1PM9A

Crystal structure of human mnsod h30n, y166f mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
196
structure length
196
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKNHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Amino acid substitution at the dimeric interface of human manganese superoxide dismutase
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1pm9A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1pm9A02
1IXBA 2ADPA 3OT7A 1XREA 1EN4A 1PM9A 4YIPA 1GN4A 3MDSA 1ZLZA 3TJTA 1GN6A 1MNGA 1QNMA 4GUNA 3AK1A 3IC9A 1Y67A 1BSMA 1ZSPA 1VARA 4BR6A 1MSDA 1WB7A 1KKCA 1EN6A 1MA1A 1AP6A 1XDCA 1BS3A 3EVKA 1LUVA 2QKCA 2CE4A 3LSUA 4C7UA 1XILA 3BFRA 3C3SA 3DC6A 3QVNA 1D5NA 1PL4A 1N0JA 1I08A 5A9GA 1IDSA 1MMMA 1EM1A 1AR4A 1VEWA 1AVMA 3CEIA 1GN3A 3DC5A 3K9SA 1LUWA 1IX9A 4FFKA 4E4EA 1N0NA 4F6EA 1WB8A 1ZUQA 1AP5A 1I0HA 3AK3A 3KKYA 1P7GA 2CDYA 1JA8A 1B06A 5AG2A 2GDSA 1ZTEA 1EN5A 1SZXA 3AK2A 4JZ2A 2AW9A 2ADQB 4X9QA 1AR5A 1JR9A 2QKAA 2RCVA 3C3TA 1BT8A 3RN4A 4JZGA 4JYYA 1GN2A 4YIOA 1XUQA 2P4KA
chains in the Genus database with same CATH superfamily
5DECA 4YY3B 2QKSA 4DV7O 4TUYB 2P06A 3OMAB 2RQ6A 2LO1A 2Q4PA 3ETDA 5EYPB 3CRCA 3JAMN 3T1CA 3VQXA 2JVDA 1MNGA 4LF5O 1GM7A 1YZBA 1HW7A 1XBLA 4LH7A 1BSMA 4DR2O 1Q6UA 2KG7B 1COWG 3ASOC 4X20A 1GRJA 3STZC 3U10A 1RSOA 1SRYA 2V1DA 3RBZA 2QTSA 4R8CA 4GX2A 1GAXA 4ZI7A 1NU1H 2UUAB 3ASNB 5IJ0A 3I55V 1BL8A 1AB3A 1DF5A 4XDLA 4DR5B 4F4LA 4JTCB 1KYOF 3QO5A 3QTCA 1IZ3A 4K8ZA 2PI4A 2EIMB 3AG1C 2X6AA 3LNMB 3K3WA 4GCZA 4EFEA 4DR4B 3JCUZ 2EILC 3L75H 2UXCO 1B3QA 2PI5A 4FLXA 3K79A 1MZFA 2ZNJA 4LC1A 3H1KH 5BMVA 5EYPA 3SGIA 3VBBA 1BQZA 2EZOA 2P5OA 3K04A 3UT5A 2KB1A 1O9HA 3HR0A 3G71V 2QJ1A 5KA6A 2WLMA 3U11A 5JWPA 4O4LA 5B5EZ 2HJFC 4JZGA 3W7WA 5LMUB 3B4SA 4UUJC 4B08A 1T5EA 5K1XA 4OXSA 4CH6A 1IXBA 1SESA 2ZIOA 2B1IA 3G67A 4CZZA 4CS4A 4AI8A 1P84F 1VIBA 2EBOA 2R9IA 2XAFA 3K0DA 4FM2A 5KHIA 4WF9V 4JI4B 5B1AC 1M90W 1THZA 2IH1C 3L73H 4ZOLB 4FLTA 2HP8A 3B8MA 4W4KA 1Q43A 1MSWD 4NB5A 5LOVB 2CAZC 3AG2C 2ZE7A 1SF9A 2PZSA 2XAHA 3APQA 4LFBB 5CBHA 1QLEB 1AJNA 4JYBA 3OFNG 3ZMUA 3P3PA 4GX0A 2RJZA 2WLIA 3G4SV 1IJGA 5LXTA 4WCEV 4BIZA 1GN3A 5IYZB 4DV4B 3K9SA 5BY1A 1S77D 3CCRV 1IX9A 2UXDO 4B3TO 4LF6O 3NXSA 1R6TA 1HNZB 5B1NA 3MHHC 2Q9LA 1FAFA 1IURA 1ORQC 3OTOO 2WA3A 4J80A 3ETGA 1S5JA 2BOCC 2QE7G 4X1KA 5H6QA 5LA6B 2EJRA 3RYHB 1S5LZ 4LF4B 4DXWA 5LHIA 4JI2O 1US6A 5CA3A 4UB8Z 3ZRSA 2ZD9A 3AG3C 4F6RB 4B7KA 1HNWB 3JAKA 3H1IH 1NQTA 4PDVA 1PNKA 3BEHA 2W6JG 2VQEB 1K7DA 4MVZA 2QM8A 1KBHA 4L8JA 1PPJH 4O4IB 2PY5A 2DWDC 4H0LB 4DV1O 5IWAB 3BRCA 1V54C 4MVRA 2P22C 3SYPA 1XMOB 4O2AA 1FFXA 4TV9A 4FIPC 5C8YB 3ABLC 2LQTA 2KKWA 1XQ8A 4YY3O 4GZRB 2YC0A 3HKDA 1M1KW 4I0XA 3E8GA 3H01A 1M56B 1NR7A 4C7UA 3BFRA 2ZM6B 5CBFA 1I5XA 4WBNA 3N2KB 2XASA 2UXNA 5LA6A 3F5WC 5LL6Y 5B1BC 1QHTA 1NTMH 4QJFB 2CTRA 3IGAC 4O4HA 1W0KG 1SQVH 1SC5B 3F7YC 4FFKA 3CCEV 2DJVA 2R70A 2UXBO 4F6RA 2QWNB 1CP9A 1S0VA 4MW3A 3BABA 4TT3G 4FM1A 2UUAO 4LF9B 3FYIB 3KKYA 1IBMB 4DR5O 2ATKC 4GYCB 1SZXA 3HKBB 4GKKB 3GWKC 3KDRA 2NR5A 4QGPA 3BHPA 2YIAA 3CMAV 3LSSA 1VF6A 1G6UA 1L1FA 1N32B 1M5IA 3HKCB 3IC7A 4DR4O 4DUZO 3RVZA 4PA4A 4J7ZA 4LF7B 1KMIZ 3AG4B 3KG2A 4R7CA 5FNVB 4IIJB 4P9OA 4H13B 1IVSA 1H2SB 4HNAB 4P9PA 2X7RB 1V55B 1GTOA 3P3NA 5LMUO 1XI1A 1IXMA 1VF6C 4DR2B 2UUCO 3E22B 5CB4A 4JI3B 3BY6A 2PUSA 3K57A 3CSXA 3CS5A 1G4YB 3HKBA 2LP7A 1RM1C 2RMKB 1Q7YW 4JI4O 1ZL8B 3JYCA 4E2LA 3JASA 1GKFA 3OM3B 3UO2A 4BW5A 2W6IG 3HKCA 4DK0A 4HBNA 4AILC 4WFGA 4JTDB 3T4ZA 1K73W 4TV8B 2GBOA 3JALA 5AG2A 5LP6A 3HPLC 5JJNB 1P4RA 5FNVA 4IIJA 1K4CC 4PJ0Z 2NNUA 1Q86W 5JVDA 4DV4O 4HAMA 2FKXA 4HZ3A 4JAUA 1KQSU 3BA8A 1PL0A 2QDOA 3CCQV 2BSKB 1FXHA 3DSQA 1Z5WA 1HNZO 2BTQB 1FXKA 2EIJC 1XEQA 2UXXA 3J7AU 5JQGB 3X2QB 2PF4E 4YIOA 3JSLA 1NT2B 4EB6A 5LP6C 1ENVA 4RQFA 1Q6IA 2BTOA 2Q69A 2ZE5A 4N21A 3RYFB 3K08A 3OUFA 4GUNA 1PD3A 3A2FA 2Y0IA 1AJPA 4I55A 2NLJC 3GWOA 3OW2U 3ABUA 4RUFA 1FXKC 3CP1A 3ZRVA 3OEHG 3ABKB 1MSDA 1VQPV 1HNWO 1L0LH 3LNNA 5LYJA 4X1IB 1MA1A 2HG5C 1OCOC 2DYSB 5CA0A 2Y4TA 5IY5C 3W7SA 2RDCA 2E75B 3C3SA 4OPHA 2AHYA 1N0JA 3JD1A 