1PM9A

Crystal structure of human mnsod h30n, y166f mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amino acid substitution at the dimeric interface of human manganese superoxide dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
total genus 75
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1pm9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1pm9A02
3DC5A 1SZXA 1MA1A 2QKAA 1AVMA 1GN3A 1QNMA 3OT7A 1I08A 4C7UA 2P4KA 3RN4A 3AK1A 3LSUA 4BR6A 3BFRA 1ZUQA 3IC9A 1MSDA 1XREA 1Y67A 3MDSA 3QVNA 1XILA 1GN2A 1KKCA 4E4EA 2CDYA 1ZLZA 4X9QA 3C3TA 1GN6A 4YIOA 3TJTA 1EN6A 1D5NA 2AW9A 1LUWA 3C3SA 1BS3A 1MMMA 1IX9A 5AG2A 4FFKA 1WB7A 1WB8A 1LUVA 2GDSA 1BSMA 1AR4A 4GUNA 1VEWA 1EM1A 1P7GA 1XDCA 3K9SA 4JYYA 1AR5A 3KKYA 4F6EA 3DC6A 1JR9A 2CE4A 1PL4A 3EVKA 5A9GA 1ZTEA 1GN4A 1N0NA 1BT8A 1VARA 1EN4A 1PM9A 1EN5A 1MNGA 1I0HA 4JZGA 2QKCA 1IXBA 2ADPA 3AK2A 4YIPA 1JA8A 1N0JA 3CEIA 2RCVA 4JZ2A 1XUQA 1IDSA 2ADQB 1ZSPA 1AP6A 1B06A 3AK3A 1AP5A
chains in the Genus database with same CATH superfamily
1T5EA 5B66Z 2YI8A 3D36C 2P22C 5KAFZ 5L3CA 1N8RW 1M4UA 4LWSB 5F2VO 1YTFB 1S3JA 5JWPA 1JJOA 2QE7G 1I08A 4X62O 4DUYB 2HEPA 1GMGA 1SQXH 4X1KA 5CBFA 3I56V 1FJGB 2WLMA 1PPJH 1XBLA 2HP8A 3PJSK 2Q67A 2DW4A 1HNXO 1NKDA 1YXBA 5IJ9B 2ZXWC 2NNUA 5JCOC 1NTZH 1S0VA 4E4EA 2CDYA 3CJHA 3GWKC 4LF8B 4RWUA 4J7KA 5JJNB 1GH6A 4MTFA 1M1KW 1CPYA 3OAAG 1H8EG 1E79G 2P7TC 1WB7A 1SQVH 2H3OA 5CN0A 2OT5A 2XAFA 2RN9A 1R6TA 4UCRA 2E3CA 1YJWV 1P7GA 1TAEA 3SJBC 2ODMA 2R9IA 1N34B 5K1XA 3WFVA 2QM4A 1HW7A 2DYRC 3BAAA 3K3WA 4P9OA 4DXWA 4JI1O 2YSUB 5D5PA 4LP8A 3CMEV 2XOKG 4F6RA 2V7QG 5BMVB 3W7UA 1PKXA 4R6ZA 5JH7B 3A0RA 3ABLC 1URFA 3A0HZ 4KL1A 3OGIB 2F1MA 1BZKA 3ZS8C 3K9AA 3HKBB 1FXKA 3LDCA 1DF5A 5TISZ 1QQCA 2ADQB 1ZSPA 4PI0A 4OX9B 2Y4TA 1AP6A 1NVPD 4OXSA 4F4LA 3ZHVA 3EXAA 2N05A 4NVPA 5JQGB 4DV3B 1WPXA 1ZAUA 5CB4B 2LO1A 3BPZA 2HVJC 1RPOA 3ML0A 1VQMV 3P32A 2DE0X 1XNRO 4O2BB 4DR1B 3JD2A 3LSUA 4JV5O 1IBKB 2IJHA 3FYEB 2OIEA 4JI2B 5H6QA 3HKEA 5IT9N 2UXCB 1XILA 5LMUO 4R8CA 1AJQA 1GN2A 3QNEA 1WJZA 5IYZA 1NQTA 2F93B 3K5LA 4DK1A 2HJDA 4QPJA 1M57B 1S5JA 3HKCA 4LFCB 5KX5A 2BSKA 4JPRA 4PDMA 2BTOA 3S3WA 3VBBA 3T1HB 4LH6A 4LF5B 4CH6A 2X0LA 5EZYB 2QA4V 1R73A 4WFAV 4DR4O 4FM0A 1GTOA 3T1CA 1SA0A 2FYUH 1JPXA 4K3AA 2YC0A 3AG7A 2IH1C 4UCTA 2UXBB 5BY1A 5LGUA 2E5LO 4X8AA 2LW1A 3TCUA 3ABLB 4J7ZA 1XMOB 3K0GA 3JD1A 3AG1B 4JI8O 1HDJA 5BXZA 2KG7A 1LR1A 1N32O 3OW2U 1OCZB 2CUGA 1OV9A 1VMGA 2Q0AA 1JJ2U 4I9QA 3CXCU 4X1YB 3K06A 4H0LB 4MSWC 2MW2B 4NXNB 2GUZA 5GTHZ 4FZ1A 2WLLA 1S77D 4YHHB 4O2BA 4X66B 1SETA 1KB9F 4PDVA 3CCLV 2ITDC 4UXNA 1ORQC 3ZMVA 5C93A 3MAQA 1OCOB 1M93A 1VQ9V 1TVKA 2F23A 2FMLA 3ZHQA 3GWOA 3CRCA 4PA7A 3NXSA 4LWSA 2EIMB 3I55V 1KD1W 4X65B 5KLVH 1KMIZ 1TUBA 3K04A 2JJ2G 1THZA 5LYJB 3LSQA 1I94O 1RP3B 1WN7A 2IU3A 1QLEC 4I9WA 3UQ8A 1EZJA 4NB5A 5JJJB 1H2NA 2JGDB 5CB4A 3H01A 1PL0A 2BTQB 1Q5OA 2RMKB 3OEEG 5DN6G 1H2MA 3AG4C 3G80A 5B1OA 2PY5A 4RAIA 4LF4B 1AR5A 3B8MA 3QG5A 3T2MA 3KDRA 1PNLA 4CZZA 3J7AU 2NR5A 3N2GA 4X1YA 4MVRA 3ETQA 2IJIA 1NR1A 2W6JG 3E83A 5KA5A 4NR1A 1OCZC 2QWPB 2HG5C 1F4NA 2WLLB 1K3EA 1I0HA 3ZHTA 1WNSA 3ZCCA 4JTAB 3OEHG 1SESA 5L3GA 2QTSA 2EULA 3SYCA 4YIPA 1DGSA 4L8JA 4EB6A 3CPWU 3N2KB 5LMNO 2YIDA 2Q0OC 1I94B 3RYHA 2QKAA 1JFFA 3AG3B 1FXKC 4MW3A 5IYDO 2B5UA 2YIAA 3OD4A 3HKDA 5EZYA 3TK1A 1Y76B 1JOYA 4ZOLB 3FKSG 4U7OA 1E1QG 4AQYB 4JGSA 1MOFA 1Y4MA 4IGGA 2ZM6B 2UUBO 3GVMA 1QBZA 1H2KA 4NYKA 3CWBH 2EIJC 2YXYA 3D8CA 4FIPC 5KHIA 4X9QA 1K5SA 3U0ZA 1XQ8A 4DYLA 5JH7A 3H9VA 3T4ZA 2B1GA 5BZBA 1IX9A 1VF6A 4G27B 1Q81W 4B3SB 4MVUA 3OM3B 1FS0G 3JARA 3H1LH 4DR6O 4LFBB 3BA8A 2YUAA 1K33A 3LNNA 1TVKB 1PNKA 4JTCB 4HBNA 4WFHA 5B1AB 2GTSA 4F6EA 4KXRA 3ETGA 2Y4UA 1KP2A 3F7VC 2N74A 2F4VO 1YI2V 3DXRB 4TWKA 4O4JB 1NT2B 4EB6B 3O9OA 1Q6IA 2EX3A 2Q7EA 2RNBA 4UUJC 3SPIA 1BHBA 4DV3O 1V54B 2CGNA 2W0FC 4B7KA 4IYIA 2Y0PA 5FL7G 3CB2A 3SJCC 3VQYA 1DF4A 3SYPA 5IDJA 2ZT9B 3CMAV 1RSOA 4J11A 2UXNA 1MA1A 2DYSC 1V9PA 5LOVA 1XNQO 2ZNIA 1JVMA 1J5EO 2VQEB 1OJHA 3DSQA 1BQ0A 3OT7A 4PHZA 4CH3A 4PDRA 4JF3A 1BHAA 4FVMA 2YEVA 4O4IB 4PELA 2AZ0A 4LFAB 3OFNG 