3BFRA

The crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 78
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3bfrA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3bfrA02
2ADQB 5A9GA 4FFKA 3MDSA 1IX9A 3LSUA 1KKCA 1MA1A 1JA8A 3K9SA 3AK2A 3DC6A 1MSDA 1PM9A 3QVNA 1AR4A 4GUNA 1D5NA 1ZUQA 1GN6A 1AP6A 1GN3A 3EVKA 4YIOA 1AVMA 1IDSA 1MMMA 4E4EA 3OT7A 2RCVA 4BR6A 1IXBA 1ZSPA 1WB8A 1QNMA 2CE4A 1LUWA 1BSMA 1EM1A 1VARA 2QKAA 4JZGA 2P4KA 3CEIA 1XUQA 1BT8A 1I0HA 4JZ2A 1EN5A 1B06A 1XDCA 1WB7A 1BS3A 1LUVA 1Y67A 3TJTA 1VEWA 1AR5A 1XILA 3BFRA 4JYYA 1SZXA 1N0JA 1JR9A 1AP5A 1GN2A 3AK3A 2CDYA 1ZTEA 4C7UA 1XREA 2QKCA 4X9QA 1PL4A 1P7GA 3C3TA 1EN4A 1GN4A 1N0NA 1ZLZA 1I08A 3DC5A 3IC9A 3AK1A 1MNGA 2ADPA 1EN6A 3RN4A 5AG2A 2AW9A 3C3SA 2GDSA 3KKYA 4F6EA 4YIPA
chains in the Genus database with same CATH superfamily
2H94A 5L3FA 5EK0A 1PNMA 3P30A 2YS8A 2WAMA 3ASNC 1VP7A 3RYIA 3ZX6A 4K35A 1SQGA 5JJEB 3TCUA 2CGOA 4P9OA 1LR1A 3CE2A 4X66O 1SZTA 3OW2U 2Z5UA 3JARB 3ZEDA 1M5IA 2Q5ZA 2DYSC 5L3EA 1XMOB 2GUZB 2YIDA 1SC5B 2HJDA 1R3KC 3CHXA 1P49A 4F4LA 2DE0X 1R6KA 1T5EA 1Z5WA 3QTCA 4X1IA 5GONA 4B7KA 1FXKC 4BIZA 5J2UA 4QNHB 1XNQO 1R3JC 5KAFZ 4IT5A 3H1KH 4JV5B 3AK3A 4U7NA 3CD6V 1B04A 4JI5O 1KU9A 3QNEA 3DXRA 4LBEC 4JAVA 2AZ2A 2JK5C 3B8MA 1UFIA 3JCUZ 4I9QA 4XDLA 4EB6B 1VQ9V 2B5UA 4DUZO 5LP6A 1BQZA 1WPXA 1VF6A 4I9WA 1OCOC 2OCCC 3CJHA 2A9HA 5KA6A 4B3SO 4TV8A 4W4KA 2JS3A 1J5EB 3JARA 2YUAA 3O9OA 3T4ZA 5DM6V 1X59A 2FL4A 1VQOV 2P6JA 5K1XA 4ZKIA 2Z0AA 2GUZA 1N32O 1KKCA 2G38A 2IH3C 2JGDA 5LOVB 3SGIA 4DR7B 4DUYB 1Y6XA 1KP2A 3RVZA 2Q7HA 5IDJA 2WLKA 3ETQA 2YI9A 2EZOA 2KSDA 1HP8A 4FM2A 4CH5A 1NR1A 3T1CA 2RQ6A 4MS2A 1XEQA 4PD4F 4J80A 1JCHA 4MTOA 4UCUA 1AVMA 2ZXWB 4TQDA 5EC2C 2HJFC 3WB2A 2ZR3A 4E2LA 3E89A 4O4HA 5KHHA 3OTOO 1VF7A 5KX5B 3LSSA 2EIMB 1HNZO 3C90A 5LXTB 4JYBA 2KQXA 4GYCB 1S0VA 3CRRA 3A0RA 2A7WA 3JD0A 4UB6Z 2OTJV 4MTXA 3E35A 2LW1A 4NR1A 4CS4A 4JZ2A 1B06A 2CK3G 4X66B 1GM9A 4W4LA 4NYKA 2DYRB 3HR0A 2XAQA 1S5JA 3EHBB 1I5XA 4Q20A 4JYCA 4GKJO 3O65A 1DGSA 4GKKB 2IU0A 1PP9H 5D5QA 2OWOA 3W7XA 3N2GB 3ETDA 5K1PA 2AHYA 2ZE5A 3LUTB 4JGSA 2Y4UA 1VQ6V 4I4TA 3FB7C 3AG3B 1P7BA 2F23A 1RFYA 1WP7A 3M99B 2EULA 2ZDIA 1N34B 3H1LH 3RN4A 1XNQB 4K0KB 4I55B 4Z1VA 2YIBD 4FK5C 1VQPV 3HKBA 1NH2B 3LSUA 5IJ0B 3JATA 2HP8A 5KX5A 4ZHQB 4RUFA 3CMAV 2UUCB 5L3GA 3QVNA 3APOA 1EZJA 4DUZB 4DXWA 1VMGA 3CC4V 3E86A 3SPCA 4UXNA 3K3WA 1HNXO 3SYQA 4DRXA 3EVKA 2YIAA 4B3SB 4MVSA 4BAYA 5BY1A 4G28B 3B8NA 3RGBA 3ABTA 3FAVB 3R66A 2UXDO 2UXCO 1P84F 4LF9O 1YVWA 5GTIZ 2P4KA 3CEIA 3D36C 1JOYA 1U96A 2PZSA 2HKOA 3FYEB 4FLZA 5EZYA 4UCTA 1AI6A 2ZNIA 2IJJA 3K57A 3ABLC 4NTWA 4PA3A 1AR5A 3HPLC 1GTOA 4HAMA 4D7SA 3G6EV 2DOSA 2YXYA 4DR3O 4U3JB 3PJSK 3N27A 4I55A 3OTOB 1KP3A 2QWOB 4WCEV 4DR2O 1XL6A 1VQ5V 4J11A 4JI6O 1HNZB 5IJ0A 3LDEA 1G8MA 3K58A 3K5OA 3S3WA 4ZHQA 2JJ2G 4DR1O 4CC5A 4P9PA 3ZHQA 4JI0B 4IHJA 1K5SA 4MT8A 4JI8O 3JSLA 1L1FA 1NT2B 1JVMA 2F66C 3FAVA 3BEHA 1Q6UA 1JFFB 1BGYH 1TVKB 3ABMC 3STLC 2E75B 1HR0O 5L3DA 4ZOLB 1K8AW 3ZMVA 2FTKA 1Q3EA 1WNSA 3ZHVA 1AI7A 1W59A 4YHHB 2M7WA 2NN4A 3OUFA 4EKWA 1QQCA 1NJIW 4A5UB 5A2QN 2UXNA 4TSFG 3CCLV 1NBMG 4KL1A 2NR5A 1NI8A 4J7KA 1FXVA 4KXRA 1R3LC 3L73H 1XUQA 3NR7A 3K79A 4Q6GA 4FPPA 3K0GA 1M56C 3ZRWA 5J2TB 1I0HA 4UVBA 1SQBH 2UXBO 2FB5A 4JI4O 1Y67A 2YXHA 4O2BA 5FL7G 1HNXB 1ZL8B 4JI1O 3LDCA 3VQYA 2EIKB 2QA4V 2JEUA 2IJHA 2Q68A 1OCCB 2QWQB 2F4VO 4PELA 2UXDB 4NXMB 2KG7B 5KMGB 4C7UA 1YEWA 4DR5B 2UXCB 2W0FC 2EINB 4LF9B 4FLVA 2YXLA 4HBNA 3UQ8A 3T1YO 1EN4A 3F7YC 1JFFA 2DMXA 2YI8A 4QPJA 1N36O 4ZOLA 3CPWU 3TETA 3G71V 4JI7B 4FLWA 4TUYA 4J7JA 1IZ3A 1V9PA 2LO1A 2QTOA 5EC1C 2QKSA 2QWPB 4R7CA 1V54B 2ADQB 5LA6B 4TWKA 3ZMUA 2WLIB 2CTRA 5CA0B 2ATKC 3H1IH 3W7WA 1IX9A 3TXQA 3IC7A 4DR2B 2PY5A 3N2KA 4LF8O 4JI6B 1GAXA 3E22B 5GW7A 5C8YA 1RSOA 1XMOO 2DW4A 3H9VA 4XDJA 3ZJZA 4DR1B 1Q86W 5J2TA 3CCEV 1F23A 1IDSA 1H2KA 2QWRB 2Q4PA 3LNNA 1URFA 4FLTA 2QGNA 4BR6A 2P06A 5B1BC 4CH6A 4N23A 4TV9B 2EILB 1VARA 2JIZG 1OCRC 4BW9A 5KMGA 3U11A 1YJNV 2BTQB 1L8DA 1L0NH 4LWSB 2WLLA 1R6TA 3SPHA 4ZI7B 4X62B 4F6RA 