3BFRA

The crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 78
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3bfrA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3bfrA02
1AP5A 1EN5A 2QKAA 3DC5A 1AR4A 2GDSA 4JYYA 4E4EA 1GN4A 4F6EA 1BSMA 3LSUA 1XDCA 1GN6A 1P7GA 1AVMA 1EM1A 3AK3A 4C7UA 3KKYA 3MDSA 2P4KA 5AG2A 1Y67A 1SZXA 3OT7A 1JA8A 2CDYA 2QKCA 1XUQA 1ZUQA 3TJTA 1JR9A 5A9GA 3RN4A 1WB7A 1PM9A 4YIOA 4JZGA 1BS3A 3CEIA 1IX9A 1MSDA 2AW9A 3EVKA 4JZ2A 1MMMA 1WB8A 1XREA 3IC9A 1D5NA 3QVNA 1ZTEA 3C3TA 1ZLZA 4FFKA 1IXBA 1BT8A 1MA1A 3BFRA 1LUVA 4X9QA 2ADPA 1N0NA 4YIPA 1PL4A 1LUWA 1AP6A 1KKCA 3AK1A 1N0JA 3K9SA 1MNGA 1B06A 1GN3A 1VARA 1EN6A 3AK2A 1GN2A 1I0HA 1ZSPA 4BR6A 4GUNA 1EN4A 1QNMA 3DC6A 1VEWA 2ADQB 1I08A 3C3SA 1AR5A 2CE4A 2RCVA 1IDSA 1XILA
chains in the Genus database with same CATH superfamily
4JI8B 2FTKA 4FK5C 5KAIZ 5IYBO 5IJ0A 5LHHA 3H1KH 4IIJA 4DR3B 4EEQA 2XAJA 1BE3H 5LOVB 3J80N 1W0KG 4FLWA 2A06H 1AVMA 4K8XA 1VF7A 1Q3EA 2H3OA 4WFHA 1X59A 4GX2A 3A0HZ 3QG5A 4C7UA 3E83A 4ZOLB 2ZE7A 4J7JA 2FKXA 4LNUB 1KUQA 2OCCB 2LGQA 3OEHG 5EYPA 4DV5O 4FM2A 2LP7A 1N34O 1JA8A 1V55C 2ZM6O 4LFBB 4I55B 4H33A 3RYHB 1VF6A 4PI2A 2N05A 3ASOB 3CCRV 1COWG 1YDXA 2KG7A 3CEIA 1PD3A 3RYCB 1P7BA 2PTMA 3EHBB 4RAIA 1J95A 4L87A 5DM6V 2IU3A 5IYZA 2Y0PA 4X65O 4O4HA 3UCSC 2W0XA 3BFRA 4UB6Z 5E79Z 1TVKA 3OMNB 1Y6XA 4PA7A 2QSAA 2F23A 1Q82W 4DV5B 1WPXA 4J42A 4JI1O 1Z5VA 1N34B 2P5OA 2ZM6B 3ZN1A 1H5WA 1DTOA 2PZSA 5F2VO 2ZD9A 1TGOA 5L3BA 2WLHA 1VQ7V 2HVKC 3JARA 2YSUB 4BR6A 4YJ2A 4GKKO 1V9PA 1K73W 4HNAB 5JH7B 4HYOA 1I08A 3C3SA 2GHYA 4PV1B 4JAAA 4PDVA 3P30A 4CH4A 4X66B 1EBOA 4G28B 3TXQA 3MHSC 3ETEA 2HP8A 3NR7A 4K3AA 2Q7GA 1QQCA 1OCZB 1WLEA 4WFBV 1BSMA 1VP7A 4JI1B 3ZHRA 1Q90D 4WFEA 1HNWO 4GT1A 4MVZA 2LJ2A 1EM1A 4JI6B 3K08A 4RUFA 2ZE8A 3FAVA 2CTWA 4LBEC 