1AI7A 3BCCH 4QJFB 4X88A 4LCUC 2QM8A 4X64O 4FLZA 2ZD9A 3QVNA 4JI2O 3TXQA 3ABKB 1SQGA 3JALA 4ICGA 2E74B 4W4LA 1A32A 2P06A 3KG2A 2VQFO 5KHGA 2AW9A 3W7SA 4JTDB 1BQZA 2ZE8A 2QR4A 1JCHA 1YZBA 2Q69A 1K97A 2DWEC 3A8TA 3BVOA 4LF9B 1I5XA 2LW7A 4FFKA 4ZI7B 2Q7HA 3GB7C 3D3QA 5GONA 1BSMA 3CCRV 1UPGA 2PUSA 1AR4A 2M6YA 4YY3B 5HFMA 2F43G 2NN4A 1VEWA 1PD3A 4ASUG 2JJ1G 3K5MA 4FFBB 3KKYA 4KUMA 3WB1A 4WFBV 4DV4B 4FLTA 4LBEC 4JI1B 3ZRSA 3Q4HB 2BTQA 2EJRA 5L3DA 4ZHQB 1JR9A 4DR2O 3K0DA 2Q5ZA 3KCYA 2PYLA 1ZTEA 4DV6O 4B3MO 1R6KA 1YCIA 1K4DC 3CCSV 4FM1A 4Z2WA 1KKDA 5IWAO 4JZGA 3HR0A 3O65A 4LF6B 1Z5WA 1OZ0A 3CEIA 3JAWA 5LA6A 5LHHA 2OCCB 4LF8O 4DV5B 1WA8B 3MHHC 2FB5A 1RM1C 2R70A 5FPRA 4DV1B 4JI4B 2CH7B 5DEDA 5EIBD 4BIOA 5LXTB 2UXDB 4X66O 3K5NA 2YXHA 3UO3A 2X7RB 4MVZA 5IYBO 1N34O 3A2FA 5K1PA 2EILB 4JYAB 2KB1A 1SZTA 2UXDO 3CC4V 1VQNV 3UT5A 5LP6B 2B1IA 3LDEA 2OCHA 1HNZO 3FFQA 4LF9O 4JI0B 1G4YB 2JRIA 3P30A 5KAIZ 4P9PA 4TSFG 2HVKC 3JAWB 5LA6B 2Q7GA 5IY5B 3OTOO 3C3TA 3TETA 1K92A 4G28B 1H8HG 5KHHA 3BABA 4PV1B 1J5EB 3OTOB 2EZPA 2LGQA 4Q20A 1NH2D 2RQ6A 5LP6C 4GLXA 3BRCA 1DLBA 1WLEA 1X59A 3ETEA 1GM9A 2ZCEA 1NBMG 3JARB 5CA0B 4YY3O 2ZE5A 2JVDA 2X6CA 4O4LA 3OUFA 1WP7A 4DW0A 2UXCO 4RQEA 1QVGU 2ZXWB 4YJ3A 1WA8A 1HNZB 2ZKOA 4B3TO 3RYIB 4DV0B 1K5QA 2GTAA 4Z1VA 1JA8A 4PJ0Z 4KP4A 4O4JA 1V55B 3CCEV 3L74H 1VIBA 4CC5A 4WFEA 3M8AA 1MABG 3RBZA 2LQTA 1ZL8A 3J80N 2YIBD 2AZ2A 4C7UA 2K9PA 3ZMUA 3M7MX 4J42A 3LSSA 4XDKA 3ZRVA 2OWOA 2D2CB 4DR3B 1QR9A 1K73W 1H38A 2QKSA 3RYCA 3FB8C 4W4KA 5B1NA 4BW9A 2UU9O 2L6LA 1IBLO 3WB2A 3MDSA 4DV6B 1SF9A 2FKXA 3AG1C 3OE7G 4JI5O 1KKCA 1E1RG 4UB6Z 3VQXA 2DYRB 1QHTA 1KBHA 4YIOA 1LUWA 3C3SA 4LF7O 3CRMA 1OCRC 1YITV 1D5AA 1XMQO 1KYOF 3ASOC 3IGAC 5BR8B 4DR5B 1WB8A 1ZWIC 2X6AA 3B40A 1S5HC 1Y6XA 5J2UB 4JYAO 1XDCA 3K9SA 4HAMA 1FAFA 1XEQA 1J95A 3SPHA 2YDEA 1HNWO 1BE3H 1SS3A 5KMGB 4RUFA 2KKWA 1Y74A 2XTAA 3D3IA 1Q8IA 2GSMB 4D6TH 1V55C 2PTMA 4IHJB 2ADPA 3JASA 5IJ9A 3I5DA 4XDJA 2JEUA 1SA0B 3RFRA 1UJWB 4GZRB 2VRZA 1XL6A 3P3NA 2LGWA 2KQXA 1MSWD 2EJ7A 2EZOA 3OMAB 4B3MB 5KUKA 1YVWA 5J2TA 3FB7C 4R50A 1YDXA 4JI7B 2PZSA 3OGCC 4HZ3A 1KP3A 3B8NA 1XHXA 2UXXA 3BEHA 3FAVA 1SQPH 4O4LB 5D5QA 4LNUB 4TQDA 2EIKB 4ZI7A 2EIJB 1H5WA 4B3RB 2CH7A 2H8PC 4DV0O 2XASA 3HKCB 3SPCA 2UUBB 4TV8B 1FXVA 3JATB 1H2LA 4AHCA 3DTUB 2R72A 2Q8VA 1NS1A 3N27A 4J9ZB 3STLC 1SQQH 5ITZA 3ZHUA 2YI9A 4BAYA 2EILC 3UT5B 3RYIA 5LP6A 1DTOA 4TQFA 1B04A 1IXMA 4OGQB 1GM8A 3STZC 1P84F 3ETDA 4CC6A 1W59A 4MTXA 3VQVA 1K9MW 4LFBO 4RO2A 1Q86W 3UO2A 2YEVB 4RUEA 5L3FA 2OTLV 5JVDA 2WSSG 1GKFA 1M56B 2X6BA 5EYPB 5B5EZ 4UCVA 4GKKO 1H2GA 1G8MA 3VQWA 2HHHO 1IBMB 1Z2GA 4O4HB 4OPAA 1Y76A 5FPOA 1FOUA 2QWOB 5KUMA 4LFAO 1N0NA 1F51A 1QLNA 1PM9A 1AJNA 3ZHRA 3ZRXA 1RM1B 5A2QN 2Y69C 4LF7B 2JS5A 1GAXA 1GK9A 1AI5A 2ATKC 1XNQB 2D3OW 3CRAA 1YSCA 2FL4A 4A5UB 1IDSA 1AROP 5JVDB 1BGYH 4R7CA 4FFBA 1ROPA 3E2EA 4BWAA 4O4HA 3OTFA 4TUYA 1MG1A 4J41A 1IBMO 4B08A 3T1HO 2XUMA 1BCCH 2HFEC 4UB8Z 5EBMC 1XOUA 4I50A 4IYHA 4ZKIA 5LGNA 3BFRA 1ZUQA 2ARHA 4K8XA 3CCQV 5DECA 3CCJV 4I5SA 3IFXA 2W0XA 3G71V 1HR0O 3K5OA 3CCUV 4F6RB 1YJNV 3A0BZ 5L3BA 2P6JA 4DW1A 4KHPO 3HKEB 4DRXB 1OCOC 4GX0A 4YJ3B 1VF6C 4DR6B 4U7NA 3JASB 4U3JA 4FZ0A 3K08A 2PI5A 1L0NH 4X1KB 3FAVB 2VS0A 2ZE7A 4I50B 4DUZB 1I7FA 1IBKO 4DV7B 5J2TB 5GTIZ 3CRQA 2BE3A 3ZIAG 5JQGA 3TGUH 2AXTZ 2XAHA 3BHPA 4B3TB 3DC6A 5LOVB 2UUCO 5H5NA 3JSLA 4DO2A 2RJZA 4TV9A 4Z1MG 2P5OA 1XHZA 1PL4A 1WP8A 5A9GA 3E89A 4P30A 1NJIW 3K58A 1P4RA 2YICA 4UCUA 4CH4A 2LP7A 1IXBA 1HWYA 4X89A 3G6BA 3CSXA 3ABKC 4JI7O 2RCVA 4H13B 4DR4B 1YJ9V 4HNAA 4Q6GA 4NXMO 3JALB 1VQ8V 4MVOA 3DC5A 3ASNC 5LBQA 4FM2A 4ZBMA 3OR6C 4TV9B 1YIJV 2XT9A 3ZHSA 3SPJA 1WAZA 2QSAA 2CK3G 1R3KC 4IL6Z 4E2LA 5CMUA 4FLXA 4LR3A 2H94A 5FLXN 4MTGA 2MK3A 3OMIB 2Y69B 1N32B 4XDLA 3P3PA 4DV1O 4EFBA 4H37A 3N2GB 1AJPA 1UFIA 3LUTB 4FLUA 4N21A 4U3JB 4DR7O 1B3QA 2Y0IA 3OR7C 4NKGB 1AB3A 2OYQA 4DUZO 4YJ2A 1GN6A 4LF6O 4GKKB 3F5WC 4GKJO 4PDLA 4JI4O 2QWQB 3E8HA 4I7ZB 1TUBB 1SC5B 3BA9A 3ZMZA 4FPPA 4X65O 4OX9O 2UU9B 5ITZB 2GDSA 2P67A 3T4DA 4MT8A 4U3FH 3AG3C 3RT3C 4GUNA 3DXRA 5FNVA 5B3SC 4DV2O 2AGAA 