3OAAG 3VQWA 2ETNA 2JS3A 3JD2A 3OR7C 5IWAO 3ZHTA 3CCMV 1NJIW 2ZR3A 3OGCC 2BSKA 1CPYA 3BAAA 3NR7A 3HKEB 2BTQA 3J80N 5C93A 4UVAA 4YJ2B 1YHQV 4B3TB 4LF6B 2X6CA 2OCHA 5B3SC 1JJ2U 2FB5A 2ZDIA 5EZYA 4J10A 4L87A 2ZM6O 2VQFB 3RT3C 2CDYA 1BCCH 3EXAA 3OTOB 4DV5O 3E35A 1NTZH 1SQXH 2PYJA 3D36A 3ICXA 3JAWB 1LR1A 3L72H 2Y69B 5LGUA 5IYCO 5DN6G 2D2CB 2P7TC 2HJDA 2R72A 4JI2B 3A0HZ 5EBMC 1WPXA 1VQLV 1TVKA 5KHHA 3RYIB 5A2QN 2CH7B 4X88A 4LF9O 1AROP 1IBMO 3ZS8C 1K33A 1L8DA 1VQOV 4BIUA 4G2KA 1YITV 4JV5B 5CA1B 2A9HA 4FLYA 3E89A 4NKGB 1O9GA 3TETA 4X89A 3D36C 4LCUC 3FAVB 4K8XA 3P30A 2EILB 2WLLB 5KA5A 4CBCA 3L71H 1N32O 2WPDG 1VQMV 1WA8A 3ABMB 3FB5C 4NYKA 4DK1A 1D2DA 5L3GA 1PNLA 2P4VA 4NTWA 2EIKC 2QWPB 3FFQA 4N23A 3OEEG 4LF7O 2JGUA 5IDJA 1LNQA 2XHBA 3W7TA 4CC5A 2YIBA 3B2EE 4H37A 5H6RA 3THOA 4J7KA 1H8HG 2K9PA 5CN0A 2FYUH 3JAWA 1Y74B 1D5NA 5EC2C 1PL4A 4FK5C 3UO3A 2YIBD 3JCZA 1AR4A 3CEIA 4GLXA 3ML0A 2LFRA 4MTOA 4PD4F 2F4VO 2GTSA 2CGOA 1JX9A 3OGIB 2UXBB 1AI4A 3G80A 4JI3O 5IJ9A 5LBQA 1WPBA 4MT8A 4IGGA 5F2VO 3ZMSA 4DV2O 1JA8A 1B06A 4I50B 2WSSG 4DRXB 4R6ZA 3FAVA 5H5NA 3CCSV 3ZRWB 1Z5VA 1NI8A 1F4MA 3RW0A 4R50A 3SPGA 3E2EA 4PA3A 1N8RW 1R3LC 4NXMO 4CH3A 1SQGA 2Z0AA 3UQ8A 4KFMA 3FYEB 4TUYA 4DUZB 4I5SA 4JYYA 2VWJA 3I5DA 2FMLA 4KP4A 4PA7A 1Q8IA 2F1MA 1OCRC 2F66C 2Q7HA 1QBZA 5KHKA 1GN6A 3T1YB 1BMFG 1YTFB 5L3EA 2KG7A 2DYRB 1GO3F 2Q0OC 2EINB 3ZHSA 4BWAA 4X62B 2UUCB 3OUSA 1U97A 4UV9A 3WU2Z 4QE9A 1NVPB 1HNXO 1EFRG 1AP6A 3ZX6A 4XBFA 5L3FA 3VQVA 5JH7B 4B3MB 3RYCB 2V4DA 4O2BB 2YEVB 5EIBD 3HB3B 1DGSA 5J2UB 1S72V 2DMXA 3CCLV 4WFHA 4GKJB 1QVGU 1OV9A 4P2ZA 4E4EA 1KP2A 2H8PC 3ASNC 4JAAA 1V9PA 3TCUA 2XAGA 4TQFA 2GHYA 3CPWU 2YI8A 1JPXA 1H2MA 4FFBB 1ZTEA 4JI7B 1EN5A 4O4JB 3ZRXA 2PGGA 4IT5A 3BPZA 2EIMC 5KAFZ 1CEZA 1E1QG 4K0KB 2CTQA 1XHZA 4JAVA 2OCCC 2RCVA 1KU9A 3C3TA 1S3JA 4PI2A 4TQDA 1YTFD 1BE3H 4LBEC 4DR6O 1WJZA 4JI6B 3CJHB 2Q8VA 1RPRA 5IYBO 3ZIAG 2GUZB 3OE7G 3DTUB 2N74A 2VQFO 5B1BB 4NTXA 3H1JH 1XUQA 2P4KA 3J81N 5JH7A 1NVPD 1GN4A 1P49A 4ZOLA 5EBLC 4O2BA 2FTKA 3IAYA 1ZWIC 2YEVA 3D3QA 3M99B 2F43G 3OMIB 3K5LA 2PTMA 2R9AA 5J2UA 5CBGA 5LOVA 3E86A 1TA8A 2ZE6A 1K34A 2YXYA 4JV5O 3QF7A 1Y76B 4IL6Z 5GONB 1BS3A 4X64O 2QKCA 1YI2V 5IYZA 3QVNA 3JARB 4FLZA 1FOUA 2ZT9B 4B3RB 3T1HO 3IFXA 5ITZB 2GUZA 2YDEA 3WG7B 1DF4A 1QLEC 4DV6B 2DE0X 4UCVA 1SETA 1H5WA 1E79G 4K35A 4DV5B 3RYHA 4YJ3B 1HP8A 1NR1A 1Q3EA 1Q90D 3EFFK 2IJKA 1SA0B 4UFZA 2X6BA 3QO7A 2HVJC 2A0LA 1JR9A 1Q5OA 2QKAA 2QR4A 1I94B 3CRRA 4DO2A 3ZMZA 3DXRB 1YDXA 4U7NA 1R3IC 4DR3B 2ZCEA 3CRAA 3BA9A 4U3JB 4QPKA 1EZJA 1FD9A 5E79Z 2HHHO 4O4IA 2IJHA 1K92A 5L3BA 3MAQA 1JNBA 4J42A 4FM0A 1AILA 3FX7A 1PNMA 2IJJA 5C8YA 3K5OA 1MOFA 1S5HC 1VQ4V 1H2KA 4FZ0A 1SZTA 4PELA 1TAEA 4MW8A 1BZKA 4IYHA 3F5TA 3N2KA 1W2BU 2YS8A 4DR1B 4UV8A 3WFVA 3VQYA 4JI0B 2ZR2A 2DOSA 2Z5UA 1H2LA 2QGNA 4DR7B 1SA0A 5KUKA 3T1YO 5H2FZ 1R6NA 1DTOA 5DM6V 3JD4A 1SQPH 2B5UA 2JEXA 4MTGA 3CB2A 3DXRA 4X62O 4D7SA 2O57A 1XMQB 2F4VB 1H2GA 4LF8B 3W7XA 5IYDO 4U3JA 2ZIMA 4NR1A 2DQ0A 1FYJA 1M56C 4G28B 3QG5A 1AP5A 2NN4A 4DV2B 2P67A 1P7GA 3CMEV 1FS0G 1I5YA 4B3MO 4X66B 3T4DA 4JZ2A 4KL1A 3KCYA 3A0BZ 3KCXA 1M57B 2BCCH 4UVCA 4KXRA 3M7MX 5EC1C 4GKJO 5GTIZ 4EEQA 5IY5B 4NXMB 1WP7A 4K3AA 2LW1A 4WFEA 1PKXA 2P6JA 3LDCA 4U7OA 4X1YB 3K58A 4UCRA 3O65A 5H9CA 3FB8C 1JFFB 2XAQA 2L35A 1R3JC 1FFTB 1HR0B 4JI7O 3IJ4A 4HNAA 4H33A 5E1AC 2KQXA 3PN1A 3H9VA 4K0KO 4DV0O 5LHHA 2ZXWB 2ARHA 4I4TB 1H38A 4PI0A 1AJQA 3E22A 5BXZA 3IC9A 4JI6O 4MSWC 1BQ0A 3LDDA 3DGEA 2QSAA 1KB9F 1PV0A 3AG4C 2C2AA 5KMGB 1WB7A 2YXLA 3K5NA 1HNXB 4EFBA 1ZL8A 2ITDC 4OPAA 4FLUA 4HYOA 3E8HA 2JDIG 4X8AA 1NS1A 2VS0A 3F7VC 4PV1B 1LUWA 2QM4A 4JTAB 2E74B 3JSNA 4LP8A 4TV8A 3RFRA 3CCJV 2F93B 1BHAA 4PA6A 4AQYB 2AHZA 4WFBV 1IBLO 3L9DA 1ZUQA 3AK3A 2ZINA 2QWOB 3ETQA 1GK9A 1B6QA 4ZIBA 4B3RO 3VOUA 2GTAA 4X9QA 5J2TB 5JQGA 1OCZC 1SKVA 4DR6B 2YI9A 1NH2B 4DV6O 1YSCA 2YXHA 3W7UA 1TUEB 3L70H 1GN2A 2CK3G 4LNUB 5GTHZ 4MVQA 1J5EB 3M8AA 1XOUA 3ASOB 2ADPA 4YXWG 1XREA 1WLEA 3B09A 3RYFA 3TGUH 3WB0A 4B3SB 1I94O 1OCCC 2DW4A 1QNMA 4DR3O 4X1IA 4CS2A 5BR8B 1IBKO 1Z2GA 2ZDIC 5HFLA 2P90A 1SQBH 2Q7GA 1AI6A 3T2MA 