4UVAA 4Q6GA 5IT9N 4EFBA 4X89A 3MDSA 3RVZA 1R6NA 4FLVA 4ZI7A 4JI5O 3B8NA 3I56V 2NLJC 3JASB 5B1NA 5H6RA 2QA4V 5GONB 1OV9A 4X20A 4FLYA 5IWAO 1K92A 2Z3YA 3H9VA 3FX7A 5A9GA 1R6KA 5LXTA 3F5WC 2ZNJA 3STLC 4EB6B 3OTOO 1E1QG 3E22A 4OX9O 2YICA 2WPDG 2KKWA 1WN7A 1BGYH 2ZIMA 4JAVA 1HNWB 4JGSA 3CSXA 4AI8A 5J9PC 3E86A 2RQ6A 1SRYA 2IH1C 4U3JB 2PY5A 1VQ4V 1SQXH 1M57C 1PNLA 5J2TB 4X1IB 1GM9A 5IWAB 1MNGA 2JS5A 2DQ0A 4MVOA 2QDOA 5IJ0B 1ZAUA 1NH2B 2MW2B 4AILC 1NTMH 4IIJB 4UCVA 2EIJB 3L72H 4QE9A 2C2AA 1JNBA 3OTOB 3CJHB 5LBQA 4YHHB 5LYJB 4X62B 3BPZA 1SC5B 1Q6IA 2Q73A 4OX9B 4TV9A 2PGGA 5EZYA 1FKAO 1IDSA 5L3FA 2YI8A 2F4VO 1S3JA 3FYEB 3ZJZA 2GDSA 5JCOA 4DV6O 1OCRB 1YI2V 1K5SA 2EILB 1NTKH 4GCZA 2KG7B 3UT5A 3KKYA 4Z1VA 1ENVA 1D2DA 2E76B 3T2MA 1Y67A 2BTOA 5FPOA 1AI5A 4J9YB 3OT7A 5KA6A 3BA9A 3STZC 2ZXWB 4A5UB 4O4HB 3J7AU 2B5UA 1FPOA 1TVKB 5DEDA 2EIMB 4Z1MG 1IX9A 2F4VB 1Q86W 1R3LC 1N33O 2R9RB 3WB2A 4DV6B 1VQKV 2DJVA 1YXBA 1S5HC 3BHPA 2EIKB 1YTFB 1H2KA 4WBNA 2WSSG 1F7YA 3SYPA 3ETDA 4QNHB 3JARB 1BHAA 4YJ2B 3BABA 3ZRVA 1IBKO 1FJGO 4P9OA 3HKEA 2IH3C 2QM7A 2DYRC 1YJNV 3RGBA 3LDCA 4B08A 1VF5B 3GWKC 5D5QA 4YJ3A 4J11A 1MG1A 1I0HA 5FLXN 4GUNA 1N33B 3K0GA 2XNDG 1HNZB 4JAUA 5B1AC 1JVMA 1U97A 4FJCC 3B09A 3FAVB 3N2GA 3I5DA 1S5LZ 1JPXA 2JEUA 1RM1B 2QGNA 1SQQH 3FFQA 3SYAA 3ZN0A 5EIBD 4X20B 1FFXA 1XHXA 5GTIZ 1IBKB 2YIBD 5LXTB 1FOUA 1KD1W 3E22B 4RQFA 3G6EV 2BOCC 4TV8B 2ZKOA 3CCLV 1SQGA 4K0KO 2ITCC 2L6LA 2FL4A 4QPJA 2JGDA 4NXNO 1YF2A 3ZHTA 1QLNA 3VBBA 4IHJA 2QWRB 1GMGA 3F7VC 4NXMB 1OCCB 4CH3A 1IBLO 3RFRA 2ZDIA 3QVNA 4G27B 3ABLC 1L1FA 3OFNG 1AJQA 4L8JA 2IM9A 1IBMO 3AG7A 3L75H 4AQYO 2GTSA 3RT3C 4H0LB 4LF9O 4ZBMA 4JI7O 5LGNA 2VWJA 3PN1A 4TV9B 4HAMA 5EZYB 3RYIA 1Q8IA 1AP6A 3FB7C 3U10A 1N0JA 2P7TC 4LH7A 4LNUA 4JTDB 1K8AW 4NXNB 3KZIZ 1JFFA 2CTRA 4IT5A 3SPHA 1QBZA 1QU7A 5L3DA 