5CBGA 3H1HH 4DV4O 2YS8A 2JS3A 3CHXA 1KUQA 3IC7A 4CBCA 4J10A 1G6UA 4D7SA 1Z5VA 5IE9A 1DK1A 1FXKB 4DR2B 1CXZB 4JYBA 3CXHF 2PI4A 1VARA 1TUEB 4YJ2B 3THOA 3E8BA 5EC2C 2Z3YA 3JYCA 2QKCA 4TV8A 2IU0A 3JATA 1IZ3A 2N04A 1N0JA 4I4TB 4ABMA 3IAYA 4DK0A 2VWKA 1OCCC 3BY6A 4NXNO 4H44B 3ASOB 2ZR2A 4QNHB 4JI3B 3B4SA 1N4CA 1K7DA 3QTCA 2L35A 3ZN0A 1KECA 1ZX3A 2ZIMA 2R9RB 3RN4A 4X62B 4DUYO 1ENVA 2KG7B 3UM7A 4JI8B 2ILMA 3G67A 2XNDG 3H1IH 4UCOA 4JI3O 3ZN1A 1XREA 4FJCC 2BSKB 4DR3O 3UKMA 4D7TA 1R1BA 2Z0AA 3ZMTA 1OCRB 2O57A 3K57A 1QVFU 3EHBB 2GUZB 4H33A 3EFFK 2GBOA 2Q4PA 4BW5A 3CP1A 4AI8A 3RYFB 3CYOA 2Q9LA 3H1KH 2JGUA 3R65A 4G2KA 3JD0A 1BS3A 4K8ZA 1JNBA 1O9GA 2RDCA 3WG7C 4J80A 2AHYA 4QGPA 4JI5B 3B09A 3N2KA 2DYSB 5E1AC 2CTPA 4CS4A 1P49A 1SKVA 2OIGA 4WFGA 4O2AA 2NLJC 4N23A 4MVMA 4GYCB 3RYFA 3L72H 1M90W 5H9CA 5LYJA 5LHGA 5IYZB 4I4TA 3JAKB 1EN5A 3L9DA 4PI2A 1F23A 3RVYA 1TGOA 2P90A 3CD6V 2DQ0A 3AK2A 3U10A 2BOBC 1K8AW 3CE2A 3CC7V 1R3LC 1B06A 5FNVB 5CA1A 3E8FA 3G6EV 4O2AB 2JK5C 1M5IA 3RWRD 1QNMA 3CRRA 4UFZA 3SPGA 3ICXA 2P4VA 2XAGA 1COWG 1OHHG 3HPLC 5EIBC 3VOUA 5J2UA 5L3EA 2A3QA 1K34A 1GRJA 2F66C 2JGDA 2WA3A 4KFMA 3ZMSA 4QE9A 3FD9A 1ZLZA 4WF9V 3IJ4A 5DM6V 1V54C 4UVCA 1W0KG 5B1AC 1I5YA 1NR7A 1MMMA 2IW5A 2E75B 2IJJA 4ZOLA 3HKDB 4X64B 1LNQA 1NVPB 1H2SB 1VQ5V 3MD0A 3J81N 4UVAA 1M9NA 3WG7B 1W2BU 4PA6A 1FKAO 1RSOB 1US6A 1Q7YW 2F4VB 2CAZC 2QWNB 3E22B 1IBLB 1YHQV 3QO5A 5EBWC 4NTYA 1VQKV 3G4SV 1FPOA 4IIJB 1GN4A 2V4DA 4TT3G 3JD4A 4QIWF 1N33O 2WLJA 1NU1H 3APOA 1D2DA 4NTWA 1M57C 4MW8A 1QLEB 2V1DA 4B3SO 3W7TA 3ABMB 3KZIZ 5CBHA 4WCEV 4NXMB 4GX2A 1HR0B 3SR2C 2ZR3A 5JJEB 4DV2B 1O9HA 3JSNA 1CP9A 1FFTB 1NI8A 1N36O 1NH2B 5HFLA 1OCCB 1QCEA 2E76B 2OCCC 4MVSA 2QJ1A 4FLYA 2UUAB 2A0LA 1CEZA 4K35A 1F7YA 3W7WA 2Q6AA 3CS5A 5GONB 2Z5UA 3KCXA 4AQYO 1FFXB 3ABMC 3W7XA 1AR1B 4IHJA 5IWAB 2A9HA 3T1YB 5IYCO 3UCSC 1Q6UA 2JEXA 3AG2C 1EN6A 1D5NA 1G1XB 2WLHA 1SRYA 1L8DA 5B3SB 3E22A 4B7EA 1XMOO 2EIMC 2A7WA 3CCMV 1SERA 3AEIA 3RYHB 4FMTA 2VWJA 3SYOA 1JFFB 4UVBA 2JIZG 2LFRA 3H1JH 3AG4B 1Q3EA 4TUYB 1KC8W 4JI0O 2R9AA 3WB0A 2CTQA 2QGNA 4I55B 4X20A 5C8YA 2QTOA 1VQLV 1P7BA 1BL8A 1BT8A 2ZDIC 4MS2A 4QPKA 4DV7O 1R6NA 1U96A 1MNGA 3SGIA 1S5LZ 3RVZA 3QO8A 4ZIBA 3RYCB 1XL4A 4JAAA 2WA4A 3D36A 3FB6C 1XMQB 2UUCB 2DQ3A 2BCCH 2WAMA 4I0XB 1AI4A 2HR3A 4KHPB 5LL6Y 4LF5O 3F7YC 5LMNB 1SQBH 1IVSA 2HKOA 4GX5A 2B9ZA 3OMNB 3L71H 5LGTA 2ZIOA 2GV9A 1HP8A 5H6RA 1AVMA 1GN3A 2DMXA 3Q4HA 2M7WA 3OUSA 1Y66A 2ZDIA 1S76D 2WLKA 1MZEA 2QDOA 2QWRB 3E35A 1NZ6A 2LJ2A 5LMUB 4BR6A 1YEWA 2Q73A 3LDDA 2WLIA 4WBNB 4JAUA 1YTFD 3E86A 1ZL8B 1NTMH 4RQFA 2PYJA 4BIUA 1B6QA 4DR1O 3DGEA 4EEQA 1L1FA 3JCUZ 4HYOA 3TJTA 4TOIA 3NR7A 2PF4E 4JASA 5IJ0B 5AG2A 3TXSA 2AHZA 2VQFB 2QEXV 1EFRG 2ETNA 4AILC 2Q68A 4O4IA 4JYYA 3JAMN 2EIKC 2WPDG 4GKJB 1SQFA 3L75H 2KSDA 4B3RO 3R66A 3ZX6A 2HHHB 1JQ0A 1FXHA 3K79A 2DOSA 2YXLA 2IBZH 4PA9A 4MTOA 4JYCA 1KQSU 2A06H 1FFXA 1X4TA 4CS3A 2QM7A 3SJAC 2IM9A 5EC1C 2UXBO 2JDIG 3ABTA 4WFFA 2VQEO 2ZE6A 4EKWA 5CA3A 4IIJA 5KMGA 1VQ4V 2GHYA 1S72V 3AK3A 3RW0A 1VQ7V 1SZXA 4K0KO 1Q82W 4JAVA 5EYPA 1BMFG 3U11A 5EBLC 2P4KA 1HNWB 3ZRWA 3AK1A 4LFCO 5H2FZ 4XBFA 4JV5B 1JMKC 3HKBA 3CJHB 3QO7A 2G38A 2ITCC 1Y67A 1VQOV 4J7JA 4HNAB 4QE7A 2HLDG 3LNMB 5BR8O 4DR5O 1IURA 3FX7A 2DJVA 2LFSA 5LHIA 3X2QB 4LF4O 5LXTA 2C2AA 1RPRA 3ZRWB 4YHHO 2YIBA 4UCSA 5KHJA 5CA0A 5B1BC 1F4MA 4FK5C 5BMVA 4J9YB 1Q6HA 2K1EA 3K03A 3CX5F 3HB3B 2ZNJA 4GT1A 3M99B 4JI6B 1L0LH 2WLNA 1QU7A 4UV8A 3E8GA 3F5TA 2UUAO 3EVKA 2ZM6O 5KHKA 2WLIB 4WBNA 1VF7A 1KU9A 2F95B 2FTKA 5JCOA 1FD9A 1AILA 4ZHQA 2PGGA 5C8YB 3S3XA 1U97A 5KA6A 1XUQA 1XI1A 3JCZA 4X1IA 4DR7B 1R3JC 4LC1A 4OPHA 2HJFC 1N36B 1GO3F 4LH7A 4K0KB 4IT5A 4PA4A 3RGBA 4I0XA 4FLVA 1EBOA 1VQ6V 1Q90D 1M56C 3APQA 2EINB 4MVQA 2ZINA 3ZBHA 2EBOA 1Y74B 3CC2V 1Q43A 1NTKH 3IC9A 1MSDA 1K4CC 3SDLA 1AI6A 5KX5B 3ZJZA 3FB5C 4EFEA 1FYJA 4PD4F 1HNXB 5GW7A 1PNMA 4CH5A 4X1IB 3MHSC 2XAJA 2Y48A 2CTWA 3ZEDA 4DV5O 4GCZA 3WU2Z 3QF7A 5J9PC 2E5LB 4I55A 4X20B 1VQPV 3JAKA 4BIZA 1IJGA 4L87A 1WPBA 3SJQC 2EINC 1R3IC 1PP9H 2BOCC 3L70H 2IJKA 3T1YO 1JX9A 5E79Z 1LUVA 3SYAA 3SYQA 3ASNB 1W0JG 4FLWA 3JD3A 3C90A 2DWDC 1EM1A 4YXWG 1FJGO 4DRXA 2A79B 1PV0A 5CA1B 1QR8A 3K59A 5IJ0A 1MZFA 3B2EE 2CGOA 4PA3A 2IH3C 3PN1A 1VF5B 2CE4A 3B77A 2XAQA 2XHBA 4NTXA 1XNRB 5EK0A 5B1BB 2DN9A 3ABUA 1EN4A 1YF2A 1TA8A 3L73H 4JI6O 1VP7A 2CTRA 4GX1A 3X2QC 5IY5C 1EZVH 1GM7A 2OTJV 3AG2B 2ZQMA 1RFYA 4UV9A 4JZ2A 3CCVV 2W6IG 4P2ZA 1N33B 4LNUA 3FYIB 1AP5A 4CS2A 2WWWA