3MHSC 3A0RA 4X64B 3AG1B 3P32A 5EBWC 1XNQO 2CE4A 2Y48A 2Q67A 4X20B 3DC6A 4QIWF 2N05A 3HKEA 1RSOB 4QPJA 2QM7A 4YJ2A 3SJCC 1QR8A 4D6TH 2A06H 1KD1W 4ZI7B 1F7YA 4DUYB 2VRZA 3T1HB 3CWBH 3ABKC 3DC5A 3OTFA 4I9QA 1WNSA 2QWQB 1A32A 4XDJA 2DYSC 1OCRB 4DR1O 1BHBA 1Q81W 2YSUB 4LNUA 4JI0O 1YIJV 2WA4A 4RO2A 5BZBA 1NZ6A 3CD6V 3K0GA 3TXSA 4DR7O 4DW0A 3K5MA 3G6EV 1NH2D 1S76D 3E83A 1YXBA 2ILMA 1XL4A 1VQ6V 2G38A 2CTWA 1YVWA 3AK2A 4D7TA 4PHZA 3CC7V 3RYIA 2AGAA 5LGNA 4LFCB 1XMQO 2CH7A 4LF8O 4FMTA 5BMVB 2IW5A 2UUBB 1DK1A 1NBMG 2YICA 3UT5B 1N33B 4UCUA 5KLVH 2WLJA 5CA1A 5LHGA 1Y4MA 1OZ0A 2OYQA 3CXCU 4CH5A 3EHBB 5B1AB 2B1GA 3K9AA 1N34O 1HWYA 1VP7A 3ZCCA 4O4LB 2HHHB 4X66O 4J7JA 2WLLA 2Y69C 4JYAO 3AG2B 2BOBC 4CC6A 4YIPA 5JJJB 2CTPA 1K9MW 1R73A 4XDKA 1ZLZA 1NKDA 4OX9B 4BIOA 1X59A 2WLKA 2XAJA 4YHHB 2HLDG 1VMGA 1Y67A 2EX3A 1AR1B 4J41A 4TOIA 2Q73A 2ZKOA 1HR0O 4B7EA 4NTYA 1Y74A 4PDMA 3FB7C 5KUMA 1R1BA 2OCCB 1JMKC 2JRIA 1J95A 1ZX3A 2EJ7A 2WAMA 4PDRA 2F95B 3LDEA 4CS3A 4EKWA 3H1HH 3ABMC 1G8MA 3UCSC 4FZ1A 5JJEB 4FJCC 4UCTA 1VQ8V 1M93A 2K1EA 2A79B 1UJWB 1HDJA 2WLIB 4JI8O 5LXTB 2LJ2A 1I7FA 1N0NA 4I50A 3SPCA 3FKSG 4ZBMA 3SR2C 1K5QA 2E5LO 1WB8A 4DRXA 3E8FA 5LGTA 1QR9A 3K06A 3ZBHA 3ZRWA 3U0ZA 1YJNV 1AI5A 3ZHQA 5EK0A 2RN9A 4W4LA 2OTJV 3AG3B 2OTLV 3B8NA 2JIZG 2GV9A 2YUAA 1FJGB 2Q7EA 3SPHA 2OWOA 1FKAO 3QNEA 4AQYO 1GM9A 5L3DA 4X1KB 2LGWA 1RP3B 3D8CA 4PA9A 3AG7A 2QEXV 2YIDA 4J9ZB 1V54B 4QE7A 5EIBC 1M9NA 1N36B 4X65B 2BE3A 3BVOA 4ZHQB 1CXZB 1VQ9V 3ABLB 2IH3C 3N2GB 4BAYA 4DV0B 1UPGA 1QU7A 3TJTA 3JAKB 1K4DC 2ITCC 1KUQA 4DW1A 2RNBA 4MTXA 1KECA 4DV3B 4ZKIA 1N4CA 3RGBA 3LSQA 1K5SA 3WB2A 3GB7C 1JJOA 1J5EO 1MABG 1VQ5V 1WAZA 2WWWA 5TISZ 3RYCA 3EVKA 1FFXB 4O2AB 2XOKG 1LUVA 4TV9B 3ZMTA 4B3SO 2IU3A 2QA4V 2JJ2G 2DYRC 3FD9A 3CC4V 4LFAB 2A7WA 1IDSA 1F4NA 2EINC 2E76B 3BCCH 3HKDB 1JVMA 3JD0A 3RWRD 4I0XB 5D5PA 5BR8O 1VF7A 3ZJZA 2X0LA 4WBNB 3CXHF 3JD3A 2OIGA 1YJWV 2Q0AA 2ZQMA 4FFBA 3SYQA 3UM7A 2WLNA 1IBLB 4MVUA 1RFYA 4ZHQA 2OT5A 4JI1O 2F23A 5LMNB 3SYAA 4O4HB 4O4JA 1U96A 3N2GA 2GDSA 5FL7G 2LGQA 3ZN0A 3LUTB 1AI7A 2HR3A 4DUYO 2HVKC 4BW9A 2H94A 4FLWA 3CYOA 3CJHA 1WN7A 2IM9A 5L3CA 2IJIA 5GW7A 3ZHVA 4IYIA 5B1OA 5DEDA 2CGNA 3SDLA 2LW7A 4KHPB 2W0XA 3CC2V 1Y66A 3OT7A 2DN9A 1D5AA 4JASA 2B9ZA 4LFCO 2KSDA 4U3FH 1K8AW 1QCEA 2UUBO 2A3QA 4JF3A 2QTOA 3ZN1A 4NXNB 1YEWA 2FL4A 1N33O 3C90A 3FB6C 3AEIA 1RM1B 2HEPA 1Y76A 1IBKB 5GONA 2AXTZ 1ZSPA 4JI5B 1B04A 5JCOA 3JARA 1QVFU 1FXVA 1KKCA 1M4UA 2CUGA 4TSFG 1XDCA 4WFFA 4I7ZB 5IE9A 3K03A 1XNQB 4CH4A 1XNRB 2HKOA 4UVBA 4OX9O 1SQFA 1WP8A 4GT1A 5A9GA 3CE2A 5CB4B 1YCIA 2ZNIA 5ITZA 4YHHO 4I9WA 1VEWA 4UCOA 3OD4A 3A8TA 4JGSA 4LH6A 3TK1A 2UU9B 5CMUA 4GX5A 4MVOA 5FPRA 3CRMA 4YJ3A 3JASB 2XT9A 5JCOC 1F23A 3B40A 2MK3A 4Z1MG 4FVMA 2JJ1G 3JATB 2M6YA 2EIJB 4J11A 4AHCA 1Y6XA 3CHXA 2M7WA 4UXNA 3UKMA 4DV7B 3B77A 4A5UB 2D3OW 3SPIA 4UB6Z 1OJHA 1R6KA 3JALB 1F51A 5LP6B 4OGQB 1AR5A 3WG7C 3TXQA 4JPRA 4LF5B 4RUEA 5B66Z 5K1PA 1GM8A 5JVDB 5HFMA 1G1XB 1H8EG 4JYCA 2IBZH 1N34B 1PP9H 2H3OA 1VQ7V 1NTKH 4JYAB 1FXKB 1EN4A 1VQNV 1Q82W 1SS3A 2VWKA 1KKDA 1OCOB 1FJGO 1R3KC 2AZ0A 4EB6B 4ABMA 2EULA 3O9OA 1QLNA 4PDLA 2JEUA 3AK1A 3STLC 3K59A 1N36O 2Q6AA 5D5QA 4X65O 3CCVV 3JATA 3H1LH 2Q68A 2MW2B 4IHJB 1P7BA 3I56V 4TWKA 5B3SB 1TGOA 3R65A 4I55B 4LFBO 2Y4UA 1OCZB 2UXCB 4UCSA 5LYJB 1TUBB 1DLBA 1YF2A 5J9PC 3WB1A 2OIEA 2W0FC 1MMMA 1JOYA 5CA0B 1EM1A 1QQCA 1MG1A 4DV3O 2DWEC 3GVMA 4RQEA 3SJQC 4FLVA 4JI8B 4RAIA 1URFA 2E5LB 4RWUA 1SQQH 4ASUG 4Q6GA 2XUMA 1OCCB 1I0HA 1XHXA 1V55C 1FPOA 3Q4HB 2IU0A 2AZ2A 4LFAO 1KC8W 3RVYA 5EZYB 1W59A 1XL6A 4MVSA 2Z3YA 3ABTA 4X1YA 3MD0A 2DQ3A 4Q20A 1L0NH 1JFFA 4KUMA 4LF4O 2ODMA 3E8BA 3RN4A 3OR6C 1X4TA 3ETEA 4ICGA 3ZHRA 5FLXN 2LFSA 5LMNO 2Q5ZA 3SJAC 4IHJA 1ROPA 1VF5B 4WFAV 2JGDB 1TVKB 1Q6HA 2EIKB 1TUBA 3R66A 2JS5A 4I4TA 2PYLA 1M57C 1PM9A 1EZVH 2VQEO 1KP3A 3L74H 3MDSA 3G6BA 4P30A 4FPPA 2XTAA 1YJ9V 4GX1A 5KMGA 2EZPA 3CCUV 4Z2WA 3N27A 5KX5B 4LWSB 1ZAUA 2E3CA 2QWRB 1XMOO 1VARA 4MVMA 4KHPO 4Z1VA 4BR6A 4LR3A 3Q4HA 3SYOA 2UXDB 1RPOA 2N04A 1EN6A 1WA8B 3QO8A 1UFIA 4MS2A 3S3XA 1SERA 2Y0PA 1K3EA 5KHGA 3LSUA 1XILA 2ZXWC 5FPOA 2V7QG 4NXNO 1GMGA 1I08A 5KAIZ 3OMNB 1MZEA 4H44B 3APOA 4QNHB 3X2QC 1JCHA 2R9RB 3D3IA 4JI5O 4NVPA 5KHJA 1JQ0A 3CRQA 3SJBC 4F6EA 3ZMVA 2JGDA 4JI1B 1BGYH 3ZEDA 3SPJA 1OHHG 1XNRO 2JK5C 5IT9N 1GH6A 5IJ9B 1EBOA 5J2TA 3SYCA 3ZHUA 4J9YB 5IJ0B 1VQKV 4G27B 4GKKO 2L6LA 2AW9A 2GSMB 2ADQB 4MTFA 3PJSK 2ZE8A 2UU9O 5KX5A 2HFEC 4LWSA 1H2NA 3KZIZ 4DYLA 1BT8A 4DV1B 2XNDG 1W0JG 2WLHA 1K97A 1E1RG 3CX5F 3S3WA 1AVMA