1RP3B 4NVPA 1XNRB 5JQGA 3EFFK 3RYHA 3CRRA 1ZSPA 2Y69C 1IBMB 1AR5A 2PUSA 3UT5B 3P3NA 4OXSA 3TK1A 1R1BA 2CGOA 4J10A 4LF9B 1Y74A 5LGTA 3P3PA 3OUSA 4JI7B 3SJCC 2YUAA 3LSSA 2QR4A 3OR7C 4JYYA 2ZINA 3OMAB 1N32O 4ZKIA 1GN4A 3ETGA 2P90A 3T1YO 3E2EA 1GN6A 4DV3B 1Q6UA 1P7GA 5B3SC 2EINC 2F1MA 2X0LA 2ZR3A 3SGIA 4GX0A 2CTQA 5H2FZ 1VMGA 2IBZH 3JATA 2N74A 5AG2A 5CA1A 3AG3B 2Q9LA 1YTFD 3ASNC 1M93A 2A9HA 4WBNB 5D5PA 1GK9A 3JCZA 3K04A 1N36O 1XNQO 1HW7A 2IJHA 4LF5B 4HNAA 5JH7A 1MMMA 2P6JA 2WA3A 3IC9A 4PD4F 3E89A 3UQ8A 1NI8A 1N32B 1I7FA 1ZLZA 2PI4A 3T1YB 2A7WA 3CCMV 4YJ3B 1NS1A 2HKOA 4GKJO 4CC6A 4WCEV 2QJ1A 2G38A 2WLKA 1NVPB 2Z0AA 3CRMA 1BL8A 4X88A 2CTPA 1OCOC 5BXZA 1PL4A 3CB2A 1P49A 1KKCA 2YI9A 2UUBO 3N2GB 1QLEC 5LP6C 1B3QA 3CYOA 4MT8A 1B06A 3B40A 3JASA 2IW5A 2QWNB 3IC7A 5LL6Y 1N36B 1FXKC 1FFXB 3CWBH 3FD9A 3CD6V 4PHZA 1FXHA 5JWPA 3JD1A 3OW2U 4DV0O 2CE4A 2E3CA 4GKJB 1JCHA 1K4DC 2XAQA 1Y4MA 3ZCCA 4R7CA 4I0XA 5FL7G 1NR7A 4CBCA 4IHJB 2UUBB 2IJJA 3X2QC 2K9PA 4I50A 4U3JA 2X7RB 1QR9A 3P32A 3OTFA 2XAGA 1HR0O 3IAYA 5BMVA 2P4KA 2XTAA 3ZHQA 3G4SV 3G71V 4FM0A 2Y0IA 3WG7B 4X1YA 3CJHA 4XDLA 4IL6Z 4DV0B 2WWWA 5LYJA 2DE0X 1AILA 4BWAA 1J5EO 1XQ8A 4LC1A 4JI3B 1BS3A 3K79A 2AHZA 3RYIB 3FB8C 4WFAV 2W0FC 3T1HO 1CXZB 4JI2O 3C3TA 2AGAA 3D36C 2FYUH 1JFFB 4I9WA 4H37A 3CPWU 2LFRA 2DYSC 3HKBA 1D5AA 5JQGB 4TT3G 3ABTA 3JAKA 1V54B 2O57A 3NXSA 2HHHO 1HR0B 4XDKA 4ASUG 2OWOA 4W4LA 2JJ2G 4WF9V 1ORQC 1Y74B 1ROPA 2BSKA 3TGUH 1J5EB 3VQXA 1DGSA 3ABKB 4LFAO 4UCUA 4PA4A 3T1HB 5LMNO 1RPOA 4JI2B 1NQTA 3AG4C 3OMIB 1VQ9V 2UUAO 3SPGA 5KMGA 2OCCC 2Y48A 1SETA 4R8CA 2A79B 4YXWG 2YEVA 1YEWA 3JATB 5CA1B 4G2KA 2HHHB 3R65A 2AHYA 1BZKA 3ASOC 1CP9A 5BR8O 1Y66A 1H2NA 3LSUA 5IY5C 4B3SO 1GRJA 1H2LA 3BCCH 4B7EA 3RYFA 4UCTA 4FM1A 1EZJA 2Q67A 4RO2A 4X65B 4LFAB 3SYCA 1PNMA 1Q7YW 1FD9A 4FIPC 3W7XA 