4LFBO 4JV5O 3JALB 2V1DA 1FPOA 4J9YB 1L0LH 2PI4A 5CA3A 4X1YB 1GN2A 4DW1A 4DK1A 4HNAB 5JCOA 2CDYA 5KHIA 5KHKA 1YDXA 2WLIA 2BSKA 2Y48A 2QKCA 1WAZA 4NB5A 2BOCC 1J5EO 3IGAC 3STZC 4Z2WA 1XI1A 3BA8A 1GH6A 3F5TA 1WP8A 3E22A 4FM1A 3A0HZ 1G1XB 2UXBB 2Q7GA 2GSMB 4DV4O 3F7VC 3A8TA 4DV3B 4JI4B 2VWKA 4UVAA 2LQTA 4ZIBA 1RM1B 5FNVB 5CMUA 5A9GA 4DUYO 4DR7O 5EBLC 1IURA 3L70H 4O4JB 4JI1B 3ZMSA 2ZE8A 4YXWG 4JTAB 1PPJH 3JSNA 4DK0A 5D5PA 2PUSA 4HZ3A 3MD0A 4TQFA 4RUEA 4B7EA 1BZKA 2PTMA 1M1KW 1SF9A 3JD1A 5BMVA 1QR9A 2UUBB 1AP6A 4MVMA 3G67A 1N36B 3K08A 4UV8A 4RWUA 3JALA 2AHZA 3EFFK 1OCZC 1GO3F 4RQFA 4JYAO 1ZSPA 1WB8A 3QO8A 3KG2A 3IFXA 1FAFA 1E1QG 4GZRB 5LYJA 4JZGA 4GLXA 3ZRVA 4X88A 1KBHA 1GMGA 1QVGU 5HFMA 3BVOA 1Z2GA 4LF8B 1OV9A 2DYSB 2LW7A 5LGNA 3LNMB 4GKKO 5ITZB 2QWNB 1VEWA 5LP6C 1S5LZ 4UCOA 1SESA 1BHAA 1TUBB 2OTLV 1VQNV 4TOIA 4X89A 1VF6C 1AROP 5IYZB 3MHSC 3TGUH 5KUKA 1FS0G 2PI5A 1GM7A 2CH7B 2YIBA 4BIUA 1TAEA 4O4JA 1FXKB 4LF4B 2A3QA 1N34O 1I5YA 1RPRA 3K5MA 3IC9A 4K0KO 3WB0A 2P7TC 3DSQA 3JAMN 5DN6G 4PI2A 4B3MB 3JD2A 1F4MA 4NTXA 2Q67A 4LFBB 5B1AC 1AJQA 1SQFA 3JD4A 4PDMA 4QE7A 5JVDB 2L6LA 5B1NA 3MAQA 4L8JA 1ROPA 3CCVV 2UUCO 1SQVH 3M8AA 3CRQA 3THOA 2PYJA 3IAYA 3CB2A 4EEQA 1OCOB 3KCXA 5IE9A 3APQA 4EFBA 3VQXA 3B77A 1D5NA 1Q5OA 5BR8B 2EJRA 4P2ZA 3CYOA 4DV4B 1R1BA 2HVKC 5IWAO 2Y0IA 2XAHA 1RPOA 4B08A 3ZN0A 2F43G 1IBLB 3GWKC 2X7RB 4WFAV 3K06A 2X6CA 4MVRA 4RAIA 2WA3A 1UPGA 3OD4A 1WB7A 1LUVA 3K04A 5IY5C 3E8FA 3L74H 1XHZA 4L87A 4LC1A 4R6ZA 2ZDIC 2K9PA 4AILC 3UKMA 5CB4B 2ODMA 1YXBA 2OYQA 4JYAB 2XUMA 4LFCB 1AJNA 4DV5B 5H2FZ 1Q81W 1HNWO 4EB6A 4JI0O 1K4DC 2WLHA 3OEHG 1XNRB 2ILMA 1MOFA 1I08A 3ZBHA 1QR8A 2N74A 2RDCA 3K9AA 4X1KB 1M90W 2AW9A 2QTSA 2V4DA 3FB5C 2GDSA 4FIPC 1N33B 1FOUA 3CRMA 5B1OA 5IJ9B 3R65A 2DN9A 1MA1A 4DR6B 3T1HO 2ZE6A 5LOVA 1PNKA 1Y4MA 3ZCCA 3ZHUA 4N21A 1MSWD 4OXSA 1WA8B 4YHHO 1DF4A 4BIOA 3A2FA 2KKWA 1PM9A 3AG1C 1GRJA 2EX3A 1V55B 4RQEA 4G2KA 2DJVA 2IBZH 4X64B 2FKXA 4CS2A 2B1IA 3AG2C 3RBZA 3OT7A 1UJWB 5LGUA 3AG7A 3HKEB 3K59A 4H44B 2ZM6B 5LXTA 3BAAA 2EIJC 2E5LB 5CB4A 1PD3A 4I7ZB 1OHHG 1Y66A 4JAUA 4QE9A 1NU1H 3PN1A 3U0ZA 5E1AC 1VF5B 2W0XA 1K34A 1Y74B 4CBCA 2N04A 2ZIMA 3BRCA 4DV2B 2F95B 4JTDB 1BCCH 1MZEA 1QLEC 2D2CB 4JYYA 4LF7O 4NXMO 2YICA 4DR5O 4X1KA 1NVPB 3ZIAG 1Y76B 5H6QA 2WWWA 1ENVA 5IWAB 3N2GA 4IYHA 5FLXN 4PV1B 1M57C 4UFZA 2UU9B 5EBWC 4GX0A 4JI7O 2ZQMA 3ABLB 1N0NA 1WA8A 2K1EA 4B3TO 1TUEB 3H1HH 1AI5A 2RJZA 1YJWV 4O4IB 2ZE7A 3C3SA 3RFRA 3K0DA 2ETNA 1S76D 1NTKH 4JPRA 3H1JH 3W7TA 3CCQV 1JX9A 1P4RA 3K03A 4BWAA 2N05A 1JJOA 5F2VO 1SERA 1FFTB 2ZCEA 2DWEC 1K7DA 4O4LB 3T2MA 4AI8A 2FYUH 1WN7A 3U10A 1HNWB 2QJ1A 5KA5A 4X20B 3ZN1A 1MZFA 5JH7B 1N8RW 5LMUO 2H3OA 5CBHA 2VQEB 4NXNB 3B09A 1K9MW 4PJ0Z 4YIOA 5LMNO 4LF5B 3CCJV 1Y74A 1YIJV 1M4UA 2HEPA 3WFVA 1AI4A 3RWRD 5EYPB 3ABMB 3CCUV 1YSCA 1IBMO 2LGWA 4NKGB 3SJAC 2NNUA 4B3RO 1Z5VA 4D6TH 3T1HB 4X62O 2VRZA 4GCZA 1FXHA 2IM9A 2RNBA 2QR4A 1NTMH 3BCCH 4UCSA 3ASOC 5FPOA 3CC7V 3CXCU 5B3SC 1A32A 2CTQA 2X6BA 3AEIA 3NXSA 5DEDA 3SR2C 2CAZC 2HVJC 2CTPA 4O4IA 4J42A 4U3JA 1QCEA 4OGQB 1M56B 1VIBA 1THZA 2IJKA 1ZWIC 1DLBA 2OCHA 3OMNB 1K5QA 2V7QG 4LF6O 1G4YB 2PYLA 4DV3O 4TT3G 1QVFU 3AK1A 1ZX3A 5H5NA 1K97A 1FJGB 4X20A 3GB7C 1IVSA 5JH7A 5AG2A 5CBFA 2QSAA 3UO2A 1BQ0A 1YF2A 4LF7B 1KYOF 4DV0O 1Q6HA 4LFAB 1DF5A 2E74B 3RYHB 1KD1W 2UUBO 4QGPA 1TVKA 2XASA 2XAFA 1VQ7V 2QE7G 2YEVB 4GUNA 1WPBA 5EIBC 1EBOA 4B3TB 1S77D 2XAJA 4PDVA 1R6NA 3M7MX 2P22C 4X8AA 1FKAO 4FFBB 4WFBV 2Y69C 2ZD9A 4FLXA 1BSMA 2HFEC 1IBKB 3FB8C 5JCOC 3P32A 3QO7A 4CZZA 2ZR2A 3D3QA 3SJBC 1HW7A 2JGUA 3B40A 3G4SV 2EBOA 2ZKOA 2R72A 4DV6O 1QU7A 3SYAA 3SJQC 5LMUB 1GK9A 5B1BB 4MVQA 4BW5A 4U3FH 3BFRA 1SZXA 1ZL8A 1SRYA 1H38A 5LMNB 4LF4O 3RW0A 4CS3A 5KLVH 1NKDA 2YSUB 1FFXB 2QM7A 3F5WC 3AG4C 2KG7A 3CSXA 2CGNA 3ZHSA 3I5DA 1IBMB 3SDLA 4B3MO 4B3RB 3J7AU 1US6A 1CPYA 1H5WA 1MG1A 4H37A 5GTHZ 3VOUA 4YY3B 3JYCA 3D3IA 2PGGA 4LP8A 2QDOA 3S3XA 2DQ3A 4JAAA 2WLJA 3CRAA 4AQYB 1NVPD 1VQ4V 3HKDB 4QJFB 3W7SA 5LA6A 1KMIZ 5CA0A 1N4CA 1YITV 1NZ6A 3QF7A 3RYIB 3ABKC 1Q7YW 2KB1A 3SYCA 3ETGA 1X4TA 