chains in the Genus database with same CATH topology
3DC5A 1SZXA 1MA1A 2QKAA 1AVMA 1GN3A 1QNMA 3OT7A 1I08A 4C7UA 2P4KA 3RN4A 3AK1A 3LSUA 4BR6A 3BFRA 1ZUQA 3IC9A 1MSDA 1XREA 1Y67A 3MDSA 3QVNA 1XILA 1GN2A 1KKCA 4E4EA 2CDYA 1ZLZA 4X9QA 3C3TA 1GN6A 4YIOA 3TJTA 1EN6A 1D5NA 2AW9A 1LUWA 3C3SA 1BS3A 1MMMA 1IX9A 5AG2A 4FFKA 1WB7A 1WB8A 1LUVA 2GDSA 1BSMA 1AR4A 4GUNA 1VEWA 1EM1A 1P7GA 1XDCA 3K9SA 4JYYA 1AR5A 3KKYA 4F6EA 3DC6A 3KDRA 1JR9A 2CE4A 1PL4A 3EVKA 5A9GA 1ZTEA 1GN4A 1N0NA 1BT8A 1VARA 1EN4A 1PM9A 1EN5A 1MNGA 1I0HA 4JZGA 2QKCA 1IXBA 2ADPA 3AK2A 4YIPA 1JA8A 1N0JA 3CEIA 2RCVA 4JZ2A 1XUQA 1IDSA 2ADQB 1ZSPA 1AP6A 1B06A 3AK3A 1AP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DC5 A;  1SZX A;  1MA1 A;  2QKA A;  1AVM A;  1GN3 A;  1QNM A;  3OT7 A;  1I08 A;  4C7U A;  2P4K A;  3RN4 A;  3AK1 A;  3LSU A;  4BR6 A;  3BFR A;  1ZUQ A;  3IC9 A;  1MSD A;  1XRE A;  1Y67 A;  3MDS A;  3QVN A;  1XIL A;  1GN2 A;  1KKC A;  4E4E A;  2CDY A;  1ZLZ A;  4X9Q A;  3C3T A;  1GN6 A;  4YIO A;  3TJT A;  1EN6 A;  1D5N A;  2AW9 A;  1LUW A;  3C3S A;  1BS3 A;  1MMM A;  1IX9 A;  5AG2 A;  4FFK A;  1WB7 A;  1WB8 A;  1LUV A;  2GDS A;  1BSM A;  1AR4 A;  4GUN A;  1VEW A;  1EM1 A;  1P7G A;  1XDC A;  3K9S A;  4JYY A;  1AR5 A;  3KKY A;  4F6E A;  3DC6 A;  1JR9 A;  2CE4 A;  1PL4 A;  3EVK A;  5A9G A;  1ZTE A;  1GN4 A;  1N0N A;  1BT8 A;  1VAR A;  1EN4 A;  1PM9 A;  1EN5 A;  1MNG A;  1I0H A;  4JZG A;  2QKC A;  1IXB A;  2ADP A;  3AK2 A;  4YIP A;  1JA8 A;  1N0J A;  3CEI A;  2RCV A;  4JZ2 A;  1XUQ A;  1IDS A;  2ADQ B;  1ZSP A;  1AP6 A;  1B06 A;  3AK3 A;  1AP5 A; 
#chains in the Genus database with same CATH topology
 1T5E A;  5B66 Z;  2YI8 A;  3D36 C;  2P22 C;  5KAF Z;  5L3C A;  1N8R W;  1M4U A;  4LWS B;  5F2V O;  1YTF B;  1S3J A;  5JWP A;  1JJO A;  2QE7 G;  1I08 A;  4X62 O;  4DUY B;  2HEP A;  1GMG A;  1SQX H;  4X1K A;  5CBF A;  3I56 V;  1FJG B;  2WLM A;  1PPJ H;  1XBL A;  2HP8 A;  3PJS K;  2Q67 A;  2DW4 A;  1HNX O;  1NKD A;  1YXB A;  5IJ9 B;  2ZXW C;  2NNU A;  5JCO C;  1NTZ H;  1S0V A;  4E4E A;  2CDY A;  3CJH A;  3GWK C;  4LF8 B;  4RWU A;  4J7K A;  5JJN B;  1GH6 A;  4MTF A;  1M1K W;  1CPY A;  3OAA G;  1H8E G;  1E79 G;  2P7T C;  1WB7 A;  1SQV H;  2H3O A;  5CN0 A;  2OT5 A;  2XAF A;  2RN9 A;  1R6T A;  4UCR A;  2E3C A;  1YJW V;  1P7G A;  1TAE A;  3SJB C;  2ODM A;  2R9I A;  1N34 B;  5K1X A;  3WFV A;  2QM4 A;  1HW7 A;  2DYR C;  3BAA A;  3K3W A;  4P9O A;  4DXW A;  4JI1 O;  2YSU B;  5D5P A;  4LP8 A;  3CME V;  2XOK G;  4F6R A;  2V7Q G;  5BMV B;  3W7U A;  1PKX A;  4R6Z A;  5JH7 B;  3A0R A;  3ABL C;  1URF A;  3A0H Z;  4KL1 A;  3OGI B;  2F1M A;  1BZK A;  3ZS8 C;  3K9A A;  3HKB B;  1FXK A;  3LDC A;  1DF5 A;  5TIS Z;  1QQC A;  2ADQ B;  1ZSP A;  4PI0 A;  4OX9 B;  2Y4T A;  1AP6 A;  1NVP D;  4OXS A;  4F4L A;  3ZHV A;  3EXA A;  2N05 A;  4NVP A;  5JQG B;  4DV3 B;  1WPX A;  1ZAU A;  5CB4 B;  2LO1 A;  3BPZ A;  2HVJ C;  1RPO A;  3ML0 A;  1VQM V;  3P32 A;  2DE0 X;  1XNR O;  4O2B B;  4DR1 B;  3JD2 A;  3LSU A;  4JV5 O;  1IBK B;  2IJH A;  3FYE B;  2OIE A;  4JI2 B;  5H6Q A;  3HKE A;  5IT9 N;  2UXC B;  1XIL A;  5LMU O;  4R8C A;  1AJQ A;  1GN2 A;  3QNE A;  1WJZ A;  5IYZ A;  1NQT A;  2F93 B;  3K5L A;  4DK1 A;  2HJD A;  4QPJ A;  1M57 B;  1S5J A;  3HKC A;  4LFC B;  5KX5 A;  2BSK A;  4JPR A;  4PDM A;  2BTO A;  3S3W A;  3VBB A;  3T1H B;  4LH6 A;  4LF5 B;  4CH6 A;  2X0L A;  5EZY B;  2QA4 V;  1R73 A;  4WFA V;  4DR4 O;  4FM0 A;  1GTO A;  3T1C A;  1SA0 A;  2FYU H;  1JPX A;  4K3A A;  2YC0 A;  3AG7 A;  2IH1 C;  4UCT A;  2UXB B;  5BY1 A;  5LGU A;  2E5L O;  4X8A A;  2LW1 A;  3TCU A;  3ABL B;  4J7Z A;  1XMO B;  3K0G A;  3JD1 A;  3AG1 B;  4JI8 O;  1HDJ A;  5BXZ A;  2KG7 A;  