1SZXA 1N8RW 1JQ0A 1KU9A 1TUBA 5LMNB 2VS0A 5KAFZ 1QCEA 5IE9A 1NVPD 1PPJH 3CS5A 3B2EE 1SF9A 2UUAB 2Q8VA 4LFCO 4I9QA 1K4CC 4FZ0A 3S3XA 3FKSG 1SS3A 4IYHA 4UV8A 5EC2C 1AB3A 4MTXA 1YCIA 3IGAC 3L70H 3BY6A 5BR8B 4DXWA 5KHJA 4YY3O 3HKCA 3U11A 4EFEA 1EZVH 1A32A 1IXBA 1SZTA 2R70A 3ZX6A 2IJIA 4GKKB 5LHIA 4Q20A 1KBHA 4BIOA 1PP9H 2A0LA 2ADPA 2BCCH 2VRZA 1N0NA 1FAFA 4WFFA 5KHKA 1H2SB 2DOSA 1OZ0A 4TV8A 5LMUO 2ARHA 1JMKC 5KHIA 4NYKA 4LFCB 3L9DA 4LCUC 4I0XB 1QHTA 2E5LO 2F95B 1SKVA 2CAZC 3E35A 2F93B 3OAAG 4I50B 4JI5B 3LSQA 1KQSU 4JYBA 4YY3B 1AR1B 2HVJC 5BMVB 3OUFA 5KUMA 2UUCO 3ABUA 2N04A 5EIBC 1EN5A 1AROP 2RJZA 2EULA 1TA8A 4JTAB 5GTHZ 4FLTA 2VQFO 3HPLC 3W7UA 4X1YB 3OGIB 2UU9O 5KA5A 2QEXV 5B1BB 5LMUB 1VQLV 4UUJC 2QTSA 1Q81W 1NJIW 4HZ3A 4MTFA 2YDEA 1JJOA 2EX3A 4DYLA 3HKBB 4CH6A 3JAKB 4LH6A 1PM9A 4DR2O 1URFA 2DWEC 2UUCB 1F4NA 4NKGB 3BAAA 3IJ4A 2X6CA 2Q69A 2HR3A 1H2GA 4UV9A 2WLNA 3CRCA 4MVMA 3ICXA 4LF7O 2VQFB 1L8DA 2EBOA 2QWQB 4KP4A 4B3MO 2BSKB 5EBMC 2ZE5A 2UU9B 4TUYA 1I5XA 3K59A 3PJSK 2WLJA 3M7MX 1NZ6A 2Y4TA 1H38A 2PYLA 4I5SA 3ZHUA 1MABG 3N2KA 5KMGB 3AK1A 4PDLA 3K9SA 2YEVB 3G67A 1BMFG 1SERA 1OCRC 2EILC 4DR2B 1VF6C 3RVYA 5CA3A 2WLIA 1NR1A 4D7TA 2XAHA 1X4TA 4F4LA 3UO2A 4D7SA 2LW1A 4LF7B 5LHGA 3DC6A 1M56B 3RYFB 3DXRA 1GH6A 4WFGA 4J80A 2UXDO 4R6ZA 2M6YA 1AP5A 3SDLA 4CC5A 3AEIA 1WA8B 2WA4A 3CC4V 1TUBB 4N23A 4E4EA 2BOBC 1NT2B 4NR1A 4DO2A 3ABMB 2EIMC 4DUYO 2Q68A 5FNVA 2X6AA 1YJWV 1K9MW 4HBNA 2OIGA 3AK3A 3JALA 3FYIB 1G4YB 1NTZH 3QO7A 3RWRD 1YHQV 2EIKC 4DV1O 2Z5UA 1QVGU 3HKCB 5CB4A 3BA8A 4OPHA 1R3IC 4FFBB 4UVBA 1JR9A 4DK1A 3SJAC 5EK0A 2MK3A 1I94O 1FJGB 5EBLC 5H5NA 2HLDG 4PA6A 2YC0A 3ZMZA 3SYQA 2UXDB 4U7OA 3JYCA 3CCJV 1GTOA 1R3KC 1HP8A 1LR1A 2BTQB 2OTLV 2JDIG 4N21A 3GVMA 4K8ZA 3ABLB 2HEPA 5A2QN 1T5EA 1JJ2U 3JD4A 2V4DA 4FFKA 2RNBA 3RW0A 4DV2O 3DTUB 