2JDIG 5BR8O 2RN9A 2WSSG 2E76B 4LF6B 3ZRXA 2OIEA 2IH1C 1AB3A 1CP9A 3WG7C 1W0KG 3FB6C 1O9GA 2LP7A 3WU2Z 4NTYA 1RP3B 2RCVA 3SYPA 4FM0A 1IBLO 4DV0B 1H2GA 4TV9A 2XOKG 1KB9F 1KQSU 1FFXA 4YJ3B 2WA4A 1YTFB 2BTQA 5CA1B 2Q0OC 2WLNA 2VQFO 4LWSA 4DV1O 5GONB 1S5HC 4WFEA 4ZI7A 1XDCA 4O2AB 2P5OA 4PA7A 3T4DA 1JQ0A 1S72V 3ASNB 2Y4TA 4IL6Z 1OCZB 3P3PA 1NQTA 1TGOA 4D7TA 3OUSA 4LFCO 3JD3A 4DV5O 4X1YA 4CC6A 3GVMA 4EFEA 3RYCB 3X2QC 4HNAA 3E83A 2B9ZA 3L72H 1XNRO 2UUAO 3CRCA 1BHBA 4X65O 4X9QA 2Y0PA 1P7GA 3WB1A 2HG5C 3E8BA 2JVDA 5LP6B 3DC5A 1SQPH 3CJHB 4LNUB 2F93B 4FLYA 1N33O 3ZHTA 4DV6B 4TV8B 1H2MA 2ZINA 4DR6O 5FNVA 2O57A 4MTGA 1B3QA 3E8GA 3IJ4A 3UM7A 4XDKA 2JGDB 1JPXA 4KFMA 4DV7B 5JJNB 4J7ZA 4KUMA 4X64O 3W7UA 4YJ3A 5B1AB 4ICGA 3H01A 5BZBA 2B1GA 1GN6A 5CA1A 1PKXA 3K5LA 1MMMA 4O2AA 2ZM6O 3LSQA 5C93A 4GX1A 2ZNJA 3FFQA 2E5LO 3CC2V 2H8PC 1U97A 2YDEA 4O4HB 4Z1MG 2XAGA 2OCCB 2CE4A 1H2NA 1LUWA 4KP4A 3RYCA 1EM1A 3FKSG 4PDRA 2ZIOA 1DTOA 5EIBD 4DV2O 5B5EZ 2XTAA 2JJ1G 1ORQC 5ITZA 4QIWF 3UO3A 3SPJA 2NLJC 1TUBA 3OFNG 1O9HA 4LNUA 2QM8A 2UU9O 1JR9A 5IYZA 4WBNB 2XHBA 4KHPB 4JTCB 2CH7A 4IYIA 4K3AA 3MHHC 3DGEA 4IGGA 2XT9A 2D3OW 1FXKA 3A0BZ 1LNQA 3VQVA 1M93A 5IT9N 5IY5B 3RYFB 4UCVA 4UB8Z 1ZLZA 4GX2A 4I4TB 4U7OA 2VQFB 4FLUA 3ICXA 2JRIA 2A0LA 4DV1B 1D2DA 1VQ8V 1YZBA 3G80A 1FYJA 5JVDA 3KKYA 4YIPA 2GTSA 3VQWA 4FFKA 2P90A 3J80N 2ZXWC 3HKBB 3JATB 3K9SA 5L3CA 3B4SA 2VWJA 2Q6AA 3CWBH 2UUAB 3HB3B 3I55V 3KDRA 2VQEO 4NXNO 4X65B 3KCYA 2EIMC 4LF5O 3ABUA 3CS5A 5CBGA 4J9ZB 4LCUC 1R73A 4OX9O 1GN3A 2BOBC 2C2AA 2M6YA 4DRXB 4E4EA 2GTAA 1NTZH 2Q73A 1W2BU 2ITCC 2DYRC 2UXXA 2W6JG 2LFRA 2R70A 1QNMA 3JAWB 3SJCC 5KHJA 4WBNA 3AG1B 3OR6C 3SYOA 1WJZA 3OGCC 1YCIA 2OIGA 4FZ1A 4RO2A 5J9PC 5EZYB 3AG2B 1Q43A 1R3IC 3K5NA 3RYFA 1GKFA 4JI3O 1YI2V 3HKCB 5KHGA 4LR3A 4K8XA 2WLMA 2GBOA 2L35A 3AG3C 1ZAUA 5LHGA 2EIJB 2HHHO 3E8HA 1I94O 3CCMV 2YC0A 1V55C 1JMKC 1YTFD 1XREA 1SA0B 3CXHF 5LBQA 1FJGO 1H8HG 3OR7C 4R8CA 4DYLA 3CMEV 4JI5B 3C3TA 1YJ9V 4CH3A 3KZIZ 1QLEB 1PV0A 3RT3C 4IHJB 3JAKB 2GHYA 4LFAO 1FD9A 1M57B 1HWYA 5IJ9A 4J10A 5LL6Y 3OE7G 3ZMTA 5JJJB 3DC6A 3JAWA 4OPAA 5LHHA 3D8CA 4UCRA 1N32B 4MVUA 1YHQV 1AR4A 2IJIA 1KECA 2ARHA 3HKCA 2LFSA 1IBKO 2X6AA 3HKEA 3L71H 3OEEG 3ETEA 1Q8IA 1JJ2U 4HYOA 2ZT9B 2FMLA 2QKAA 2BE3A 1XQ8A 4I50B 3BABA 1H2LA 2Z3YA 4IIJB 1SA0A 4H0LB 1BT8A 3ZRWB 1Q90D 4FVMA 1EN5A 2EJ7A 3E2EA 1F4NA 2BTOA 1Q6IA 1SQXH 3B2EE 1K3EA 3TJTA 1OJHA 2W6IG 5LGTA 4O2BB 4OX9B 1COWG 1CXZB 1XILA 5H6RA 4PA9A 4FMTA 1N0JA 1I7FA 1GM8A 2F1MA 4G27B 3JAKA 1TA8A 1Y76A 3FD9A 1XOUA 3D36A 4H13B 3BA9A 3GWOA 1ZTEA 2AGAA 4YY3O 3CCSV 4GKJB 3BPZA 2CTWA 1QLNA 2P4VA 3ASOB 4DR4O 2BCCH 1JNBA 1QHTA 4CH4A 3TK1A 5B3SB 4AQYO 4WFFA 4WF9V 1DK1A 3UCSC 1B6QA 4FJCC 4JI3B 4TUYB 1H8EG 5L3BA 3OMAB 4MSWC 2R9IA 3TXSA 2VS0A 3OM3B 2LGQA 1XL4A 2HHHB 1D5AA 4MW8A 1I94B 3BHPA 1JA8A 3OAAG 4NVPA 1XMQO 4O4LA 3AK2A 3LDDA 2XNDG 3N2KB 1OZ0A 2A79B 1EFRG 4MVOA 4J41A 2R9RB 2IU3A 5C8YB 1RSOB 4I50A 4YJ2B 1SKVA 2HR3A 4IIJA 3JASB 2R9AA 4I5SA 3OMIB 4GT1A 2JS5A 2MW2B 4PA4A 4H33A 5EYPA 4WFHA 3L9DA 1K4CC 5JQGB 3J81N 1E1RG 3Q4HB 1K73W 3ZHRA 2EIKC 4WFGA 1OCCC 1VQMV 5FPRA 3DTUB 5LHIA 2WLLB 2EINC 4MVZA 4JI2O 2RMKB 4F6RB 1XBLA 3SPIA 1F7YA 2CUGA 4ZBMA 4UV9A 2MK3A 2EZPA 3FYIB 3UT5B 3ZMZA 2Y69B 3P3NA 5TISZ 4UVCA 5EBMC 5DECA 1K92A 2DWDC 5CN0A 2P67A 1V54C 4PDLA 4ASUG 2BSKB 1EZVH 2AXTZ 2HLDG 1PL4A 3G6BA 1AILA 5HFLA 4DW0A 1HDJA 4DR3B 2Q0AA 2OT5A 4GX5A 1AR1B 1GN4A 1E79G 3CCRV 5JWPA 1IXMA 1MNGA 2ADPA 5IYDO 1EN6A 1G6UA 3BY6A 2A06H 4YJ2A 3VBBA 1OCRB 3L75H 3EXAA 3AG4B 3JASA 4F6EA 4DV7O 1J95A 4XBFA 5E79Z 2AZ0A 3MDSA 5IYCO 4PI0A 1NH2D 4PA6A 1PL0A 4I0XB 4PHZA 5KUMA 1SS3A 3RYHA 5JQGA 1VQLV 4JI8B 1BL8A 1K33A 3RVYA 3Q4HA 4DR4B 4MTFA 1MSDA 2EILC 1PNLA 3CX5F 2YEVA 4K8ZA 5BMVB 1S3JA 4MW3A 1ZUQA 5BXZA 1H2SB 5IYBO 1NS1A 2IW5A 3JCZA 1HR0B 3QG5A 4JASA 3ZS8C 1Q82W 4OPHA 1SQQH 2GV9A 4FFBA 3ABKB 3UT5A 1IXBA 5KAIZ 4AHCA 1KUQA 1QBZA 1WLEA 2DQ0A 1XHXA 4ABMA 4R50A 4LH7A 5LYJB 1VQKV 3CP1A 1M9NA 1XMQB 3WG7B 1F51A 3SPGA 1KKDA 2ITDC 3OGIB 3FX7A 2Q7EA 1BS3A 4KHPO 3QO5A 1CEZA 3ZRSA 2QM4A 3I56V 1AP5A 2WPDG 4UUJC 2X0LA 1AJPA 2PF4E 1NR7A 5B66Z 4X1IB 1RM1C 1KC8W 1SETA 1BMFG 2Q9LA 4DO2A 4P30A 2F4VB 2QEXV 2Q8VA 4FZ0A 4I0XA 5J2UB 4LH6A 3ML0A 2JEXA 5H9CA 4QPKA 1MABG 4JI2B 2E3CA 1BE3H 3T1YB 3OTFA 3X2QB 2LJ2A 1W0JG 2Q69A 3HKDA 1IJGA 4JF3A 3DXRB