chains in the Genus database with same CATH topology
1IXBA 2ADPA 3OT7A 1XREA 1EN4A 1PM9A 4YIPA 1GN4A 3MDSA 1ZLZA 3TJTA 1GN6A 1MNGA 1QNMA 4GUNA 3AK1A 3IC9A 1Y67A 1BSMA 1ZSPA 1VARA 4BR6A 1MSDA 1WB7A 1KKCA 1EN6A 1MA1A 1AP6A 1XDCA 1BS3A 3EVKA 1LUVA 2QKCA 2CE4A 3LSUA 4C7UA 1XILA 3BFRA 3C3SA 3DC6A 3QVNA 1D5NA 1PL4A 1N0JA 1I08A 5A9GA 1IDSA 1MMMA 1EM1A 1AR4A 1VEWA 1AVMA 3CEIA 1GN3A 3DC5A 3K9SA 1LUWA 1IX9A 4FFKA 4E4EA 1N0NA 4F6EA 1WB8A 1ZUQA 1AP5A 1I0HA 3AK3A 3KKYA 1P7GA 2CDYA 1JA8A 1B06A 5AG2A 2GDSA 1ZTEA 1EN5A 1SZXA 3AK2A 4JZ2A 3KDRA 2AW9A 2ADQB 4X9QA 1AR5A 1JR9A 2QKAA 2RCVA 3C3TA 1BT8A 3RN4A 4JZGA 4JYYA 1GN2A 4YIOA 1XUQA 2P4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXB A;  2ADP A;  3OT7 A;  1XRE A;  1EN4 A;  1PM9 A;  4YIP A;  1GN4 A;  3MDS A;  1ZLZ A;  3TJT A;  1GN6 A;  1MNG A;  1QNM A;  4GUN A;  3AK1 A;  3IC9 A;  1Y67 A;  1BSM A;  1ZSP A;  1VAR A;  4BR6 A;  1MSD A;  1WB7 A;  1KKC A;  1EN6 A;  1MA1 A;  1AP6 A;  1XDC A;  1BS3 A;  3EVK A;  1LUV A;  2QKC A;  2CE4 A;  3LSU A;  4C7U A;  1XIL A;  3BFR A;  3C3S A;  3DC6 A;  3QVN A;  1D5N A;  1PL4 A;  1N0J A;  1I08 A;  5A9G A;  1IDS A;  1MMM A;  1EM1 A;  1AR4 A;  1VEW A;  1AVM A;  3CEI A;  1GN3 A;  3DC5 A;  3K9S A;  1LUW A;  1IX9 A;  4FFK A;  4E4E A;  1N0N A;  4F6E A;  1WB8 A;  1ZUQ A;  1AP5 A;  1I0H A;  3AK3 A;  3KKY A;  1P7G A;  2CDY A;  1JA8 A;  1B06 A;  5AG2 A;  2GDS A;  1ZTE A;  1EN5 A;  1SZX A;  3AK2 A;  4JZ2 A;  2AW9 A;  2ADQ B;  4X9Q A;  1AR5 A;  1JR9 A;  2QKA A;  2RCV A;  3C3T A;  1BT8 A;  3RN4 A;  4JZG A;  4JYY A;  1GN2 A;  4YIO A;  1XUQ A;  2P4K A; 
#chains in the Genus database with same CATH topology
 5DEC A;  4YY3 B;  2QKS A;  4DV7 O;  4TUY B;  2P06 A;  3OMA B;  2RQ6 A;  2LO1 A;  2Q4P A;  3ETD A;  5EYP B;  3CRC A;  3JAM N;  3T1C A;  3VQX A;  2JVD A;  1MNG A;  4LF5 O;  1GM7 A;  1YZB A;  1HW7 A;  1XBL A;  4LH7 A;  1BSM A;  4DR2 O;  1Q6U A;  2KG7 B;  1COW G;  3ASO C;  4X20 A;  1GRJ A;  3STZ C;  3U10 A;  1RSO A;  1SRY A;  2V1D A;  3RBZ A;  2QTS A;  4R8C A;  4GX2 A;  1GAX A;  4ZI7 A;  1NU1 H;  2UUA B;  3ASN B;  5IJ0 A;  3I55 V;  1BL8 A;  1AB3 A;  1DF5 A;  4XDL A;  4DR5 B;  4F4L A;  4JTC B;  1KYO F;  3QO5 A;  3QTC A;  1IZ3 A;  4K8Z A;  2PI4 A;  2EIM B;  3AG1 C;  2X6A A;  3LNM B;  3K3W A;  4GCZ A;  4EFE A;  4DR4 B;  3JCU Z;  2EIL C;  3L75 H;  2UXC O;  1B3Q A;  2PI5 A;  4FLX A;  3K79 A;  1MZF A;  2ZNJ A;  4LC1 A;  3H1K H;  5BMV A;  5EYP A;  3SGI A;  3VBB A;  1BQZ A;  2EZO A;  2P5O A;  3K04 A;  3UT5 A;  2KB1 A;  1O9H A;  3HR0 A;  3G71 V;  2QJ1 A;  5KA6 A;  2WLM A;  3U11 A;  5JWP A;  4O4L A;  5B5E Z;  2HJF C;  4JZG A;  3W7W A;  5LMU B;  3B4S A;  4UUJ C;  4B08 A;  1T5E A;  5K1X A;  4OXS A;  4CH6 A;  1IXB A;  1SES A;  2ZIO A;  2B1I A;  3G67 A;  4CZZ A;  4CS4 A;  4AI8 A;  1P84 F;  1VIB A;  2EBO A;  2R9I A;  2XAF A;  3K0D A;  4FM2 A;  5KHI A;  4WF9 V;  4JI4 B;  5B1A C;  1M90 W;  1THZ A;  2IH1 C;  3L73 H;  4ZOL B;  4FLT A;  2HP8 A;  3B8M A;  4W4K A;  1Q43 A;  1MSW D;  4NB5 A;  5LOV B;  2CAZ C;  3AG2 C;  2ZE7 A;  1SF9 A;  2PZS A;  2XAH A;  3APQ A;  4LFB B;  5CBH A;  1QLE B;  1AJN A;  4JYB A;  3OFN G;  3ZMU A;  3P3P A;  4GX0 A;  2RJZ A;  2WLI A;  3G4S V;  1IJG A;  5LXT A;  4WCE V;  4BIZ A;  1GN3 A;  5IYZ B;  4DV4 B;  3K9S A;  5BY1 A;  1S77 D;  3CCR V;  1IX9 A;  2UXD O;  4B3T O;  4LF6 O;  3NXS A;  1R6T A;  1HNZ B;  5B1N A;  3MHH C;  2Q9L A;  1FAF A;  1IUR A;  1ORQ C;  3OTO O;  2WA3 A;  4J80 A;  3ETG A;  1S5J A;  2BOC C;  2QE7 G;  4X1K A;  5H6Q A;  5LA6 B;  2EJR A;  3RYH B;  1S5L Z;  4LF4 B;  4DXW A;  5LHI A;  4JI2 O;  1US6 A;  5CA3 A;  4UB8 Z;  3ZRS A;  2ZD9 A;  3AG3 C;  4F6R B;  4B7K A;  1HNW B;  