1BQ0A 1EFRG 4XDJA 1LUVA 3ZMUA 4QIWF 3CC7V 1WJZA 1ZWIC 4U7NA 4O2BB 4JTCB 4QJFB 1VQOV 4DV1B 4BW9A 1RM1C 5LA6B 1Q5OA 3CRQA 2ZR2A 1H2MA 4X1KA 1I94B 1NH2D 4B7KA 3LUTB 1Z2GA 1GN2A 4U3FH 5J2UB 1YIJV 3AG1B 3F5TA 2Y69B 2OT5A 1W2BU 3HR0A 1Z5WA 4DR7O 4K0KB 2ETNA 1SQPH 4DV2B 2ITDC 3DSQA 2E74B 1E79G 2HG5C 4R50A 2QKAA 2GV9A 3D8CA 1MZFA 4LF4O 1TUEB 1IBLB 3QTCA 1OCCC 1GM8A 5K1PA 2AXTZ 1WAZA 1M1KW 5B3SB 2EINB 4AQYB 3A2FA 1W0JG 2YXLA 2EJRA 4DR5O 2YS8A 4P9PA 1XMOO 2L35A 3KCXA 3A0RA 4TUYB 4DR4O 1ZUQA 5JVDA 4B3RO 4DR7B 4YIOA 1VQ8V 2HJDA 2AW9A 4FMTA 2JRIA 1XREA 3N2KB 1L0NH 1P84F 4JI0O 2D3OW 3THOA 2UXNA 3K06A 4BIUA 4TWKA 5JCOC 4LF4B 2F43G 3ZRWA 2JK5C 2WLIB 2PYJA 5L3EA 1RFYA 4KXRA 4X9QA 3K9AA 2NN4A 2V1DA 3QO8A 3TETA 4P30A 4DR5B 3T4ZA 2R9AA 4BIZA 4RWUA 2XT9A 4KFMA 3DXRB 3QF7A 4QGPA 1XMOB 4H44B 2HJFC 4DR4B 2OYQA 4DR6O 2EZOA 5LP6B 4B3RB 3UKMA 3ZRXA 2X6BA 1M4UA 3CHXA 1VARA 4PELA 5EC1C 2VQEO 2Q4PA 4JI0B 1Y76A 5FNVB 3OD4A 4F6RA 3R66A 3K3WA 2Q7EA 3JALB 4E2LA 1KMIZ 2ODMA 1L0LH 3VOUA 3E8GA 1YVWA 4DV4O 4GZRB 1XNQB 5EBWC 3M8AA 4O4IA 5CMUA 5CB4B 4EKWA 4F6EA 1THZA 3UO3A 5TISZ 4CH5A 5B1OA 3OR6C 1SA0B 1HNXO 1JX9A 1P4RA 5K1XA 4TQFA 2ZQMA 4DR6B 1R73A 3K03A 3ZMTA 2P22C 3AG2B 4JASA 3L71H 5IJ9A 3IFXA 1OJHA 5KUKA 1IVSA 1I5YA 4PDRA 1B04A 2M7WA 2ZNIA 1Q43A 1N4CA 5IDJA 4JI8O 2XHBA 3A0BZ 3RN4A 1WB7A 4LWSA 3T1CA 2AZ2A 1O9HA 2UXXA 2R72A 4UCSA 2LQTA 4DV4B 3WU2Z 3O65A 3B8MA 3UM7A 4DK0A 5C93A 3CCVV 4X1KB 1CEZA 1ZL8A 1HNXB 3SYOA 4CS2A 1PV0A 1V55B 1E1RG 3ML0A 3T4DA 1DF4A 3BRCA 1U96A 2JIZG 4NTXA 1IXMA 5B5EZ 2W6IG 3FB6C 3LNMB 3C90A 2CH7A 5HFMA 3ZIAG 1DLBA 4DR1O 1BQZA 3QNEA 4H13B 4X64O 5B66Z 2RN9A 1QNMA 2ZDIC 2Q5ZA 2ADQB 1XEQA 5KX5A 3AG4B 3E8HA 1S77D 1XILA 3OE7G 2ATKC 1XI1A 3LNNA 3I55V 1WPBA 1UJWB 3WG7C 3DC5A 3N27A 3MD0A 3ZMSA 2ILMA 5DECA 1XBLA 5JVDB 2YXYA 2YXHA 2E75B 4NB5A 