chains in the Genus database with same CATH topology
2ADQB 5A9GA 4FFKA 3MDSA 1IX9A 3LSUA 1KKCA 1MA1A 1JA8A 3K9SA 3AK2A 3KDRA 3DC6A 1MSDA 1PM9A 3QVNA 1AR4A 4GUNA 1D5NA 1ZUQA 1GN6A 1AP6A 1GN3A 3EVKA 4YIOA 1AVMA 1IDSA 1MMMA 4E4EA 3OT7A 2RCVA 4BR6A 1IXBA 1ZSPA 1WB8A 1QNMA 2CE4A 1LUWA 1BSMA 1EM1A 1VARA 2QKAA 4JZGA 2P4KA 3CEIA 1XUQA 1BT8A 1I0HA 4JZ2A 1EN5A 1B06A 1XDCA 1WB7A 1BS3A 1LUVA 1Y67A 3TJTA 1VEWA 1AR5A 1XILA 3BFRA 4JYYA 1SZXA 1N0JA 1JR9A 1AP5A 1GN2A 3AK3A 2CDYA 1ZTEA 4C7UA 1XREA 2QKCA 4X9QA 1PL4A 1P7GA 3C3TA 1EN4A 1GN4A 1N0NA 1ZLZA 1I08A 3DC5A 3IC9A 3AK1A 1MNGA 2ADPA 1EN6A 3RN4A 5AG2A 2AW9A 3C3SA 2GDSA 3KKYA 4F6EA 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADQ B;  5A9G A;  4FFK A;  3MDS A;  1IX9 A;  3LSU A;  1KKC A;  1MA1 A;  1JA8 A;  3K9S A;  3AK2 A;  3DC6 A;  1MSD A;  1PM9 A;  3QVN A;  1AR4 A;  4GUN A;  1D5N A;  1ZUQ A;  1GN6 A;  1AP6 A;  1GN3 A;  3EVK A;  4YIO A;  1AVM A;  1IDS A;  1MMM A;  4E4E A;  3OT7 A;  2RCV A;  4BR6 A;  1IXB A;  1ZSP A;  1WB8 A;  1QNM A;  2CE4 A;  1LUW A;  1BSM A;  1EM1 A;  1VAR A;  2QKA A;  4JZG A;  2P4K A;  3CEI A;  1XUQ A;  1BT8 A;  1I0H A;  4JZ2 A;  1EN5 A;  1B06 A;  1XDC A;  1WB7 A;  1BS3 A;  1LUV A;  1Y67 A;  3TJT A;  1VEW A;  1AR5 A;  1XIL A;  3BFR A;  4JYY A;  1SZX A;  1N0J A;  1JR9 A;  1AP5 A;  1GN2 A;  3AK3 A;  2CDY A;  1ZTE A;  4C7U A;  1XRE A;  2QKC A;  4X9Q A;  1PL4 A;  1P7G A;  3C3T A;  1EN4 A;  1GN4 A;  1N0N A;  1ZLZ A;  1I08 A;  3DC5 A;  3IC9 A;  3AK1 A;  1MNG A;  2ADP A;  1EN6 A;  3RN4 A;  5AG2 A;  2AW9 A;  3C3S A;  2GDS A;  3KKY A;  4F6E A;  4YIP A; 
#chains in the Genus database with same CATH topology
 2H94 A;  5L3F A;  5EK0 A;  1PNM A;  3P30 A;  2YS8 A;  2WAM A;  3ASN C;  1VP7 A;  3RYI A;  3ZX6 A;  4K35 A;  1SQG A;  5JJE B;  3TCU A;  2CGO A;  4P9O A;  1LR1 A;  3CE2 A;  4X66 O;  1SZT A;  3OW2 U;  2Z5U A;  3JAR B;  3ZED A;  1M5I A;  2Q5Z A;  2DYS C;  5L3E A;  1XMO B;  2GUZ B;  2YID A;  1SC5 B;  2HJD A;  1R3K C;  3CHX A;  1P49 A;  4F4L A;  2DE0 X;  1R6K A;  1T5E A;  1Z5W A;  3QTC A;  4X1I A;  5GON A;  4B7K A;  1FXK C;  4BIZ A;  5J2U A;  4QNH B;  1XNQ O;  1R3J C;  5KAF Z;  4IT5 A;  3H1K H;  4JV5 B;  3AK3 A;  4U7N A;  3CD6 V;  1B04 A;  4JI5 O;  1KU9 A;  3QNE A;  3DXR A;  4LBE C;  4JAV A;  2AZ2 A;  2JK5 C;  3B8M A;  1UFI A;  3JCU Z;  4I9Q A;  4XDL A;  4EB6 B;  1VQ9 V;  2B5U A;  4DUZ O;  5LP6 A;  1BQZ A;  1WPX A;  1VF6 A;  4I9W A;  1OCO C;  2OCC C;  3CJH A;  2A9H A;  5KA6 A;  4B3S O;  4TV8 A;  4W4K A;  2JS3 A;  1J5E B;  3JAR A;  2YUA A;  3O9O A;  3T4Z A;  5DM6 V;  1X59 A;  2FL4 A;  1VQO V;  2P6J A;  5K1X A;  4ZKI A;  2Z0A A;  2GUZ A;  1N32 O;  1KKC A;  2G38 A;  2IH3 C;  2JGD A;  5LOV B;  3SGI A;  4DR7 B;  4DUY B;  1Y6X A;  1KP2 A;  3RVZ A;  2Q7H A;  5IDJ A;  2WLK A;  3ETQ A;  2YI9 A;  2EZO A;  2KSD A;  1HP8 A;  4FM2 A;  4CH5 A;  1NR1 A;  3T1C A;  2RQ6 A;  4MS2 A;  1XEQ A;  4PD4 F;  4J80 A;  1JCH A;  4MTO A;  4UCU A;  1AVM A;  2ZXW B;  4TQD A;  5EC2 C;  2HJF C;  3WB2 A;  2ZR3 A;  4E2L A;  3E89 A;  4O4H A;  5KHH A;  3OTO O;  1VF7 A;  5KX5 B;  3LSS A;  2EIM B;  1HNZ O;  3C90 A;  5LXT B;  4JYB A;  2KQX A;  4GYC B;  1S0V A;  3CRR A;  3A0R A;  2A7W A;  3JD0 A;  4UB6 Z;  2OTJ V;  4MTX A;  3E35 A;  2LW1 A;  4NR1 A;  4CS4 A;  4JZ2 A;  1B06 A;  2CK3 G;  4X66 B;  1GM9 A;  4W4L A;  4NYK A;  2DYR B;  3HR0 A;  2XAQ A;  1S5J A;  3EHB B;  1I5X A;  4Q20 A;  4JYC A;  4GKJ O;  3O65 A;  1DGS A;  4GKK B;  2IU0 A;  1PP9 H;  5D5Q A;  2OWO A;  3W7X A;  3N2G B;  3ETD A;  5K1P A;  2AHY A;  2ZE5 A;  3LUT B;  4JGS A;  2Y4U A;  1VQ6 V;  4I4T A;  3FB7 C;  3AG3 B;  1P7B A;  2F23 A;  1RFY A;  1WP7 A;  3M99 B;  2EUL A;  2ZDI A;  1N34 B;  3H1L H;  3RN4 A;  1XNQ B;  4K0K B;  4I55 B;  4Z1V A;  2YIB D;  4FK5 C;  1VQP V;  3HKB A;  1NH2 B;  3LSU A;  5IJ0 