1LR1 A;  1N32 O;  3OW2 U;  1OCZ B;  2CUG A;  1OV9 A;  1VMG A;  2Q0A A;  1JJ2 U;  4I9Q A;  3CXC U;  4X1Y B;  3K06 A;  4H0L B;  4MSW C;  2MW2 B;  4NXN B;  2GUZ A;  5GTH Z;  4FZ1 A;  2WLL A;  1S77 D;  4YHH B;  4O2B A;  4X66 B;  1SET A;  1KB9 F;  4PDV A;  3CCL V;  2ITD C;  4UXN A;  1ORQ C;  3ZMV A;  5C93 A;  3MAQ A;  1OCO B;  1M93 A;  1VQ9 V;  1TVK A;  2F23 A;  2FML A;  3ZHQ A;  3GWO A;  3CRC A;  4PA7 A;  3NXS A;  4LWS A;  2EIM B;  3I55 V;  1KD1 W;  4X65 B;  5KLV H;  1KMI Z;  1TUB A;  3K04 A;  2JJ2 G;  1THZ A;  5LYJ B;  3LSQ A;  1I94 O;  1RP3 B;  1WN7 A;  2IU3 A;  1QLE C;  4I9W A;  3UQ8 A;  1EZJ A;  4NB5 A;  5JJJ B;  1H2N A;  2JGD B;  5CB4 A;  3H01 A;  1PL0 A;  2BTQ B;  1Q5O A;  2RMK B;  3OEE G;  5DN6 G;  1H2M A;  3AG4 C;  3G80 A;  5B1O A;  2PY5 A;  4RAI A;  4LF4 B;  1AR5 A;  3B8M A;  3QG5 A;  3T2M A;  3KDR A;  1PNL A;  4CZZ A;  3J7A U;  2NR5 A;  3N2G A;  4X1Y A;  4MVR A;  3ETQ A;  2IJI A;  1NR1 A;  2W6J G;  3E83 A;  5KA5 A;  4NR1 A;  1OCZ C;  2QWP B;  2HG5 C;  1F4N A;  2WLL B;  1K3E A;  1I0H A;  3ZHT A;  1WNS A;  3ZCC A;  4JTA B;  3OEH G;  1SES A;  5L3G A;  2QTS A;  2EUL A;  3SYC A;  4YIP A;  1DGS A;  4L8J A;  4EB6 A;  3CPW U;  3N2K B;  5LMN O;  2YID A;  2Q0O C;  1I94 B;  3RYH A;  2QKA A;  1JFF A;  3AG3 B;  1FXK C;  4MW3 A;  5IYD O;  2B5U A;  2YIA A;  3OD4 A;  3HKD A;  5EZY A;  3TK1 A;  1Y76 B;  1JOY A;  4ZOL B;  3FKS G;  4U7O A;  1E1Q G;  4AQY B;  4JGS A;  1MOF A;  1Y4M A;  4IGG A;  2ZM6 B;  2UUB O;  3GVM A;  1QBZ A;  1H2K A;  4NYK A;  3CWB H;  2EIJ C;  2YXY A;  3D8C A;  4FIP C;  5KHI A;  4X9Q A;  1K5S A;  3U0Z A;  1XQ8 A;  4DYL A;  5JH7 A;  3H9V A;  3T4Z A;  2B1G A;  5BZB A;  1IX9 A;  1VF6 A;  4G27 B;  1Q81 W;  4B3S B;  4MVU A;  3OM3 B;  1FS0 G;  3JAR A;  3H1L H;  4DR6 O;  4LFB B;  3BA8 A;  2YUA A;  1K33 A;  3LNN A;  1TVK B;  1PNK A;  4JTC B;  4HBN A;  4WFH A;  5B1A B;  2GTS A;  4F6E A;  4KXR A;  3ETG A;  2Y4U A;  1KP2 A;  3F7V C;  2N74 A;  2F4V O;  1YI2 V;  3DXR B;  4TWK A;  4O4J B;  1NT2 B;  4EB6 B;  3O9O A;  1Q6I A;  2EX3 A;  2Q7E A;  2RNB A;  4UUJ C;  3SPI A;  1BHB A;  4DV3 O;  1V54 B;  2CGN A;  2W0F C;  4B7K A;  4IYI A;  2Y0P A;  5FL7 G;  3CB2 A;  3SJC C;  3VQY A;  1DF4 A;  3SYP A;  5IDJ A;  2ZT9 B;  3CMA V;  1RSO A;  4J11 A;  2UXN A;  1MA1 A;  2DYS C;  1V9P A;  5LOV A;  1XNQ O;  2ZNI A;  1JVM A;  1J5E O;  2VQE B;  1OJH A;  3DSQ A;  1BQ0 A;  3OT7 A;  4PHZ A;  4CH3 A;  4PDR A;  4JF3 A;  1BHA A;  4FVM A;  2YEV A;  4O4I B;  4PEL A;  2AZ0 A;  4LFA B;  3OFN G;  1AI7 A;  3BCC H;  4QJF B;  4X88 A;  4LCU C;  2QM8 A;  4X64 O;  4FLZ A;  2ZD9 A;  3QVN A;  4JI2 O;  3TXQ A;  3ABK B;  1SQG A;  3JAL A;  4ICG A;  2E74 B;  4W4L A;  1A32 A;  2P06 A;  3KG2 A;  2VQF O;  5KHG A;  2AW9 A;  3W7S A;  4JTD B;  1BQZ A;  2ZE8 A;  2QR4 A;  1JCH A;  1YZB A;  2Q69 A;  1K97 A;  2DWE C;  3A8T A;  3BVO A;  4LF9 B;  1I5X A;  2LW7 A;  4FFK A;  4ZI7 B;  2Q7H A;  3GB7 C;  3D3Q A;  5GON A;  1BSM A;  3CCR V;  1UPG A;  2PUS A;  1AR4 A;  2M6Y A;  4YY3 B;  5HFM A;  2F43 G;  2NN4 A;  1VEW A;  1PD3 A;  4ASU G;  2JJ1 G;  3K5M A;  4FFB B;  3KKY A;  4KUM A;  3WB1 A;  4WFB V;  4DV4 B;  4FLT A;  4LBE C;  4JI1 B;  3ZRS A;  3Q4H B;  2BTQ A;  2EJR A;  5L3D A;  4ZHQ B;  1JR9 A;  4DR2 O;  3K0D A;  2Q5Z A;  3KCY A;  2PYL A;  1ZTE A;  4DV6 O;  4B3M O;  1R6K A;  1YCI A;  1K4D C;  3CCS V;  4FM1 A;  4Z2W A;  1KKD A;  5IWA O;  4JZG A;  3HR0 A;  3O65 A;  4LF6 B;  1Z5W A;  1OZ0 A;  3CEI A;  3JAW A;  5LA6 A;  5LHH A;  2OCC B;  4LF8 O;  4DV5 B;  1WA8 B;  3MHH C;  2FB5 A;  1RM1 C;  2R70 A;  5FPR A;  4DV1 B;  4JI4 B;  2CH7 B;  5DED A;  5EIB D;  4BIO A;  5LXT B;  2UXD B;  4X66 O;  3K5N A;  2YXH A;  3UO3 A;  2X7R B;  4MVZ A;  5IYB O;  1N34 O;  3A2F A;  5K1P A;  2EIL B;  4JYA B;  2KB1 A;  1SZT A;  2UXD O;  3CC4 V;  1VQN V;  3UT5 A;  5LP6 B;  2B1I A;  3LDE A;  2OCH A;  1HNZ O;  3FFQ A;  4LF9 O;  4JI0 B;  1G4Y B;  2JRI A;  3P30 A;  5KAI Z;  4P9P A;  4TSF G;  2HVK C;  3JAW B;  5LA6 B;  2Q7G A;  5IY5 B;  3OTO O;  3C3T A;  3TET A;  1K92 A;  4G28 B;  1H8H G;  5KHH A;  3BAB A;  4PV1 B;  1J5E B;  3OTO