4JYCA 3HB3B 5IY5B 4UXNA 1US6A 1NKDA 2F66C 2H8PC 4MVUA 5GW7A 4DR1B 4GX5A 2DMXA 4X64B 3EXAA 5L3CA 2CDYA 4KUMA 3ZRWB 1V54C 4X66O 3SJBC 1UFIA 4DRXA 4MVRA 1M90W 2QKSA 4ICGA 1PKXA 4DW1A 4JZ2A 4FLZA 1K34A 5JJEB 1D5NA 3VQWA 4JI6O 5C8YA 1NU1H 2FMLA 3ABKC 3WB1A 3Q4HA 4J9ZB 2DWDC 1WA8A 1SQBH 1WP8A 1KP2A 4O2AB 4KHPO 1CPYA 2XAFA 1NBMG 1Y76B 2D2CB 5DN6G 4AHCA 4F6RB 4BW5A 1LUWA 1SQVH 2Y4UA 4FZ1A 3D3QA 4K35A 4W4KA 2UXBO 1XL6A 4IYIA 4B3SB 1FS0G 1DK1A 4UCOA 4O4IB 4FFBA 3TCUA 1F23A 3W7WA 4I7ZB 2LW7A 2P06A 4ZIBA 3K0DA 1EN4A 2Q7HA 4JYAO 1MOFA 2LGWA 4GLXA 2H94A 3H1IH 2R9IA 5IJ9B 2QTOA 1M9NA 1AI4A 4QE7A 3JD2A 2BTQA 4KHPB 1M57B 1OCZC 4JF3A 1K33A 3G80A 4KL1A 3CCSV 2Q0AA 4LF6O 1ZX3A 2HFEC 2XOKG 4LWSB 3K57A 1R6TA 4O2BA 4YHHO 2PF4E 3JAWA 4UB8Z 2UXBB 2JS3A 4JPRA 4X62O 1BHBA 5LA6A 1MZEA 4O4LB 3ZBHA 4TQDA 2GUZA 2KB1A 2B9ZA 3ETQA 3ZEDA 4XBFA 3K5NA 1ZL8B 4MTGA 1XMQO 5L3GA 4JYAB 1SESA 2UXCO 3JSLA 5CA0A 4CZZA 4TOIA 2KSDA 5ITZA 1S76D 1F4MA 5J2UA 4PDMA 2ZT9B 3TXSA 4ABMA 4FPPA 4LF6B 4J7KA 4PA3A 2CH7B 2E5LB 3M99B 3GWOA 1BT8A 1KB9F 2GBOA 3FB5C 1VQMV 5KHGA 3D3IA 1JOYA 1AI7A 2B1GA 5KX5B 1XMQB 4CS4A 2KQXA 5EYPB 4BAYA 2UXCB 5BY1A 3LDEA 2QM8A 1G6UA 2EIJC 3CX5F 3CXHF 1EN6A 1VQNV 5B1BC 3S3WA 1RSOA 1YZBA 1YITV 1VEWA 1FYJA 4JV5O 3WFVA 1YJ9V 3TJTA 1BCCH 2FB5A 5IYZB 2DYRB 3BVOA 1WP7A 5CBHA 2WLLA 1AR4A 1VQ6V 4P2ZA 4MW3A 4DRXB 5KHHA 4MSWC 2DW4A 2XASA 3K58A 1KECA 1H8EG 5CBGA 4B3MB 5B1AB 3H1LH 1HNZO 5C8YB 1RPRA 1PL0A 2ZXWC 5E1AC 3SR2C 3MHHC 3Q4HB 5LP6A 3JCUZ 1DF5A 2QKCA 1XUQA 3K5MA 2WAMA 1IZ3A 1FXKA 4JV5B 2DQ3A 1WNSA 3H01A 3JD0A 1MSDA 3EVKA 1AJPA 1S72V 2XUMA 4NTWA 4MVQA 1K5QA 2P4VA 3E8BA 2OCHA 1UPGA 3DGEA 3ZHVA 3W7TA 2LO1A 4PI0A 1MA1A 3CCEV 1K3EA 4I4TA 1SQFA 2CGNA 2ZIOA 1G8MA 1M56C 3B4SA 4O4JA 3VQYA 1SA0A 3KCYA 3CCUV 4CS3A 1HDJA 1VQ5V 3OEEG 1GM7A 2OIEA 1KYOF 4NXMO 2VWKA 