B;  3JAT A;  2HP8 A;  5KX5 A;  4ZHQ B;  4RUF A;  3CMA V;  2UUC B;  5L3G A;  3QVN A;  3APO A;  1EZJ A;  4DUZ B;  4DXW A;  1VMG A;  3CC4 V;  3E86 A;  3SPC A;  4UXN A;  3K3W A;  1HNX O;  3SYQ A;  4DRX A;  3EVK A;  2YIA A;  4B3S B;  4MVS A;  4BAY A;  5BY1 A;  4G28 B;  3B8N A;  3RGB A;  3ABT A;  3FAV B;  3R66 A;  2UXD O;  2UXC O;  1P84 F;  4LF9 O;  1YVW A;  5GTI Z;  2P4K A;  3CEI A;  3D36 C;  1JOY A;  1U96 A;  2PZS A;  2HKO A;  3FYE B;  4FLZ A;  5EZY A;  4UCT A;  1AI6 A;  2ZNI A;  2IJJ A;  3K57 A;  3ABL C;  4NTW A;  4PA3 A;  1AR5 A;  3HPL C;  1GTO A;  4HAM A;  4D7S A;  3G6E V;  2DOS A;  2YXY A;  4DR3 O;  4U3J B;  3PJS K;  3N27 A;  4I55 A;  3OTO B;  1KP3 A;  2QWO B;  4WCE V;  4DR2 O;  1XL6 A;  1VQ5 V;  4J11 A;  4JI6 O;  1HNZ B;  5IJ0 A;  3LDE A;  1G8M A;  3K58 A;  3K5O A;  3S3W A;  4ZHQ A;  2JJ2 G;  4DR1 O;  4CC5 A;  4P9P A;  3ZHQ A;  4JI0 B;  4IHJ A;  1K5S A;  4MT8 A;  4JI8 O;  3JSL A;  1L1F A;  1NT2 B;  1JVM A;  2F66 C;  3FAV A;  3BEH A;  1Q6U A;  1JFF B;  1BGY H;  1TVK B;  3ABM C;  3STL C;  2E75 B;  1HR0 O;  5L3D A;  4ZOL B;  1K8A W;  3ZMV A;  2FTK A;  1Q3E A;  1WNS A;  3ZHV A;  1AI7 A;  1W59 A;  4YHH B;  2M7W A;  2NN4 A;  3OUF A;  4EKW A;  1QQC A;  1NJI W;  4A5U B;  5A2Q N;  2UXN A;  4TSF G;  3CCL V;  1NBM G;  4KL1 A;  2NR5 A;  1NI8 A;  4J7K A;  1FXV A;  4KXR A;  1R3L C;  3L73 H;  1XUQ A;  3NR7 A;  3K79 A;  4Q6G A;  4FPP A;  3K0G A;  1M56 C;  3ZRW A;  5J2T B;  1I0H A;  4UVB A;  1SQB H;  2UXB O;  2FB5 A;  4JI4 O;  1Y67 A;  2YXH A;  4O2B A;  5FL7 G;  1HNX B;  1ZL8 B;  4JI1 O;  3LDC A;  3VQY A;  2EIK B;  2QA4 V;  2JEU A;  2IJH A;  2Q68 A;  1OCC B;  2QWQ B;  2F4V O;  4PEL A;  2UXD B;  4NXM B;  2KG7 B;  5KMG B;  4C7U A;  1YEW A;  4DR5 B;  2UXC B;  2W0F C;  2EIN B;  4LF9 B;  4FLV A;  2YXL A;  4HBN A;  3UQ8 A;  3T1Y O;  1EN4 A;  3F7Y C;  1JFF A;  2DMX A;  2YI8 A;  4QPJ A;  1N36 O;  4ZOL A;  3CPW U;  3TET A;  3G71 V;  4JI7 B;  4FLW A;  4TUY A;  4J7J A;  1IZ3 A;  1V9P A;  2LO1 A;  2QTO A;  5EC1 C;  2QKS A;  2QWP B;  4R7C A;  1V54 B;  2ADQ B;  5LA6 B;  4TWK A;  3ZMU A;  2WLI B;  2CTR A;  5CA0 B;  2ATK C;  3H1I H;  3W7W A;  1IX9 A;  3TXQ A;  3IC7 A;  4DR2 B;  2PY5 A;  3N2K A;  4LF8 O;  4JI6 B;  1GAX A;  3E22 B;  5GW7 A;  5C8Y A;  1RSO A;  1XMO O;  2DW4 A;  3H9V A;  4XDJ A;  3ZJZ A;  4DR1 B;  1Q86 W;  5J2T A;  3CCE V;  1F23 A;  1IDS A;  1H2K A;  2QWR B;  2Q4P A;  3LNN A;  1URF A;  4FLT A;  2QGN A;  4BR6 A;  2P06 A;  5B1B C;  4CH6 A;  4N23 A;  4TV9 B;  2EIL B;  1VAR A;  2JIZ G;  1OCR C;  4BW9 A;  5KMG A;  3U11 A;  1YJN V;  2BTQ B;  1L8D A;  1L0N H;  4LWS B;  2WLL A;  1R6T A;  3SPH A;  4ZI7 B;  4X62 B;  4F6R A;  4LFB O;  4JV5 O;  3JAL B;  2V1D A;  1FPO A;  4J9Y B;  1L0L H;  2PI4 A;  5CA3 A;  4X1Y B;  1GN2 A;  4DW1 A;  4DK1 A;  4HNA B;  5JCO A;  2CDY A;  5KHI A;  5KHK A;  1YDX A;  2WLI A;  2BSK A;  2Y48 A;  2QKC A;  1WAZ A;  4NB5 A;  2BOC C;  1J5E O;  3IGA C;  3STZ C;  4Z2W A;  1XI1 A;  3BA8 A;  1GH6 A;  3F5T A;  1WP8 A;  3E22 A;  4FM1 A;  3A0H Z;  1G1X B;  2UXB B;  2Q7G A;  2GSM B;  4DV4 O;  3F7V C;  3A8T A;  4DV3 B;  4JI4 B;  2VWK A;  4UVA A;  2LQT A;  4ZIB A;  1RM1 B;  5FNV B;  5CMU A;  5A9G A;  4DUY O;  4DR7 O;  5EBL C;  1IUR A;  3L70 H;  4O4J B;  4JI1 B;  3ZMS A;  2ZE8 A;  4YXW G;  4JTA B;  1PPJ H;  3JSN A;  4DK0 A;  5D5P A;  2PUS A;  4HZ3 A;  3MD0 A;  4TQF A;  4RUE A;  4B7E A;  1BZK A;  2PTM A;  1M1K W;  1SF9 A;  3JD1 A;  5BMV A;  1QR9 A;  2UUB B;  1AP6 A;  4MVM A;  3G67 A;  1N36 B;  3K08 A;  4UV8 A;  4RWU A;  3JAL A;  2AHZ A;  3EFF K;  1OCZ C;  1GO3 F;  4RQF A;  4JYA O;  1ZSP A;  1WB8 A;  3QO8 A;  3KG2 A;  3IFX A;  1FAF A;  1E1Q G;  4GZR B;  5LYJ A;  4JZG A;  4GLX A;  3ZRV A;  4X88 A;  1KBH A;  1GMG A;  1QVG U;  5HFM A;  3BVO A;  1Z2G A;  4LF8 B;  1OV9 A;  2DYS B;  2LW7 A;  5LGN A;  3LNM B;  4GKK O;  5ITZ B;  2QWN B;  1VEW A;  5LP6 C;  1S5L Z;  4UCO A;  1SES A;  1BHA A;  1TUB B;  2OTL V;  1VQN V;  4TOI A;  4X89 A;  1VF6 C;  1ARO P;  5IYZ B;  3MHS C;  3TGU H;  5KUK A;  1FS0 G;  2PI5 A;  1GM7 A;  2CH7 B;  2YIB A;  