2U B;  2JEU A;  1GAX A;  3HKE A;  1OCZ C;  4AQY B;  3VQY A;  2UUB B;  4DYL A;  3RYI B;  1SQG A;  3C3S A;  1US6 A;  4X65 B;  3QO8 A;  4FK5 C;  3T1Y B;  2Z5U A;  4WFF A;  1VIB A;  1I5Y A;  4JTA B;  4O4J B;  4J11 A;  4O4I B;  5H5N A;  1QLE C;  5CBH A;  4GKK O;  3MAQ A;  4J7K A;  2D3O W;  1K9M W;  4G2K A;  1XNQ B;  3MHS C;  3H9V A;  4R8C A;  2FYU H;  4DR7 B;  2EIN C;  3JAM N;  1V55 B;  2UUC O;  1NJI W;  1NBM G;  3ZRV A;  2O57 A;  1Y67 A;  1I94 B;  5B1A B;  4HNA B;  2L6L A;  4PA4 A;  1GMG A;  2GV9 A;  4CH5 A;  2X6C A;  1SRY A;  5HFM A;  5BMV B;  2LFR A;  3AG2 B;  4LFA B;  1XBL A;  1DLB A;  3KG2 A;  1P4R A;  1YTF D;  2WWW A;  3BA8 A;  2DE0 X;  1NKD A;  1E79 G;  2VWJ A;  5JQG B;  2F4V B;  1IUR A;  1OCC B;  1Q81 W;  3R66 A;  4B7K A;  2JRI A;  5KHH A;  2LGW A;  2DQ3 A;  4H0L B;  2IJI A;  1VQP V;  5KAF Z;  2R9I A;  4LCU C;  3JAR A;  1MSD A;  4X64 O;  2JIZ G;  2YIC A;  1TUE B;  2ZD9 A;  1KB9 F;  1BMF G;  2EIL B;  5C8Y B;  1H5W A;  2BSK B;  2QM8 A;  4C7U A;  4DV0 O;  4L8J A;  3T1H B;  1SA0 B;  4I7Z B;  1CP9 A;  4TV9 B;  4PDM A;  2EIJ B;  5F2V O;  2VRZ A;  4BIO A;  2QA4 V;  2P90 A;  5LGN A;  4XDL A;  2LW1 A;  5DED A;  2ZKO A;  1P49 A;  4H37 A;  4KUM A;  5KMG A;  1VF6 C;  2IW5 A;  1AR5 A;  4JI4 B;  4JI8 B;  2YS8 A;  1AP6 A;  1MNG A;  1PL4 A;  2E3C A;  2NNU A;  4DK1 A;  2HHH O;  3M8A A;  4ZI7 B;  5J2U A;  1B3Q A;  2DWD C;  1NVP D;  3L74 H;  3M7M X;  1MA1 A;  5CA0 A;  4PA7 A;  3CRQ A;  1GO3 F;  3AG4 C;  3RYI A;  3ZMU A;  3CC4 V;  4B7E A;  1TUB A;  4IIJ A;  4O4J A;  3GB7 C;  4O4I A;  4WFE A;  3BPZ A;  4N23 A;  4FLT A;  2ILM A; 
#chains in the Genus database with same CATH homology
 1LUW A;  1ZTE A;  1GN6 A;  1GN2 A;  1IX9 A;  1I08 A;  1XIL A;  2CE4 A;  3BFR A;  1WB7 A;  4JZG A;  1SZX A;  3DC5 A;  1B06 A;  1LUV A;  1QNM A;  4E4E A;  4JZ2 A;  1JA8 A;  3AK2 A;  3QVN A;  2ADP A;  2ADQ B;  1MSD A;  1ZSP A;  3KKY A;  3AK1 A;  5A9G A;  1VAR A;  1XRE A;  3TJT A;  3KDR A;  1AP5 A;  4C7U A;  3RN4 A;  1AR4 A;  1XDC A;  1KKC A;  2AW9 A;  4F6E A;  1PM9 A;  4YIO A;  2QKC A;  3MDS A;  1N0N A;  1BS3 A;  1XUQ A;  5AG2 A;  1BSM A;  1AR5 A;  1WB8 A;  1AP6 A;  2GDS A;  1MNG A;  1PL4 A;  1D5N A;  3C3S A;  2CDY A;  1GN3 A;  1EM1 A;  3DC6 A;  3EVK A;  1ZLZ A;  3AK3 A;  1MA1 A;  4GUN A;  4YIP A;  1AVM A;  1EN5 A;  1MMM A;  4JYY A;  1N0J A;  4X9Q A;  1I0H A;  1ZUQ A;  3OT7 A;  1EN6 A;  1GN4 A;  4BR6 A;  1VEW A;  1BT8 A;  3IC9 A;  3C3T A;  1IDS A;  3K9S A;  2P4K A;  1P7G A;  2RCV A;  1IXB A;  1EN4 A;  4FFK A;  2QKA A;  1Y67 A;  3LSU A;  1JR9 A;  3CEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...