B;  2EZP A;  2LGQ A;  4Q20 A;  1NH2 D;  2RQ6 A;  5LP6 C;  4GLX A;  3BRC A;  1DLB A;  1WLE A;  1X59 A;  3ETE A;  1GM9 A;  2ZCE A;  1NBM G;  3JAR B;  5CA0 B;  4YY3 O;  2ZE5 A;  2JVD A;  2X6C A;  4O4L A;  3OUF A;  1WP7 A;  4DW0 A;  2UXC O;  4RQE A;  1QVG U;  2ZXW B;  4YJ3 A;  1WA8 A;  1HNZ B;  2ZKO A;  4B3T O;  3RYI B;  4DV0 B;  1K5Q A;  2GTA A;  4Z1V A;  1JA8 A;  4PJ0 Z;  4KP4 A;  4O4J A;  1V55 B;  3CCE V;  3L74 H;  1VIB A;  4CC5 A;  4WFE A;  3M8A A;  1MAB G;  3RBZ A;  2LQT A;  1ZL8 A;  3J80 N;  2YIB D;  2AZ2 A;  4C7U A;  2K9P A;  3ZMU A;  3M7M X;  4J42 A;  3LSS A;  4XDK A;  3ZRV A;  2OWO A;  2D2C B;  4DR3 B;  1QR9 A;  1K73 W;  1H38 A;  2QKS A;  3RYC A;  3FB8 C;  4W4K A;  5B1N A;  4BW9 A;  2UU9 O;  2L6L A;  1IBL O;  3WB2 A;  3MDS A;  4DV6 B;  1SF9 A;  2FKX A;  3AG1 C;  3OE7 G;  4JI5 O;  1KKC A;  1E1R G;  4UB6 Z;  3VQX A;  2DYR B;  1QHT A;  1KBH A;  4YIO A;  1LUW A;  3C3S A;  4LF7 O;  3CRM A;  1OCR C;  1YIT V;  1D5A A;  1XMQ O;  1KYO F;  3ASO C;  3IGA C;  5BR8 B;  4DR5 B;  1WB8 A;  1ZWI C;  2X6A A;  3B40 A;  1S5H C;  1Y6X A;  5J2U B;  4JYA O;  1XDC A;  3K9S A;  4HAM A;  1FAF A;  1XEQ A;  1J95 A;  3SPH A;  2YDE A;  1HNW O;  1BE3 H;  1SS3 A;  5KMG B;  4RUF A;  2KKW A;  1Y74 A;  2XTA A;  3D3I A;  1Q8I A;  2GSM B;  4D6T H;  1V55 C;  2PTM A;  4IHJ B;  2ADP A;  3JAS A;  5IJ9 A;  3I5D A;  4XDJ A;  2JEU A;  1SA0 B;  3RFR A;  1UJW B;  4GZR B;  2VRZ A;  1XL6 A;  3P3N A;  2LGW A;  2KQX A;  1MSW D;  2EJ7 A;  2EZO A;  3OMA B;  4B3M B;  5KUK A;  1YVW A;  5J2T A;  3FB7 C;  4R50 A;  1YDX A;  4JI7 B;  2PZS A;  3OGC C;  4HZ3 A;  1KP3 A;  3B8N A;  1XHX A;  2UXX A;  3BEH A;  3FAV A;  1SQP H;  4O4L B;  5D5Q A;  4LNU B;  4TQD A;  2EIK B;  4ZI7 A;  2EIJ B;  1H5W A;  4B3R B;  2CH7 A;  2H8P C;  4DV0 O;  2XAS A;  3HKC B;  3SPC A;  2UUB B;  4TV8 B;  1FXV A;  3JAT B;  1H2L A;  4AHC A;  3DTU B;  2R72 A;  2Q8V A;  1NS1 A;  3N27 A;  4J9Z B;  3STL C;  1SQQ H;  5ITZ A;  3ZHU A;  2YI9 A;  4BAY A;  2EIL C;  3UT5 B;  3RYI A;  5LP6 A;  1DTO A;  4TQF A;  1B04 A;  1IXM A;  4OGQ B;  1GM8 A;  3STZ C;  1P84 F;  3ETD A;  4CC6 A;  1W59 A;  4MTX A;  3VQV A;  1K9M W;  4LFB O;  4RO2 A;  1Q86 W;  3UO2 A;  2YEV B;  4RUE A;  5L3F A;  2OTL V;  5JVD A;  2WSS G;  1GKF A;  1M56 B;  2X6B A;  5EYP B;  5B5E Z;  4UCV A;  4GKK O;  1H2G A;  1G8M A;  3VQW A;  2HHH O;  1IBM B;  1Z2G A;  4O4H B;  4OPA A;  1Y76 A;  5FPO A;  1FOU A;  2QWO B;  5KUM A;  4LFA O;  1N0N A;  1F51 A;  1QLN A;  1PM9 A;  1AJN A;  3ZHR A;  3ZRX A;  1RM1 B;  5A2Q N;  2Y69 C;  4LF7 B;  2JS5 A;  1GAX A;  1GK9 A;  1AI5 A;  2ATK C;  1XNQ B;  2D3O W;  3CRA A;  1YSC A;  2FL4 A;  4A5U B;  1IDS A;  1ARO P;  5JVD B;  1BGY H;  4R7C A;  4FFB A;  1ROP A;  3E2E A;  4BWA A;  4O4H A;  3OTF A;  4TUY A;  1MG1 A;  4J41 A;  1IBM O;  4B08 A;  3T1H O;  2XUM A;  1BCC H;  2HFE C;  4UB8 Z;  5EBM C;  1XOU A;  4I50 A;  4IYH A;  4ZKI A;  5LGN A;  3BFR A;  1ZUQ A;  2ARH A;  4K8X A;  3CCQ V;  5DEC A;  3CCJ V;  4I5S A;  3IFX A;  2W0X A;  3G71 V;  1HR0 O;  3K5O A;  3CCU V;  4F6R B;  1YJN V;  3A0B Z;  5L3B A;  2P6J A;  4DW1 A;  4KHP O;  3HKE B;  4DRX B;  1OCO C;  4GX0 A;  4YJ3 B;  1VF6 C;  4DR6 B;  4U7N A;  3JAS B;  4U3J A;  4FZ0 A;  3K08 A;  2PI5 A;  1L0N H;  4X1K B;  3FAV B;  2VS0 A;  2ZE7 A;  4I50 B;  4DUZ B;  1I7F A;  1IBK O;  4DV7 B;  5J2T B;  5GTI Z;  3CRQ A;  2BE3 A;  3ZIA G;  5JQG A;  3TGU H;  2AXT Z;  2XAH A;  3BHP A;  4B3T B;  3DC6 A;  5LOV B;  2UUC O;  5H5N A;  3JSL A;  4DO2 A;  2RJZ A;  4TV9 A;  4Z1M G;  2P5O A;  1XHZ A;  1PL4 A;  1WP8 A;  5A9G A;  3E89 A;  4P30 A;  1NJI W;  3K58 A;  1P4R A;  2YIC A;  4UCU A;  4CH4 A;  2LP7 A;  1IXB A;  1HWY A;  4X89 A;  3G6B A;  3CSX A;  3ABK C;  4JI7 O;  2RCV A;  4H13 B;  4DR4 B;  1YJ9 V;  4HNA A;  4Q6G A;  4NXM O;  3JAL B;  1VQ8 V;  4MVO A;  3DC5 A;  3ASN C;  5LBQ A;  4FM2 A;  4ZBM A;  3OR6 C;  4TV9 B;  1YIJ V;  2XT9 A;  3ZHS A;  3SPJ A;  1WAZ A;  2QSA A;  2CK3 G;  1R3K C;  4IL6 Z;  4E2L A;  5CMU A;  4FLX A;  4LR3 A;  2H94 A;  5FLX N;  4MTG A;  2MK3 A;  3OMI B;  2Y69 B;  1N32 B;  4XDL A;  3P3P A;  4DV1 O;  