4BIU A;  1TAE A;  4O4J A;  1FXK B;  4LF4 B;  2A3Q A;  1N34 O;  1I5Y A;  1RPR A;  3K5M A;  3IC9 A;  4K0K O;  3WB0 A;  2P7T C;  3DSQ A;  3JAM N;  5DN6 G;  4PI2 A;  4B3M B;  3JD2 A;  1F4M A;  4NTX A;  2Q67 A;  4LFB B;  5B1A C;  1AJQ A;  1SQF A;  3JD4 A;  4PDM A;  4QE7 A;  5JVD B;  2L6L A;  5B1N A;  3MAQ A;  4L8J A;  1ROP A;  3CCV V;  2UUC O;  1SQV H;  3M8A A;  3CRQ A;  3THO A;  2PYJ A;  3IAY A;  3CB2 A;  4EEQ A;  1OCO B;  3KCX A;  5IE9 A;  3APQ A;  4EFB A;  3VQX A;  3B77 A;  1D5N A;  1Q5O A;  5BR8 B;  2EJR A;  4P2Z A;  3CYO A;  4DV4 B;  1R1B A;  2HVK C;  5IWA O;  2Y0I A;  2XAH A;  1RPO A;  4B08 A;  3ZN0 A;  2F43 G;  1IBL B;  3GWK C;  2X7R B;  4WFA V;  3K06 A;  2X6C A;  4MVR A;  4RAI A;  2WA3 A;  1UPG A;  3OD4 A;  1WB7 A;  1LUV A;  3K04 A;  5IY5 C;  3E8F A;  3L74 H;  1XHZ A;  4L87 A;  4LC1 A;  4R6Z A;  2ZDI C;  2K9P A;  4AIL C;  3UKM A;  5CB4 B;  2ODM A;  1YXB A;  2OYQ A;  4JYA B;  2XUM A;  4LFC B;  1AJN A;  4DV5 B;  5H2F Z;  1Q81 W;  1HNW O;  4EB6 A;  4JI0 O;  1K4D C;  2WLH A;  3OEH G;  1XNR B;  2ILM A;  1MOF A;  1I08 A;  3ZBH A;  1QR8 A;  2N74 A;  2RDC A;  3K9A A;  4X1K B;  1M90 W;  2AW9 A;  2QTS A;  2V4D A;  3FB5 C;  2GDS A;  4FIP C;  1N33 B;  1FOU A;  3CRM A;  5B1O A;  5IJ9 B;  3R65 A;  2DN9 A;  1MA1 A;  4DR6 B;  3T1H O;  2ZE6 A;  5LOV A;  1PNK A;  1Y4M A;  3ZCC A;  3ZHU A;  4N21 A;  1MSW D;  4OXS A;  1WA8 B;  4YHH O;  1DF4 A;  4BIO A;  3A2F A;  2KKW A;  1PM9 A;  3AG1 C;  1GRJ A;  2EX3 A;  1V55 B;  4RQE A;  4G2K A;  2DJV A;  2IBZ H;  4X64 B;  2FKX A;  4CS2 A;  2B1I A;  3AG2 C;  3RBZ A;  3OT7 A;  1UJW B;  5LGU A;  3AG7 A;  3HKE B;  3K59 A;  4H44 B;  2ZM6 B;  5LXT A;  3BAA A;  2EIJ C;  2E5L B;  5CB4 A;  1PD3 A;  4I7Z B;  1OHH G;  1Y66 A;  4JAU A;  4QE9 A;  1NU1 H;  3PN1 A;  3U0Z A;  5E1A C;  1VF5 B;  2W0X A;  1K34 A;  1Y74 B;  4CBC A;  2N04 A;  2ZIM A;  3BRC A;  4DV2 B;  2F95 B;  4JTD B;  1BCC H;  1MZE A;  1QLE C;  2D2C B;  4JYY A;  4LF7 O;  4NXM O;  2YIC A;  4DR5 O;  4X1K A;  1NVP B;  3ZIA G;  1Y76 B;  5H6Q A;  2WWW A;  1ENV A;  5IWA B;  3N2G A;  4IYH A;  5FLX N;  4PV1 B;  1M57 C;  4UFZ A;  2UU9 B;  5EBW C;  4GX0 A;  4JI7 O;  2ZQM A;  3ABL B;  1N0N A;  1WA8 A;  2K1E A;  4B3T O;  1TUE B;  3H1H H;  1AI5 A;  2RJZ A;  1YJW V;  4O4I B;  2ZE7 A;  3C3S A;  3RFR A;  3K0D A;  2ETN A;  1S76 D;  1NTK H;  4JPR A;  3H1J H;  3W7T A;  3CCQ V;  1JX9 A;  1P4R A;  3K03 A;  4BWA A;  2N05 A;  1JJO A;  5F2V O;  1SER A;  1FFT B;  2ZCE A;  2DWE C;  1K7D A;  4O4L B;  3T2M A;  4AI8 A;  2FYU H;  1WN7 A;  3U10 A;  1HNW B;  2QJ1 A;  5KA5 A;  4X20 B;  3ZN1 A;  1MZF A;  5JH7 B;  1N8R W;  5LMU O;  2H3O A;  5CBH A;  2VQE B;  4NXN B;  3B09 A;  1K9M W;  4PJ0 Z;  4YIO A;  5LMN O;  4LF5 B;  3CCJ V;  1Y74 A;  1YIJ V;  1M4U A;  2HEP A;  3WFV A;  1AI4 A;  3RWR D;  5EYP B;  3ABM B;  3CCU V;  1YSC A;  1IBM O;  2LGW A;  4NKG B;  3SJA C;  2NNU A;  4B3R O;  1Z5V A;  4D6T H;  3T1H B;  4X62 O;  2VRZ A;  4GCZ A;  1FXH A;  2IM9 A;  2RNB A;  2QR4 A;  1NTM H;  3BCC H;  4UCS A;  3ASO C;  5FPO A;  3CC7 V;  3CXC U;  5B3S C;  1A32 A;  2CTQ A;  2X6B A;  3AEI A;  3NXS A;  5DED A;  3SR2 C;  2CAZ C;  2HVJ C;  2CTP A;  4O4I A;  4J42 A;  4U3J A;  1QCE A;  4OGQ B;  1M56 B;  1VIB A;  1THZ A;  2IJK A;  1ZWI C;  1DLB A;  2OCH A;  3OMN B;  1K5Q A;  2V7Q G;  4LF6 O;  1G4Y B;  2PYL A;  4DV3 O;  4TT3 G;  1QVF U;  3AK1 A;  1ZX3 A;  5H5N A;  1K97 A;  1FJG B;  4X20 A;  3GB7 C;  1IVS A;  5JH7 A;  5AG2 A;  5CBF A;  2QSA A;  3UO2 A;  1BQ0 A;  1YF2 A;  4LF7 B;  1KYO F;  4DV0 O;  1Q6H A;  4LFA B;  1DF5 A;  2E74 B;  3RYH B;  1KD1 W;  2UUB O;  4QGP A;  1TVK A;  2XAS A;  2XAF A;  1VQ7 V;  2QE7 G;  2YEV B;  4GUN A;  1WPB A;  5EIB C;  1EBO A;  4B3T B;  1S77 D;  2XAJ A;  4PDV A;  1R6N A;  3M7M X;  2P22 C;  4X8A A;  1FKA O;  4FFB B;  4WFB V;  2Y69 C;  2ZD9 A;  4FLX A;  1BSM A;  2HFE C;  1IBK B;  3FB8 C;  5JCO C;  3P32 A;  3QO7 A;  4CZZ A;  2ZR2 A;  3D3Q A;  3SJB C;  1HW7 A;  2JGU A;  3B40 A;  3G4S V;  2EBO A;  2ZKO A;  2R72 A;  4DV6 O;  1QU7 A;  3SYA A;  3SJQ C;  5LMU B;  1GK9 A;  5B1B