3JAK A;  3H1I H;  1NQT A;  4PDV A;  1PNK A;  3BEH A;  2W6J G;  2VQE B;  1K7D A;  4MVZ A;  2QM8 A;  1KBH A;  4L8J A;  1PPJ H;  4O4I B;  2PY5 A;  2DWD C;  4H0L B;  4DV1 O;  5IWA B;  3BRC A;  1V54 C;  4MVR A;  2P22 C;  3SYP A;  1XMO B;  4O2A A;  1FFX A;  4TV9 A;  4FIP C;  5C8Y B;  3ABL C;  2LQT A;  2KKW A;  1XQ8 A;  4YY3 O;  4GZR B;  2YC0 A;  3HKD A;  1M1K W;  4I0X A;  3E8G A;  3H01 A;  1M56 B;  1NR7 A;  4C7U A;  3BFR A;  2ZM6 B;  5CBF A;  1I5X A;  4WBN A;  3N2K B;  2XAS A;  2UXN A;  5LA6 A;  3F5W C;  5LL6 Y;  5B1B C;  1QHT A;  1NTM H;  4QJF B;  2CTR A;  3IGA C;  4O4H A;  1W0K G;  1SQV H;  1SC5 B;  3F7Y C;  4FFK A;  3CCE V;  2DJV A;  2R70 A;  2UXB O;  4F6R A;  2QWN B;  1CP9 A;  1S0V A;  4MW3 A;  3BAB A;  4TT3 G;  4FM1 A;  2UUA O;  4LF9 B;  3FYI B;  3KKY A;  1IBM B;  4DR5 O;  2ATK C;  4GYC B;  1SZX A;  3HKB B;  4GKK B;  3GWK C;  3KDR A;  2NR5 A;  4QGP A;  3BHP A;  2YIA A;  3CMA V;  3LSS A;  1VF6 A;  1G6U A;  1L1F A;  1N32 B;  1M5I A;  3HKC B;  3IC7 A;  4DR4 O;  4DUZ O;  3RVZ A;  4PA4 A;  4J7Z A;  4LF7 B;  1KMI Z;  3AG4 B;  3KG2 A;  4R7C A;  5FNV B;  4IIJ B;  4P9O A;  4H13 B;  1IVS A;  1H2S B;  4HNA B;  4P9P A;  2X7R B;  1V55 B;  1GTO A;  3P3N A;  5LMU O;  1XI1 A;  1IXM A;  1VF6 C;  4DR2 B;  2UUC O;  3E22 B;  5CB4 A;  4JI3 B;  3BY6 A;  2PUS A;  3K57 A;  3CSX A;  3CS5 A;  1G4Y B;  3HKB A;  2LP7 A;  1RM1 C;  2RMK B;  1Q7Y W;  4JI4 O;  1ZL8 B;  3JYC A;  4E2L A;  3JAS A;  1GKF A;  3OM3 B;  3UO2 A;  4BW5 A;  2W6I G;  3HKC A;  4DK0 A;  4HBN A;  4AIL C;  4WFG A;  4JTD B;  3T4Z A;  1K73 W;  4TV8 B;  2GBO A;  3JAL A;  5AG2 A;  5LP6 A;  3HPL C;  5JJN B;  1P4R A;  5FNV A;  4IIJ A;  1K4C C;  4PJ0 Z;  2NNU A;  1Q86 W;  5JVD A;  4DV4 O;  4HAM A;  2FKX A;  4HZ3 A;  4JAU A;  1KQS U;  3BA8 A;  1PL0 A;  2QDO A;  3CCQ V;  2BSK B;  1FXH A;  3DSQ A;  1Z5W A;  1HNZ O;  2BTQ B;  1FXK A;  2EIJ C;  1XEQ A;  2UXX A;  3J7A U;  5JQG B;  3X2Q B;  2PF4 E;  4YIO A;  3JSL A;  1NT2 B;  4EB6 A;  5LP6 C;  1ENV A;  4RQF A;  1Q6I A;  2BTO A;  2Q69 A;  2ZE5 A;  4N21 A;  3RYF B;  3K08 A;  3OUF A;  4GUN A;  1PD3 A;  3A2F A;  2Y0I A;  1AJP A;  4I55 A;  2NLJ C;  3GWO A;  3OW2 U;  3ABU A;  4RUF A;  1FXK C;  3CP1 A;  3ZRV A;  3OEH G;  3ABK B;  1MSD A;  1VQP V;  1HNW O;  1L0L H;  3LNN A;  5LYJ A;  4X1I B;  1MA1 A;  2HG5 C;  1OCO C;  2DYS B;  5CA0 A;  2Y4T A;  5IY5 C;  3W7S A;  2RDC A;  2E75 B;  3C3S A;  4OPH A;  2AHY A;  1N0J A;  3JD1 A;  3OAA G;  3VQW A;  2ETN A;  2JS3 A;  3JD2 A;  3OR7 C;  5IWA O;  3ZHT A;  3CCM V;  1NJI W;  2ZR3 A;  3OGC C;  2BSK A;  1CPY A;  3BAA A;  3NR7 A;  3HKE B;  2BTQ A;  3J80 N;  5C93 A;  4UVA A;  4YJ2 B;  1YHQ V;  4B3T B;  4LF6 B;  2X6C A;  2OCH A;  5B3S C;  1JJ2 U;  2FB5 A;  2ZDI A;  5EZY A;  4J10 A;  4L87 A;  2ZM6 O;  2VQF B;  3RT3 C;  2CDY A;  1BCC H;  3EXA A;  3OTO B;  4DV5 O;  3E35 A;  1NTZ H;  1SQX H;  2PYJ A;  3D36 A;  3ICX A;  3JAW B;  1LR1 A;  3L72 H;  2Y69 B;  5LGU A;  5IYC O;  5DN6 G;  2D2C B;  2P7T C;  2HJD A;  2R72 A;  4JI2 B;  3A0H Z;  5EBM C;  1WPX A;  1VQL V;  1TVK A;  5KHH A;  3RYI B;  5A2Q N;  2CH7 B;  4X88 A;  4LF9 O;  1ARO P;  1IBM O;  3ZS8 C;  1K33 A;  1L8D A;  1VQO V;  4BIU A;  4G2K A;  1YIT V;  4JV5 B;  5CA1 B;  2A9H A;  4FLY A;  3E89 A;  4NKG B;  1O9G A;  3TET A;  4X89 A;  3D36 C;  4LCU C;  3FAV B;  4K8X A;  3P30 A;  2EIL B;  2WLL B;  5KA5 A;  4CBC A;  3L71 H;  1N32 O;  2WPD G;  1VQM V;  1WA8 A;  3ABM B;  3FB5 C;  4NYK A;  4DK1 A;  1D2D A;  5L3G A;  1PNL A;  2P4V A;  4NTW A;  2EIK C;  2QWP B;  3FFQ A;  4N23 A;  3OEE G;  4LF7 O;  2JGU A;  5IDJ A;  1LNQ A;  2XHB A;  3W7T A;  4CC5 A;  2YIB A;  3B2E E;  4H37 A;  5H6R A;  3THO A;  4J7K A;  1H8H G;  2K9P A;  5CN0 A;  2FYU H;  3JAW A;  1Y74 B;  1D5N A;  5EC2 C;  1PL4 A;  4FK5 C;  3UO3 A;  2YIB D;  3JCZ A;  1AR4 A;  3CEI A;  4GLX A;  3ML0 A;  2LFR A;  4MTO A;  4PD4 F;  2F4V O;  2GTS A;  2CGO A;  1JX9 A;  3OGI B;  2UXB B;  1AI4 A;  3G80 A;  4JI3 O;  5IJ9 A;  5LBQ A;  1WPB A;  4MT8 A;  4IGG A;  5F2V O;  3ZMS A;  4DV2 O;  1JA8 A;  1B06 A;  4I50 B;  2WSS G;  4DRX B;  4R6Z A;  3FAV A;  5H5N A;  3CCS