4EFB A;  4H37 A;  3N2G B;  1AJP A;  1UFI A;  3LUT B;  4FLU A;  4N21 A;  4U3J B;  4DR7 O;  1B3Q A;  2Y0I A;  3OR7 C;  4NKG B;  1AB3 A;  2OYQ A;  4DUZ O;  4YJ2 A;  1GN6 A;  4LF6 O;  4GKK B;  3F5W C;  4GKJ O;  4PDL A;  4JI4 O;  2QWQ B;  3E8H A;  4I7Z B;  1TUB B;  1SC5 B;  3BA9 A;  3ZMZ A;  4FPP A;  4X65 O;  4OX9 O;  2UU9 B;  5ITZ B;  2GDS A;  2P67 A;  3T4D A;  4MT8 A;  4U3F H;  3AG3 C;  3RT3 C;  4GUN A;  3DXR A;  5FNV A;  5B3S C;  4DV2 O;  2AGA A;  5CBG A;  3H1H H;  4DV4 O;  2YS8 A;  2JS3 A;  3CHX A;  1KUQ A;  3IC7 A;  4CBC A;  4J10 A;  1G6U A;  4D7S A;  1Z5V A;  5IE9 A;  1DK1 A;  1FXK B;  4DR2 B;  1CXZ B;  4JYB A;  3CXH F;  2PI4 A;  1VAR A;  1TUE B;  4YJ2 B;  3THO A;  3E8B A;  5EC2 C;  2Z3Y A;  3JYC A;  2QKC A;  4TV8 A;  2IU0 A;  3JAT A;  1IZ3 A;  2N04 A;  1N0J A;  4I4T B;  4ABM A;  3IAY A;  4DK0 A;  2VWK A;  1OCC C;  3BY6 A;  4NXN O;  4H44 B;  3ASO B;  2ZR2 A;  4QNH B;  4JI3 B;  3B4S A;  1N4C A;  1K7D A;  3QTC A;  2L35 A;  3ZN0 A;  1KEC A;  1ZX3 A;  2ZIM A;  2R9R B;  3RN4 A;  4X62 B;  4DUY O;  1ENV A;  2KG7 B;  3UM7 A;  4JI8 B;  2ILM A;  3G67 A;  2XND G;  3H1I H;  4UCO A;  4JI3 O;  3ZN1 A;  1XRE A;  4FJC C;  2BSK B;  4DR3 O;  3UKM A;  4D7T A;  1R1B A;  2Z0A A;  3ZMT A;  1OCR B;  2O57 A;  3K57 A;  1QVF U;  3EHB B;  2GUZ B;  4H33 A;  3EFF K;  2GBO A;  2Q4P A;  4BW5 A;  3CP1 A;  4AI8 A;  3RYF B;  3CYO A;  2Q9L A;  3H1K H;  2JGU A;  3R65 A;  4G2K A;  3JD0 A;  1BS3 A;  4K8Z A;  1JNB A;  1O9G A;  2RDC A;  3WG7 C;  4J80 A;  2AHY A;  4QGP A;  4JI5 B;  3B09 A;  3N2K A;  2DYS B;  5E1A C;  2CTP A;  4CS4 A;  1P49 A;  1SKV A;  2OIG A;  4WFG A;  4O2A A;  2NLJ C;  4N23 A;  4MVM A;  4GYC B;  3RYF A;  3L72 H;  1M90 W;  5H9C A;  5LYJ A;  5LHG A;  5IYZ B;  4I4T A;  3JAK B;  1EN5 A;  3L9D A;  4PI2 A;  1F23 A;  3RVY A;  1TGO A;  2P90 A;  3CD6 V;  2DQ0 A;  3AK2 A;  3U10 A;  2BOB C;  1K8A W;  3CE2 A;  3CC7 V;  1R3L C;  1B06 A;  5FNV B;  5CA1 A;  3E8F A;  3G6E V;  4O2A B;  2JK5 C;  1M5I A;  3RWR D;  1QNM A;  3CRR A;  4UFZ A;  3SPG A;  3ICX A;  2P4V A;  2XAG A;  1COW G;  1OHH G;  3HPL C;  5EIB C;  3VOU A;  5J2U A;  5L3E A;  2A3Q A;  1K34 A;  1GRJ A;  2F66 C;  2JGD A;  2WA3 A;  4KFM A;  3ZMS A;  4QE9 A;  3FD9 A;  1ZLZ A;  4WF9 V;  3IJ4 A;  5DM6 V;  1V54 C;  4UVC A;  1W0K G;  5B1A C;  1I5Y A;  1NR7 A;  1MMM A;  2IW5 A;  2E75 B;  2IJJ A;  4ZOL A;  3HKD B;  4X64 B;  1LNQ A;  1NVP B;  1H2S B;  1VQ5 V;  3MD0 A;  3J81 N;  4UVA A;  1M9N A;  3WG7 B;  1W2B U;  4PA6 A;  1FKA O;  1RSO B;  1US6 A;  1Q7Y W;  2F4V B;  2CAZ C;  2QWN B;  3E22 B;  1IBL B;  1YHQ V;  3QO5 A;  5EBW C;  4NTY A;  1VQK V;  3G4S V;  1FPO A;  4IIJ B;  1GN4 A;  2V4D A;  4TT3 G;  3JD4 A;  4QIW F;  1N33 O;  2WLJ A;  1NU1 H;  3APO A;  1D2D A;  4NTW A;  1M57 C;  4MW8 A;  1QLE B;  2V1D A;  4B3S O;  3W7T A;  3ABM B;  3KZI Z;  5CBH A;  4WCE V;  4NXM B;  4GX2 A;  1HR0 B;  3SR2 C;  2ZR3 A;  5JJE B;  4DV2 B;  1O9H A;  3JSN A;  1CP9 A;  1FFT B;  1NI8 A;  1N36 O;  1NH2 B;  5HFL A;  1OCC B;  1QCE A;  2E76 B;  2OCC C;  4MVS A;  2QJ1 A;  4FLY A;  2UUA B;  2A0L A;  1CEZ A;  4K35 A;  1F7Y A;  3W7W A;  2Q6A A;  3CS5 A;  5GON B;  2Z5U A;  3KCX A;  4AQY O;  1FFX B;  3ABM C;  3W7X A;  1AR1 B;  4IHJ A;  5IWA B;  2A9H A;  3T1Y B;  5IYC O;  3UCS C;  1Q6U A;  2JEX A;  3AG2 C;  1EN6 A;  1D5N A;  1G1X B;  2WLH A;  1SRY A;  1L8D A;  5B3S B;  3E22 A;  4B7E A;  1XMO O;  2EIM C;  2A7W A;  3CCM V;  1SER A;  3AEI A;  3RYH B;  4FMT A;  2VWJ A;  3SYO A;  1JFF B;  4UVB A;  2JIZ G;  2LFR A;  3H1J H;  3AG4 B;  1Q3E A;  4TUY B;  1KC8 W;  4JI0 O;  2R9A A;  3WB0 A;  2CTQ A;  2QGN A;  4I55 B;  4X20 A;  5C8Y A;  2QTO A;  1VQL V;  1P7B A;  1BL8 A;  1BT8 A;  2ZDI C;  4MS2 A;  4QPK A;  4DV7 O;  1R6N A;  1U96 A;  1MNG A;  3SGI A;  1S5L Z;  3RVZ A;  3QO8 A;  4ZIB A;  3RYC B;  1XL4 A;  4JAA A;  2WA4 A;  3D36 A;  3FB6 C;  1XMQ B;  2UUC B;  2DQ3 A;  2BCC H;  2WAM A;  4I0X B;  1AI4 A;  2HR3 A;  4KHP B;  5LL6 Y;  4LF5 O;  3F7Y C;  5LMN B;  1SQB H;  1IVS A;  2HKO A;  4GX5 A;  2B9Z A;  3OMN B;  3L71 H;  5LGT A;  2ZIO A;  2GV9 A;  1HP8 A;  5H6R A;  1AVM