B;  4MVQ A;  4BW5 A;  4U3F H;  3BFR A;  1SZX A;  1ZL8 A;  1SRY A;  1H38 A;  5LMN B;  4LF4 O;  3RW0 A;  4CS3 A;  5KLV H;  1NKD A;  2YSU B;  1FFX B;  2QM7 A;  3F5W C;  3AG4 C;  2KG7 A;  3CSX A;  2CGN A;  3ZHS A;  3I5D A;  1IBM B;  3SDL A;  4B3M O;  4B3R B;  3J7A U;  1US6 A;  1CPY A;  1H5W A;  1MG1 A;  4H37 A;  5GTH Z;  3VOU A;  4YY3 B;  3JYC A;  3D3I A;  2PGG A;  4LP8 A;  2QDO A;  3S3X A;  2DQ3 A;  4JAA A;  2WLJ A;  3CRA A;  4AQY B;  1NVP D;  1VQ4 V;  3HKD B;  4QJF B;  3W7S A;  5LA6 A;  1KMI Z;  5CA0 A;  1N4C A;  1YIT V;  1NZ6 A;  3QF7 A;  3RYI B;  3ABK C;  1Q7Y W;  2KB1 A;  3SYC A;  3ETG A;  1X4T A;  2JDI G;  5BR8 O;  2RN9 A;  2WSS G;  2E76 B;  4LF6 B;  3ZRX A;  2OIE A;  2IH1 C;  1AB3 A;  1CP9 A;  3WG7 C;  1W0K G;  3FB6 C;  1O9G A;  2LP7 A;  3WU2 Z;  4NTY A;  1RP3 B;  2RCV A;  3SYP A;  4FM0 A;  1IBL O;  4DV0 B;  1H2G A;  4TV9 A;  2XOK G;  1KB9 F;  1KQS U;  1FFX A;  4YJ3 B;  2WA4 A;  1YTF B;  2BTQ A;  5CA1 B;  2Q0O C;  2WLN A;  2VQF O;  4LWS A;  4DV1 O;  5GON B;  1S5H C;  4WFE A;  4ZI7 A;  1XDC A;  4O2A B;  2P5O A;  4PA7 A;  3T4D A;  1JQ0 A;  1S72 V;  3ASN B;  2Y4T A;  4IL6 Z;  1OCZ B;  3P3P A;  1NQT A;  1TGO A;  4D7T A;  3OUS A;  4LFC O;  3JD3 A;  4DV5 O;  4X1Y A;  4CC6 A;  3GVM A;  4EFE A;  3RYC B;  3X2Q C;  4HNA A;  3E83 A;  2B9Z A;  3L72 H;  1XNR O;  2UUA O;  3CRC A;  1BHB A;  4X65 O;  4X9Q A;  2Y0P A;  1P7G A;  3WB1 A;  2HG5 C;  3E8B A;  2JVD A;  5LP6 B;  3DC5 A;  1SQP H;  3CJH B;  4LNU B;  2F93 B;  4FLY A;  1N33 O;  3ZHT A;  4DV6 B;  4TV8 B;  1H2M A;  2ZIN A;  4DR6 O;  5FNV A;  2O57 A;  4MTG A;  1B3Q A;  3E8G A;  3IJ4 A;  3UM7 A;  4XDK A;  2JGD B;  1JPX A;  4KFM A;  4DV7 B;  5JJN B;  4J7Z A;  4KUM A;  4X64 O;  3W7U A;  4YJ3 A;  5B1A B;  4ICG A;  3H01 A;  5BZB A;  2B1G A;  1GN6 A;  5CA1 A;  1PKX A;  3K5L A;  1MMM A;  4O2A A;  2ZM6 O;  3LSQ A;  5C93 A;  4GX1 A;  2ZNJ A;  3FFQ A;  2E5L O;  3CC2 V;  2H8P C;  1U97 A;  2YDE A;  4O4H B;  4Z1M G;  2XAG A;  2OCC B;  2CE4 A;  1H2N A;  1LUW A;  4KP4 A;  3RYC A;  1EM1 A;  3FKS G;  4PDR A;  2ZIO A;  1DTO A;  5EIB D;  4DV2 O;  5B5E Z;  2XTA A;  2JJ1 G;  1ORQ C;  5ITZ A;  4QIW F;  3UO3 A;  3SPJ A;  2NLJ C;  1TUB A;  3OFN G;  1O9H A;  4LNU A;  2QM8 A;  2UU9 O;  1JR9 A;  5IYZ A;  4WBN B;  2XHB A;  4KHP B;  4JTC B;  2CH7 A;  4IYI A;  4K3A A;  3MHH C;  3DGE A;  4IGG A;  2XT9 A;  2D3O W;  1FXK A;  3A0B Z;  1LNQ A;  3VQV A;  1M93 A;  5IT9 N;  5IY5 B;  3RYF B;  4UCV A;  4UB8 Z;  1ZLZ A;  4GX2 A;  4I4T B;  4U7O A;  2VQF B;  4FLU A;  3ICX A;  2JRI A;  2A0L A;  4DV1 B;  1D2D A;  1VQ8 V;  1YZB A;  3G80 A;  1FYJ A;  5JVD A;  3KKY A;  4YIP A;  2GTS A;  3VQW A;  4FFK A;  2P90 A;  3J80 N;  2ZXW C;  3HKB B;  3JAT B;  3K9S A;  5L3C A;  3B4S A;  2VWJ A;  2Q6A A;  3CWB H;  2UUA B;  3HB3 B;  3I55 V;  3KDR A;  2VQE O;  4NXN O;  4X65 B;  3KCY A;  2EIM C;  4LF5 O;  3ABU A;  3CS5 A;  5CBG A;  4J9Z B;  4LCU C;  1R73 A;  4OX9 O;  1GN3 A;  2BOB C;  2C2A A;  2M6Y A;  4DRX B;  4E4E A;  2GTA A;  1NTZ H;  2Q73 A;  1W2B U;  2ITC C;  2DYR C;  2UXX A;  2W6J G;  2LFR A;  2R70 A;  1QNM A;  3JAW B;  3SJC C;  5KHJ A;  4WBN A;  3AG1 B;  3OR6 C;  3SYO A;  1WJZ A;  3OGC C;  1YCI A;  2OIG A;  4FZ1 A;  4RO2 A;  5J9P C;  5EZY B;  3AG2 B;  1Q43 A;  1R3I C;  3K5N A;  3RYF A;  1GKF A;  4JI3 O;  1YI2 V;  3HKC B;  5KHG A;  4LR3 A;  4K8X A;  2WLM A;  2GBO A;  2L35 A;  3AG3 C;  1ZAU A;  5LHG A;  2EIJ B;  2HHH O;  3E8H A;  1I94 O;  3CCM V;  2YC0 A;  1V55 C;  1JMK C;  1YTF D;  1XRE A;  1SA0 B;  3CXH F;  5LBQ A;  1FJG O;  1H8H G;  3OR7 C;  4R8C A;  4DYL A;  3CME V;  4JI5 B;  3C3T A;  1YJ9 V;  4CH3 A;  3KZI Z;  1QLE B;  1PV0 A;  3RT3 C;  4IHJ B;  3JAK B;  2GHY A;  4LFA O;  1FD9 A;  1M57 B;  1HWY A;  5IJ9 A;  4J10 A;  5LL6 Y;  3OE7 G;  3ZMT A;  5JJJ B;  3DC6 A;  3JAW A;  4OPA A;  5LHH A;  3D8C A;  4UCR A;  1N32 B;  4MVU A;  1YHQ V;  1AR4 A;  2IJI A;  1KEC A;  2ARH A;  3HKC A;  2LFS A;  1IBK O;  2X6A A;  3HKE A;  3L71 H;  3OEE G;  3ETE A;  1Q8I A;  1JJ2 U;  4HYO A;  2ZT9 B;  2FML A;  2QKA A;  2BE3 A;  1XQ8 A;  4I50 B;  3BAB