V;  3ZRW B;  1Z5V A;  1NI8 A;  1F4M A;  3RW0 A;  4R50 A;  3SPG A;  3E2E A;  4PA3 A;  1N8R W;  1R3L C;  4NXM O;  4CH3 A;  1SQG A;  2Z0A A;  3UQ8 A;  4KFM A;  3FYE B;  4TUY A;  4DUZ B;  4I5S A;  4JYY A;  2VWJ A;  3I5D A;  2FML A;  4KP4 A;  4PA7 A;  1Q8I A;  2F1M A;  1OCR C;  2F66 C;  2Q7H A;  1QBZ A;  5KHK A;  1GN6 A;  3T1Y B;  1BMF G;  1YTF B;  5L3E A;  2KG7 A;  2DYR B;  1GO3 F;  2Q0O C;  2EIN B;  3ZHS A;  4BWA A;  4X62 B;  2UUC B;  3OUS A;  1U97 A;  4UV9 A;  3WU2 Z;  4QE9 A;  1NVP B;  1HNX O;  1EFR G;  1AP6 A;  3ZX6 A;  4XBF A;  5L3F A;  3VQV A;  5JH7 B;  4B3M B;  3RYC B;  2V4D A;  4O2B B;  2YEV B;  5EIB D;  3HB3 B;  1DGS A;  5J2U B;  1S72 V;  2DMX A;  3CCL V;  4WFH A;  4GKJ B;  1QVG U;  1OV9 A;  4P2Z A;  4E4E A;  1KP2 A;  2H8P C;  3ASN C;  4JAA A;  1V9P A;  3TCU A;  2XAG A;  4TQF A;  2GHY A;  3CPW U;  2YI8 A;  1JPX A;  1H2M A;  4FFB B;  1ZTE A;  4JI7 B;  1EN5 A;  4O4J B;  3ZRX A;  2PGG A;  4IT5 A;  3BPZ A;  2EIM C;  5KAF Z;  1CEZ A;  1E1Q G;  4K0K B;  2CTQ A;  1XHZ A;  4JAV A;  2OCC C;  2RCV A;  1KU9 A;  3C3T A;  1S3J A;  4PI2 A;  4TQD A;  1YTF D;  1BE3 H;  4LBE C;  4DR6 O;  1WJZ A;  4JI6 B;  3CJH B;  2Q8V A;  1RPR A;  5IYB O;  3ZIA G;  2GUZ B;  3OE7 G;  3DTU B;  2N74 A;  2VQF O;  5B1B B;  4NTX A;  3H1J H;  1XUQ A;  2P4K A;  3J81 N;  5JH7 A;  1NVP D;  1GN4 A;  1P49 A;  4ZOL A;  5EBL C;  4O2B A;  2FTK A;  3IAY A;  1ZWI C;  2YEV A;  3D3Q A;  3M99 B;  2F43 G;  3OMI B;  3K5L A;  2PTM A;  2R9A A;  5J2U A;  5CBG A;  5LOV A;  3E86 A;  1TA8 A;  2ZE6 A;  1K34 A;  2YXY A;  4JV5 O;  3QF7 A;  1Y76 B;  4IL6 Z;  5GON B;  1BS3 A;  4X64 O;  2QKC A;  1YI2 V;  5IYZ A;  3QVN A;  3JAR B;  4FLZ A;  1FOU A;  2ZT9 B;  4B3R B;  3T1H O;  3IFX A;  5ITZ B;  2GUZ A;  2YDE A;  3WG7 B;  1DF4 A;  1QLE C;  4DV6 B;  2DE0 X;  4UCV A;  1SET A;  1H5W A;  1E79 G;  4K35 A;  4DV5 B;  3RYH A;  4YJ3 B;  1HP8 A;  1NR1 A;  1Q3E A;  1Q90 D;  3EFF K;  2IJK A;  1SA0 B;  4UFZ A;  2X6B A;  3QO7 A;  2HVJ C;  2A0L A;  1JR9 A;  1Q5O A;  2QKA A;  2QR4 A;  1I94 B;  3CRR A;  4DO2 A;  3ZMZ A;  3DXR B;  1YDX A;  4U7N A;  1R3I C;  4DR3 B;  2ZCE A;  3CRA A;  3BA9 A;  4U3J B;  4QPK A;  1EZJ A;  1FD9 A;  5E79 Z;  2HHH O;  4O4I A;  2IJH A;  1K92 A;  5L3B A;  3MAQ A;  1JNB A;  4J42 A;  4FM0 A;  1AIL A;  3FX7 A;  1PNM A;  2IJJ A;  5C8Y A;  3K5O A;  1MOF A;  1S5H C;  1VQ4 V;  1H2K A;  4FZ0 A;  1SZT A;  4PEL A;  1TAE A;  4MW8 A;  1BZK A;  4IYH A;  3F5T A;  3N2K A;  1W2B U;  2YS8 A;  4DR1 B;  4UV8 A;  3WFV A;  3VQY A;  4JI0 B;  2ZR2 A;  2DOS A;  2Z5U A;  1H2L A;  2QGN A;  4DR7 B;  1SA0 A;  5KUK A;  3T1Y O;  5H2F Z;  1R6N A;  1DTO A;  5DM6 V;  3JD4 A;  1SQP H;  2B5U A;  2JEX A;  4MTG A;  3CB2 A;  3DXR A;  4X62 O;  4D7S A;  2O57 A;  1XMQ B;  2F4V B;  1H2G A;  4LF8 B;  3W7X A;  5IYD O;  4U3J A;  2ZIM A;  4NR1 A;  2DQ0 A;  1FYJ A;  1M56 C;  4G28 B;  3QG5 A;  1AP5 A;  2NN4 A;  4DV2 B;  2P67 A;  1P7G A;  3CME V;  1FS0 G;  1I5Y A;  4B3M O;  4X66 B;  3T4D A;  4JZ2 A;  4KL1 A;  3KCY A;  3A0B Z;  3KCX A;  1M57 B;  2BCC H;  4UVC A;  4KXR A;  3M7M X;  5EC1 C;  4GKJ O;  5GTI Z;  4EEQ A;  5IY5 B;  4NXM B;  1WP7 A;  4K3A A;  2LW1 A;  4WFE A;  1PKX A;  2P6J A;  3LDC A;  4U7O A;  4X1Y B;  3K58 A;  4UCR A;  3O65 A;  5H9C A;  3FB8 C;  1JFF B;  2XAQ A;  2L35 A;  1R3J C;  1FFT B;  1HR0 B;  4JI7 O;  3IJ4 A;  4HNA A;  4H33 A;  5E1A C;  2KQX A;  3PN1 A;  3H9V A;  4K0K O;  4DV0 O;  5LHH A;  2ZXW B;  2ARH A;  4I4T B;  1H38 A;  4PI0 A;  1AJQ A;  3E22 A;  5BXZ A;  3IC9 A;  4JI6 O;  4MSW C;  1BQ0 A;  3LDD A;  3DGE A;  2QSA A;  1KB9 F;  1PV0 A;  3AG4 C;  2C2A A;  5KMG B;  1WB7 A;  2YXL A;  3K5N A;  1HNX B;  4EFB A;  1ZL8 A;  2ITD C;  4OPA A;  4FLU A;  4HYO A;  3E8H A;  2JDI G;  4X8A A;  1NS1 A;  2VS0 A;  3F7V C;  4PV1 B;  1LUW A;  2QM4 A;  4JTA B;  2E74 B;  3JSN A;  4LP8 A;  4TV8 A;  3RFR A;  3CCJ V;  2F93 B;  1BHA A;  4PA6 A;  4AQY B;  2AHZ A;  4WFB V;  1IBL O;  3L9D A;  1ZUQ A;  3AK3 A;  2ZIN A;  2QWO B;  3ETQ A;  1GK9 A;  1B6Q A;  4ZIB A;  4B3R O;  3VOU A;  2GTA A;  4X9Q A;  5J2T B;  5JQG A;  1OCZ C;  1SKV A;  4DR6 B;  2YI9 A;  