4ZI7B 3ZS8C 3OGCC 2NR5A 5JJJB 1GN3A 4DUYB 3L74H 4IGGA 2QM4A 3ABMC 5H6QA 1VQPV 2ZE6A 5KLVH 1PNKA 3JAWB 2RCVA 3HKDA 4GX1A 3SPIA 2GUZB 5LGUA 3OM3B 4RQEA 3K5LA 1R3JC 4ZHQA 3WB0A 3MAQA 2B1IA 3D36A 4FLXA 3SJQC 2QWPB 5CA0B 3JD3A 1XDCA 3J81N 5BZBA 2RDCA 2YIDA 3LDDA 1FFTB 5ITZB 5IYDO 1XHZA 1XNRO 3VQVA 2WLMA 1LNQA 4MVSA 3G6BA 3CMEV 2DN9A 4UVCA 2JGUA 2LFSA 2YIAA 1AI6A 4RUEA 2CK3G 5LOVA 2CUGA 2JJ1G 4DV7O 4B3TO 2Q6AA 2EZPA 1K7DA 4DW0A 3RBZA 3KDRA 4DV3O 4ZOLA 1ZTEA 1XL4A 4J7ZA 3CE2A 3W7SA 2BE3A 3ZHSA 1O9GA 5CN0A 3SPJA 1S0VA 1QR8A 4I55A 4MW8A 4J41A 1H8HG 3ASNB 3AG1C 1RSOB 3B77A 1YSCA 3H1HH 1IURA 3F7YC 3RYCA 2P67A 3JAMN 3APQA 4MTOA 2IJKA 3CC2V 1GO3F 1HWYA 4LF5O 4LF8O 4LP8A 3QO5A 1QVFU 2WLLB 2JEXA 4DV7B 4B3TB 2AZ0A 2NNUA 3CRAA 1B6QA 1AJNA 3ZMVA 2ZCEA 2EJ7A 4X8AA 2PI5A 1VIBA 1MSWD 1F51A 1OCOB 3APOA 2QWOB 3ZRSA 4PJ0Z 1KC8W 1Q6HA 1QLEB 4Z2WA 3O9OA 1TAEA 1G1XB 4O2AA 1FXKB 1K97A 3JSNA 1FXVA 4LF8B 3HKEB 4GYCB 3CXCU 5CBFA 4UCRA 3BEHA 3AG3C 3U0ZA 4QPKA 3A8TA 2GSMB 4DUZO 4I4TB 4O4JB 3SPCA 2K1EA 4JZGA 4JI4O 1GKFA 1WB8A 1XOUA 3X2QB 4OGQB 3CMAV 2GTAA 3GB7C 2VQEB 1M5IA 2A3QA 3K5OA 4TSFG 5GONA 3H1JH 3L73H 4LR3A 1GAXA 2YIBA 5HFLA 4FLUA 4DR3O 4YIPA 4EB6A 2OTJV 1IJGA 4FVMA 1W59A 3CP1A 4MS2A 2RMKB 4JI3O 4O4LA 3HKDB 2IU0A 5JJNB 4DUZB 1KP3A 4ZHQB 5FPRA 2JVDA 3KG2A 2JGDB 2W6JG 4JI4B 2Q0OC 2QE7G 3AK2A 2DYSB 5H9CA 1S5JA 4PA9A 4UFZA 3AG2C 4D6TH 1OHHG 2V7QG 4LFBO 1KKDA 5IYCO 3E8FA 4OPAA 3CCQV 4NTYA 5J2TA 4X1IA
chains in the Genus database with same CATH topology
1AP5A 1EN5A 2QKAA 3DC5A 1AR4A 2GDSA 4JYYA 4E4EA 1GN4A 4F6EA 1BSMA 3LSUA 1XDCA 1GN6A 1P7GA 1AVMA 1EM1A 3AK3A 4C7UA 3KKYA 3MDSA 2P4KA 5AG2A 1Y67A 1SZXA 3OT7A 1JA8A 2CDYA 2QKCA 1XUQA 1ZUQA 3TJTA 1JR9A 5A9GA 3RN4A 1WB7A 1PM9A 4YIOA 4JZGA 1BS3A 3CEIA 1IX9A 1MSDA 2AW9A 3EVKA 4JZ2A 3KDRA 1MMMA 1WB8A 1XREA 3IC9A 