A;  1H2L A;  2Z3Y A;  4IIJ B;  1SA0 A;  4H0L B;  1BT8 A;  3ZRW B;  1Q90 D;  4FVM A;  1EN5 A;  2EJ7 A;  3E2E A;  1F4N A;  2BTO A;  1Q6I A;  1SQX H;  3B2E E;  1K3E A;  3TJT A;  1OJH A;  2W6I G;  5LGT A;  4O2B B;  4OX9 B;  1COW G;  1CXZ B;  1XIL A;  5H6R A;  4PA9 A;  4FMT A;  1N0J A;  1I7F A;  1GM8 A;  2F1M A;  4G27 B;  3JAK A;  1TA8 A;  1Y76 A;  3FD9 A;  1XOU A;  3D36 A;  4H13 B;  3BA9 A;  3GWO A;  1ZTE A;  2AGA A;  4YY3 O;  3CCS V;  4GKJ B;  3BPZ A;  2CTW A;  1QLN A;  2P4V A;  3ASO B;  4DR4 O;  2BCC H;  1JNB A;  1QHT A;  4CH4 A;  3TK1 A;  5B3S B;  4AQY O;  4WFF A;  4WF9 V;  1DK1 A;  3UCS C;  1B6Q A;  4FJC C;  4JI3 B;  4TUY B;  1H8E G;  5L3B A;  3OMA B;  4MSW C;  2R9I A;  3TXS A;  2VS0 A;  3OM3 B;  2LGQ A;  1XL4 A;  2HHH B;  1D5A A;  4MW8 A;  1I94 B;  3BHP A;  1JA8 A;  3OAA G;  4NVP A;  1XMQ O;  4O4L A;  3AK2 A;  3LDD A;  2XND G;  3N2K B;  1OZ0 A;  2A79 B;  1EFR G;  4MVO A;  4J41 A;  2R9R B;  2IU3 A;  5C8Y B;  1RSO B;  4I50 A;  4YJ2 B;  1SKV A;  2HR3 A;  4IIJ A;  3JAS B;  2R9A A;  4I5S A;  3OMI B;  4GT1 A;  2JS5 A;  2MW2 B;  4PA4 A;  4H33 A;  5EYP A;  4WFH A;  3L9D A;  1K4C C;  5JQG B;  3J81 N;  1E1R G;  3Q4H B;  1K73 W;  3ZHR A;  2EIK C;  4WFG A;  1OCC C;  1VQM V;  5FPR A;  3DTU B;  5LHI A;  2WLL B;  2EIN C;  4MVZ A;  4JI2 O;  2RMK B;  4F6R B;  1XBL A;  3SPI A;  1F7Y A;  2CUG A;  4ZBM A;  4UV9 A;  2MK3 A;  2EZP A;  3FYI B;  3UT5 B;  3ZMZ A;  2Y69 B;  3P3N A;  5TIS Z;  4UVC A;  5EBM C;  5DEC A;  1K92 A;  2DWD C;  5CN0 A;  2P67 A;  1V54 C;  4PDL A;  4ASU G;  2BSK B;  1EZV H;  2AXT Z;  2HLD G;  1PL4 A;  3G6B A;  1AIL A;  5HFL A;  4DW0 A;  1HDJ A;  4DR3 B;  2Q0A A;  2OT5 A;  4GX5 A;  1AR1 B;  1GN4 A;  1E79 G;  3CCR V;  5JWP A;  1IXM A;  1MNG A;  2ADP A;  5IYD O;  1EN6 A;  1G6U A;  3BY6 A;  2A06 H;  4YJ2 A;  3VBB A;  1OCR B;  3L75 H;  3EXA A;  3AG4 B;  3JAS A;  4F6E A;  4DV7 O;  1J95 A;  4XBF A;  5E79 Z;  2AZ0 A;  3MDS A;  5IYC O;  4PI0 A;  1NH2 D;  4PA6 A;  1PL0 A;  4I0X B;  4PHZ A;  5KUM A;  1SS3 A;  3RYH A;  5JQG A;  1VQL V;  4JI8 B;  1BL8 A;  1K33 A;  3RVY A;  3Q4H A;  4DR4 B;  4MTF A;  1MSD A;  2EIL C;  1PNL A;  3CX5 F;  2YEV A;  4K8Z A;  5BMV B;  1S3J A;  4MW3 A;  1ZUQ A;  5BXZ A;  1H2S B;  5IYB O;  1NS1 A;  2IW5 A;  3JCZ A;  1HR0 B;  3QG5 A;  4JAS A;  3ZS8 C;  1Q82 W;  4OPH A;  1SQQ H;  2GV9 A;  4FFB A;  3ABK B;  3UT5 A;  1IXB A;  5KAI Z;  4AHC A;  1KUQ A;  1QBZ A;  1WLE A;  2DQ0 A;  1XHX A;  4ABM A;  4R50 A;  4LH7 A;  5LYJ B;  1VQK V;  3CP1 A;  1M9N A;  1XMQ B;  3WG7 B;  1F51 A;  3SPG A;  1KKD A;  2ITD C;  3OGI B;  3FX7 A;  2Q7E A;  1BS3 A;  4KHP O;  3QO5 A;  1CEZ A;  3ZRS A;  2QM4 A;  3I56 V;  1AP5 A;  2WPD G;  4UUJ C;  2X0L A;  1AJP A;  2PF4 E;  1NR7 A;  5B66 Z;  4X1I B;  1RM1 C;  1KC8 W;  1SET A;  1BMF G;  2Q9L A;  4DO2 A;  4P30 A;  2F4V B;  2QEX V;  2Q8V A;  4FZ0 A;  4I0X A;  5J2U B;  4LH6 A;  3ML0 A;  2JEX A;  5H9C A;  4QPK A;  1MAB G;  4JI2 B;  2E3C A;  1BE3 H;  3T1Y B;  3OTF A;  3X2Q B;  2LJ2 A;  1W0J G;  2Q69 A;  3HKD A;  1IJG A;  4JF3 A;  3DXR B; 
#chains in the Genus database with same CATH homology
 2ADQ B;  5A9G A;  4FFK A;  3MDS A;  1IX9 A;  3LSU A;  1KKC A;  1MA1 A;  1JA8 A;  3K9S A;  3AK2 A;  3KDR A;  3DC6 A;  1MSD A;  1PM9 A;  3QVN A;  1AR4 A;  4GUN A;  1D5N A;  1ZUQ A;  1GN6 A;  1AP6 A;  1GN3 A;  3EVK A;  4YIO A;  1AVM A;  1IDS A;  1MMM A;  4E4E A;  3OT7 A;  2RCV A;  4BR6 A;  1IXB A;  1ZSP A;  1WB8 A;  1QNM A;  2CE4 A;  1LUW A;  1BSM A;  1EM1 A;  1VAR A;  2QKA A;  4JZG A;  2P4K A;  3CEI A;  1XUQ A;  1BT8 A;  1I0H A;  4JZ2 A;  1EN5 A;  1B06 A;  1XDC A;  1WB7 A;  1BS3 A;  1LUV A;  1Y67 A;  3TJT A;  1VEW A;  1AR5 A;  1XIL A;  3BFR A;  4JYY A;  1SZX A;  1N0J A;  1JR9 A;  1AP5 A;  1GN2 A;  3AK3 A;  2CDY A;  1ZTE A;  4C7U A;  1XRE A;  2QKC A;  4X9Q A;  1PL4 A;  1P7G A;  3C3T A;  1EN4 A;  1GN4 A;  1N0N A;  1ZLZ A;  1I08 A;  3DC5 A;  3IC9 A;  3AK1 A;  1MNG A;  2ADP A;  1EN6 A;  3RN4 A;  5AG2 A;  2AW9 A;  3C3S A;  2GDS A;  3KKY A;  4F6E A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...