1NH2 B;  4DV6 O;  1YSC A;  2YXH A;  3W7U A;  1TUE B;  3L70 H;  1GN2 A;  2CK3 G;  4LNU B;  5GTH Z;  4MVQ A;  1J5E B;  3M8A A;  1XOU A;  3ASO B;  2ADP A;  4YXW G;  1XRE A;  1WLE A;  3B09 A;  3RYF A;  3TGU H;  3WB0 A;  4B3S B;  1I94 O;  1OCC C;  2DW4 A;  1QNM A;  4DR3 O;  4X1I A;  4CS2 A;  5BR8 B;  1IBK O;  1Z2G A;  2ZDI C;  5HFL A;  2P90 A;  1SQB H;  2Q7G A;  1AI6 A;  3T2M A;  3MHS C;  3A0R A;  4X64 B;  3AG1 B;  3P32 A;  5EBW C;  1XNQ O;  2CE4 A;  2Y48 A;  2Q67 A;  4X20 B;  3DC6 A;  4QIW F;  2N05 A;  3HKE A;  1RSO B;  4QPJ A;  2QM7 A;  4YJ2 A;  3SJC C;  1QR8 A;  4D6T H;  2A06 H;  1KD1 W;  4ZI7 B;  1F7Y A;  4DUY B;  2VRZ A;  3T1H B;  3CWB H;  3ABK C;  3DC5 A;  3OTF A;  4I9Q A;  1WNS A;  2QWQ B;  1A32 A;  4XDJ A;  2DYS C;  1OCR B;  4DR1 O;  1BHB A;  1Q81 W;  2YSU B;  4LNU A;  4JI0 O;  1YIJ V;  2WA4 A;  4RO2 A;  5BZB A;  1NZ6 A;  3CD6 V;  3K0G A;  3TXS A;  4DR7 O;  4DW0 A;  3K5M A;  3G6E V;  1NH2 D;  1S76 D;  3E83 A;  1YXB A;  2ILM A;  1XL4 A;  1VQ6 V;  2G38 A;  2CTW A;  1YVW A;  3AK2 A;  4D7T A;  4PHZ A;  3CC7 V;  3RYI A;  2AGA A;  5LGN A;  4LFC B;  1XMQ O;  2CH7 A;  4LF8 O;  4FMT A;  5BMV B;  2IW5 A;  2UUB B;  1DK1 A;  1NBM G;  2YIC A;  3UT5 B;  1N33 B;  4UCU A;  5KLV H;  2WLJ A;  5CA1 A;  5LHG A;  1Y4M A;  1OZ0 A;  2OYQ A;  3CXC U;  4CH5 A;  3EHB B;  5B1A B;  2B1G A;  3K9A A;  1N34 O;  1HWY A;  1VP7 A;  3ZCC A;  4O4L B;  2HHH B;  4X66 O;  4J7J A;  2WLL A;  2Y69 C;  4JYA O;  3AG2 B;  2BOB C;  4CC6 A;  4YIP A;  5JJJ B;  2CTP A;  1K9M W;  1R73 A;  4XDK A;  1ZLZ A;  1NKD A;  4OX9 B;  4BIO A;  1X59 A;  2WLK A;  2XAJ A;  4YHH B;  2HLD G;  1VMG A;  1Y67 A;  2EX3 A;  1AR1 B;  4J41 A;  4TOI A;  2Q73 A;  2ZKO A;  1HR0 O;  4B7E A;  4NTY A;  1Y74 A;  4PDM A;  3FB7 C;  5KUM A;  1R1B A;  2OCC B;  1JMK C;  2JRI A;  1J95 A;  1ZX3 A;  2EJ7 A;  2WAM A;  4PDR A;  2F95 B;  3LDE A;  4CS3 A;  4EKW A;  3H1H H;  3ABM C;  1G8M A;  3UCS C;  4FZ1 A;  5JJE B;  4FJC C;  4UCT A;  1VQ8 V;  1M93 A;  2K1E A;  2A79 B;  1UJW B;  1HDJ A;  2WLI B;  4JI8 O;  5LXT B;  2LJ2 A;  1I7F A;  1N0N A;  4I50 A;  3SPC A;  3FKS G;  4ZBM A;  3SR2 C;  1K5Q A;  2E5L O;  1WB8 A;  4DRX A;  3E8F A;  5LGT A;  1QR9 A;  3K06 A;  3ZBH A;  3ZRW A;  3U0Z A;  1YJN V;  1AI5 A;  3ZHQ A;  5EK0 A;  2RN9 A;  4W4L A;  2OTJ V;  3AG3 B;  2OTL V;  3B8N A;  2JIZ G;  2GV9 A;  2YUA A;  1FJG B;  2Q7E A;  3SPH A;  2OWO A;  1FKA O;  3QNE A;  4AQY O;  1GM9 A;  5L3D A;  4X1K B;  2LGW A;  1RP3 B;  3D8C A;  4PA9 A;  3AG7 A;  2QEX V;  2YID A;  4J9Z B;  1V54 B;  4QE7 A;  5EIB C;  1M9N A;  1N36 B;  4X65 B;  2BE3 A;  3BVO A;  4ZHQ B;  1CXZ B;  1VQ9 V;  3ABL B;  2IH3 C;  3N2G B;  4BAY A;  4DV0 B;  1UPG A;  1QU7 A;  3TJT A;  3JAK B;  1K4D C;  2ITC C;  1KUQ A;  4DW1 A;  2RNB A;  4MTX A;  1KEC A;  4DV3 B;  4ZKI A;  1N4C A;  3RGB A;  3LSQ A;  1K5S A;  3WB2 A;  3GB7 C;  1JJO A;  1J5E O;  1MAB G;  1VQ5 V;  1WAZ A;  2WWW A;  5TIS Z;  3RYC A;  3EVK A;  1FFX B;  4O2A B;  2XOK G;  1LUV A;  4TV9 B;  3ZMT A;  4B3S O;  2IU3 A;  2QA4 V;  2JJ2 G;  2DYR C;  3FD9 A;  3CC4 V;  4LFA B;  2A7W A;  1IDS A;  1F4N A;  2EIN C;  2E76 B;  3BCC H;  3HKD B;  1JVM A;  3JD0 A;  3RWR D;  4I0X B;  5D5P A;  5BR8 O;  1VF7 A;  3ZJZ A;  2X0L A;  4WBN B;  3CXH F;  3JD3 A;  2OIG A;  1YJW V;  2Q0A A;  2ZQM A;  4FFB A;  3SYQ A;  3UM7 A;  2WLN A;  1IBL B;  4MVU A;  1RFY A;  4ZHQ A;  2OT5 A;  4JI1 O;  2F23 A;  5LMN B;  3SYA A;  4O4H B;  4O4J A;  1U96 A;  3N2G A;  2GDS A;  5FL7 G;  2LGQ A;  3ZN0 A;  3LUT B;  1AI7 A;  2HR3 A;  4DUY O;  2HVK C;  4BW9 A;  2H94 A;  4FLW A;  3CYO A;  3CJH A;  1WN7 A;  2IM9 A;  5L3C A;  2IJI A;  5GW7 A;  3ZHV A;  4IYI A;  5B1O A;  5DED A;  2CGN A;  3SDL A;  2LW7 A;  4KHP B;  2W0X A;  3CC2 V;  1Y66 A;  3OT7 A;  2DN9 A;  1D5A A;  4JAS A;  2B9Z A;  4LFC O;  2KSD A;  4U3F H;  1K8A W;  1QCE A;  2UUB O;  2A3Q A;  4JF3 A;  2QTO A;  3ZN1 A;  4NXN B;  1YEW A;  2FL4 A;  1N33 O;  3C90 A;  3FB6 C;  3AEI A;  1RM1 B;  2HEP A;  1Y76 A;  1IBK B;  5GON A;  2AXT Z;  1ZSP A;  4JI5 B;  1B04 A;  5JCO A;  3JAR A;  1QVF U;  1FXV A;  1KKC A;  1M4U A;  2CUG A;  