A;  1GN3 A;  2DMX A;  3Q4H A;  2M7W A;  3OUS A;  1Y66 A;  2ZDI A;  1S76 D;  2WLK A;  1MZE A;  2QDO A;  2QWR B;  3E35 A;  1NZ6 A;  2LJ2 A;  5LMU B;  4BR6 A;  1YEW A;  2Q73 A;  3LDD A;  2WLI A;  4WBN B;  4JAU A;  1YTF D;  3E86 A;  1ZL8 B;  1NTM H;  4RQF A;  2PYJ A;  4BIU A;  1B6Q A;  4DR1 O;  3DGE A;  4EEQ A;  1L1F A;  3JCU Z;  4HYO A;  3TJT A;  4TOI A;  3NR7 A;  2PF4 E;  4JAS A;  5IJ0 B;  5AG2 A;  3TXS A;  2AHZ A;  2VQF B;  2QEX V;  1EFR G;  2ETN A;  4AIL C;  2Q68 A;  4O4I A;  4JYY A;  3JAM N;  2EIK C;  2WPD G;  4GKJ B;  1SQF A;  3L75 H;  2KSD A;  4B3R O;  3R66 A;  3ZX6 A;  2HHH B;  1JQ0 A;  1FXH A;  3K79 A;  2DOS A;  2YXL A;  2IBZ H;  4PA9 A;  4MTO A;  4JYC A;  1KQS U;  2A06 H;  1FFX A;  1X4T A;  4CS3 A;  2QM7 A;  3SJA C;  2IM9 A;  5EC1 C;  2UXB O;  2JDI G;  3ABT A;  4WFF A;  2VQE O;  2ZE6 A;  4EKW A;  5CA3 A;  4IIJ A;  5KMG A;  1VQ4 V;  2GHY A;  1S72 V;  3AK3 A;  3RW0 A;  1VQ7 V;  1SZX A;  4K0K O;  1Q82 W;  4JAV A;  5EYP A;  1BMF G;  3U11 A;  5EBL C;  2P4K A;  1HNW B;  3ZRW A;  3AK1 A;  4LFC O;  5H2F Z;  4XBF A;  4JV5 B;  1JMK C;  3HKB A;  3CJH B;  3QO7 A;  2G38 A;  2ITC C;  1Y67 A;  1VQO V;  4J7J A;  4HNA B;  4QE7 A;  2HLD G;  3LNM B;  5BR8 O;  4DR5 O;  1IUR A;  3FX7 A;  2DJV A;  2LFS A;  5LHI A;  3X2Q B;  4LF4 O;  5LXT A;  2C2A A;  1RPR A;  3ZRW B;  4YHH O;  2YIB A;  4UCS A;  5KHJ A;  5CA0 A;  5B1B C;  1F4M A;  4FK5 C;  5BMV A;  4J9Y B;  1Q6H A;  2K1E A;  3K03 A;  3CX5 F;  3HB3 B;  2ZNJ A;  4GT1 A;  3M99 B;  4JI6 B;  1L0L H;  2WLN A;  1QU7 A;  4UV8 A;  3E8G A;  3F5T A;  2UUA O;  3EVK A;  2ZM6 O;  5KHK A;  2WLI B;  4WBN A;  1VF7 A;  1KU9 A;  2F95 B;  2FTK A;  5JCO A;  1FD9 A;  1AIL A;  4ZHQ A;  2PGG A;  5C8Y B;  3S3X A;  1U97 A;  5KA6 A;  1XUQ A;  1XI1 A;  3JCZ A;  4X1I A;  4DR7 B;  1R3J C;  4LC1 A;  4OPH A;  2HJF C;  1N36 B;  1GO3 F;  4LH7 A;  4K0K B;  4IT5 A;  4PA4 A;  3RGB A;  4I0X A;  4FLV A;  1EBO A;  1VQ6 V;  1Q90 D;  1M56 C;  3APQ A;  2EIN B;  4MVQ A;  2ZIN A;  3ZBH A;  2EBO A;  1Y74 B;  3CC2 V;  1Q43 A;  1NTK H;  3IC9 A;  1MSD A;  1K4C C;  3SDL A;  1AI6 A;  5KX5 B;  3ZJZ A;  3FB5 C;  4EFE A;  1FYJ A;  4PD4 F;  1HNX B;  5GW7 A;  1PNM A;  4CH5 A;  4X1I B;  3MHS C;  2XAJ A;  2Y48 A;  2CTW A;  3ZED A;  4DV5 O;  4GCZ A;  3WU2 Z;  3QF7 A;  5J9P C;  2E5L B;  4I55 A;  4X20 B;  1VQP V;  3JAK A;  4BIZ A;  1IJG A;  4L87 A;  1WPB A;  3SJQ C;  2EIN C;  1R3I C;  1PP9 H;  2BOC C;  3L70 H;  2IJK A;  3T1Y O;  1JX9 A;  5E79 Z;  1LUV A;  3SYA A;  3SYQ A;  3ASN B;  1W0J G;  4FLW A;  3JD3 A;  3C90 A;  2DWD C;  1EM1 A;  4YXW G;  1FJG O;  4DRX A;  2A79 B;  1PV0 A;  5CA1 B;  1QR8 A;  3K59 A;  5IJ0 A;  1MZF A;  3B2E E;  2CGO A;  4PA3 A;  2IH3 C;  3PN1 A;  1VF5 B;  2CE4 A;  3B77 A;  2XAQ A;  2XHB A;  4NTX A;  1XNR B;  5EK0 A;  5B1B B;  2DN9 A;  3ABU A;  1EN4 A;  1YF2 A;  1TA8 A;  3L73 H;  4JI6 O;  1VP7 A;  2CTR A;  4GX1 A;  3X2Q C;  5IY5 C;  1EZV H;  1GM7 A;  2OTJ V;  3AG2 B;  2ZQM A;  1RFY A;  4UV9 A;  4JZ2 A;  3CCV V;  2W6I G;  4P2Z A;  1N33 B;  4LNU A;  3FYI B;  1AP5 A;  4CS2 A;  2WWW A; 
#chains in the Genus database with same CATH homology
 3DC5 A;  1SZX A;  1MA1 A;  2QKA A;  1AVM A;  1GN3 A;  1QNM A;  3OT7 A;  1I08 A;  4C7U A;  2P4K A;  3RN4 A;  3AK1 A;  3LSU A;  4BR6 A;  3BFR A;  1ZUQ A;  3IC9 A;  1MSD A;  1XRE A;  1Y67 A;  3MDS A;  3QVN A;  1XIL A;  1GN2 A;  1KKC A;  4E4E A;  2CDY A;  1ZLZ A;  4X9Q A;  3C3T A;  1GN6 A;  4YIO A;  3TJT A;  1EN6 A;  1D5N A;  2AW9 A;  1LUW A;  3C3S A;  1BS3 A;  1MMM A;  1IX9 A;  5AG2 A;  4FFK A;  1WB7 A;  1WB8 A;  1LUV A;  2GDS A;  1BSM A;  1AR4 A;  4GUN A;  1VEW A;  1EM1 A;  1P7G A;  1XDC A;  3K9S A;  4JYY A;  1AR5 A;  3KKY A;  4F6E A;  3DC6 A;  3KDR A;  1JR9 A;  2CE4 A;  1PL4 A;  3EVK A;  5A9G A;  1ZTE A;  1GN4 A;  1N0N A;  1BT8 A;  1VAR A;  1EN4 A;  1PM9 A;  1EN5 A;  1MNG A;  1I0H A;  4JZG A;  2QKC A;  1IXB A;  2ADP A;  3AK2 A;  4YIP A;  1JA8 A;  1N0J A;  3CEI A;  2RCV A;  4JZ2 A;  1XUQ A;  1IDS A;  2ADQ B;  1ZSP A;  1AP6 A;  1B06 A;  3AK3 A;  1AP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...