4TSF G;  1XDC A;  4WFF A;  4I7Z B;  5IE9 A;  3K03 A;  1XNQ B;  4CH4 A;  1XNR B;  2HKO A;  4UVB A;  4OX9 O;  1SQF A;  1WP8 A;  4GT1 A;  5A9G A;  3CE2 A;  5CB4 B;  1YCI A;  2ZNI A;  5ITZ A;  4YHH O;  4I9W A;  1VEW A;  4UCO A;  3OD4 A;  3A8T A;  4JGS A;  4LH6 A;  3TK1 A;  2UU9 B;  5CMU A;  4GX5 A;  4MVO A;  5FPR A;  3CRM A;  4YJ3 A;  3JAS B;  2XT9 A;  5JCO C;  1F23 A;  3B40 A;  2MK3 A;  4Z1M G;  4FVM A;  2JJ1 G;  3JAT B;  2M6Y A;  2EIJ B;  4J11 A;  4AHC A;  1Y6X A;  3CHX A;  2M7W A;  4UXN A;  3UKM A;  4DV7 B;  3B77 A;  4A5U B;  2D3O W;  3SPI A;  4UB6 Z;  1OJH A;  1R6K A;  3JAL B;  1F51 A;  5LP6 B;  4OGQ B;  1AR5 A;  3WG7 C;  3TXQ A;  4JPR A;  4LF5 B;  4RUE A;  5B66 Z;  5K1P A;  1GM8 A;  5JVD B;  5HFM A;  1G1X B;  1H8E G;  4JYC A;  2IBZ H;  1N34 B;  1PP9 H;  2H3O A;  1VQ7 V;  1NTK H;  4JYA B;  1FXK B;  1EN4 A;  1VQN V;  1Q82 W;  1SS3 A;  2VWK A;  1KKD A;  1OCO B;  1FJG O;  1R3K C;  2AZ0 A;  4EB6 B;  4ABM A;  2EUL A;  3O9O A;  1QLN A;  4PDL A;  2JEU A;  3AK1 A;  3STL C;  3K59 A;  1N36 O;  2Q6A A;  5D5Q A;  4X65 O;  3CCV V;  3JAT A;  3H1L H;  2Q68 A;  2MW2 B;  4IHJ B;  1P7B A;  3I56 V;  4TWK A;  5B3S B;  1TGO A;  3R65 A;  4I55 B;  4LFB O;  2Y4U A;  1OCZ B;  2UXC B;  4UCS A;  5LYJ B;  1TUB B;  1DLB A;  1YF2 A;  5J9P C;  3WB1 A;  2OIE A;  2W0F C;  1MMM A;  1JOY A;  5CA0 B;  1EM1 A;  1QQC A;  1MG1 A;  4DV3 O;  2DWE C;  3GVM A;  4RQE A;  3SJQ C;  4FLV A;  4JI8 B;  4RAI A;  1URF A;  2E5L B;  4RWU A;  1SQQ H;  4ASU G;  4Q6G A;  2XUM A;  1OCC B;  1I0H A;  1XHX A;  1V55 C;  1FPO A;  3Q4H B;  2IU0 A;  2AZ2 A;  4LFA O;  1KC8 W;  3RVY A;  5EZY B;  1W59 A;  1XL6 A;  4MVS A;  2Z3Y A;  3ABT A;  4X1Y A;  3MD0 A;  2DQ3 A;  4Q20 A;  1L0N H;  1JFF A;  4KUM A;  4LF4 O;  2ODM A;  3E8B A;  3RN4 A;  3OR6 C;  1X4T A;  3ETE A;  4ICG A;  3ZHR A;  5FLX N;  2LFS A;  5LMN O;  2Q5Z A;  3SJA C;  4IHJ A;  1ROP A;  1VF5 B;  4WFA V;  2JGD B;  1TVK B;  1Q6H A;  2EIK B;  1TUB A;  3R66 A;  2JS5 A;  4I4T A;  2PYL A;  1M57 C;  1PM9 A;  1EZV H;  2VQE O;  1KP3 A;  3L74 H;  3MDS A;  3G6B A;  4P30 A;  4FPP A;  2XTA A;  1YJ9 V;  4GX1 A;  5KMG A;  2EZP A;  3CCU V;  4Z2W A;  3N27 A;  5KX5 B;  4LWS B;  1ZAU A;  2E3C A;  2QWR B;  1XMO O;  1VAR A;  4MVM A;  4KHP O;  4Z1V A;  4BR6 A;  4LR3 A;  3Q4H A;  3SYO A;  2UXD B;  1RPO A;  2N04 A;  1EN6 A;  1WA8 B;  3QO8 A;  1UFI A;  4MS2 A;  3S3X A;  1SER A;  2Y0P A;  1K3E A;  5KHG A;  3LSU A;  1XIL A;  2ZXW C;  5FPO A;  2V7Q G;  4NXN O;  1GMG A;  1I08 A;  5KAI Z;  3OMN B;  1MZE A;  4H44 B;  3APO A;  4QNH B;  3X2Q C;  1JCH A;  2R9R B;  3D3I A;  4JI5 O;  4NVP A;  5KHJ A;  1JQ0 A;  3CRQ A;  3SJB C;  4F6E A;  3ZMV A;  2JGD A;  4JI1 B;  1BGY H;  3ZED A;  3SPJ A;  1OHH G;  1XNR O;  2JK5 C;  5IT9 N;  1GH6 A;  5IJ9 B;  1EBO A;  5J2T A;  3SYC A;  3ZHU A;  4J9Y B;  5IJ0 B;  1VQK V;  4G27 B;  4GKK O;  2L6L A;  2AW9 A;  2GSM B;  2ADQ B;  4MTF A;  3PJS K;  2ZE8 A;  2UU9 O;  5KX5 A;  2HFE C;  4LWS A;  1H2N A;  3KZI Z;  4DYL A;  1BT8 A;  4DV1 B;  2XND G;  1W0J G;  2WLH A;  1K97 A;  1E1R G;  3CX5 F;  3S3W A;  1AVM A; 
#chains in the Genus database with same CATH homology
 1IXB A;  2ADP A;  3OT7 A;  1XRE A;  1EN4 A;  1PM9 A;  4YIP A;  1GN4 A;  3MDS A;  1ZLZ A;  3TJT A;  1GN6 A;  1MNG A;  1QNM A;  4GUN A;  3AK1 A;  3IC9 A;  1Y67 A;  1BSM A;  1ZSP A;  1VAR A;  4BR6 A;  1MSD A;  1WB7 A;  1KKC A;  1EN6 A;  1MA1 A;  1AP6 A;  1XDC A;  1BS3 A;  3EVK A;  1LUV A;  2QKC A;  2CE4 A;  3LSU A;  4C7U A;  1XIL A;  3BFR A;  3C3S A;  3DC6 A;  3QVN A;  1D5N A;  1PL4 A;  1N0J A;  1I08 A;  5A9G A;  1IDS A;  1MMM A;  1EM1 A;  1AR4 A;  1VEW A;  1AVM A;  3CEI A;  1GN3 A;  3DC5 A;  3K9S A;  1LUW A;  1IX9 A;  4FFK A;  4E4E A;  1N0N A;  4F6E A;  1WB8 A;  1ZUQ A;  1AP5 A;  1I0H A;  3AK3 A;  3KKY A;  1P7G A;  2CDY A;  1JA8 A;  1B06 A;  5AG2 A;  2GDS A;  1ZTE A;  1EN5 A;  1SZX A;  3AK2 A;  4JZ2 A;  3KDR A;  2AW9 A;  2ADQ B;  4X9Q A;  1AR5 A;  1JR9 A;  2QKA A;  2RCV A;  3C3T A;  1BT8 A;  3RN4 A;  4JZG A;  4JYY A;  1GN2 A;  4YIO A;  1XUQ A;  2P4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...