1D5NA 3QVNA 1ZTEA 3C3TA 1ZLZA 4FFKA 1IXBA 1BT8A 1MA1A 3BFRA 1LUVA 4X9QA 2ADPA 1N0NA 4YIPA 1PL4A 1LUWA 1AP6A 1KKCA 3AK1A 1N0JA 3K9SA 1MNGA 1B06A 1GN3A 1VARA 1EN6A 3AK2A 1GN2A 1I0HA 1ZSPA 4BR6A 4GUNA 1EN4A 1QNMA 3DC6A 1VEWA 2ADQB 1I08A 3C3SA 1AR5A 2CE4A 2RCVA 1IDSA 1XILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AP5 A;  1EN5 A;  2QKA A;  3DC5 A;  1AR4 A;  2GDS A;  4JYY A;  4E4E A;  1GN4 A;  4F6E A;  1BSM A;  3LSU A;  1XDC A;  1GN6 A;  1P7G A;  1AVM A;  1EM1 A;  3AK3 A;  4C7U A;  3KKY A;  3MDS A;  2P4K A;  5AG2 A;  1Y67 A;  1SZX A;  3OT7 A;  1JA8 A;  2CDY A;  2QKC A;  1XUQ A;  1ZUQ A;  3TJT A;  1JR9 A;  5A9G A;  3RN4 A;  1WB7 A;  1PM9 A;  4YIO A;  4JZG A;  1BS3 A;  3CEI A;  1IX9 A;  1MSD A;  2AW9 A;  3EVK A;  4JZ2 A;  1MMM A;  1WB8 A;  1XRE A;  3IC9 A;  1D5N A;  3QVN A;  1ZTE A;  3C3T A;  1ZLZ A;  4FFK A;  1IXB A;  1BT8 A;  1MA1 A;  3BFR A;  1LUV A;  4X9Q A;  2ADP A;  1N0N A;  4YIP A;  1PL4 A;  1LUW A;  1AP6 A;  1KKC A;  3AK1 A;  1N0J A;  3K9S A;  1MNG A;  1B06 A;  1GN3 A;  1VAR A;  1EN6 A;  3AK2 A;  1GN2 A;  1I0H A;  1ZSP A;  4BR6 A;  4GUN A;  1EN4 A;  1QNM A;  3DC6 A;  1VEW A;  2ADQ B;  1I08 A;  3C3S A;  1AR5 A;  2CE4 A;  2RCV A;  1IDS A;  1XIL A; 
#chains in the Genus database with same CATH topology
 4JI8 B;  2FTK A;  4FK5 C;  5KAI Z;  5IYB O;  5IJ0 A;  5LHH A;  3H1K H;  4IIJ A;  4DR3 B;  4EEQ A;  2XAJ A;  1BE3 H;  5LOV B;  3J80 N;  1W0K G;  4FLW A;  2A06 H;  1AVM A;  4K8X A;  1VF7 A;  1Q3E A;  2H3O A;  4WFH A;  1X59 A;  4GX2 A;  3A0H Z;  3QG5 A;  4C7U A;  3E83 A;  4ZOL B;  2ZE7 A;  4J7J A;  2FKX A;  4LNU B;  1KUQ A;  2OCC B;  2LGQ A;  3OEH G;  5EYP A;  4DV5 O;  4FM2 A;  2LP7 A;  1N34 O;  1JA8 A;  1V55 C;  2ZM6 O;  4LFB B;  4I55 B;  4H33 A;  3RYH B;  1VF6 A;  4PI2 A;  2N05 A;  3ASO B;  3CCR V;  1COW G;  1YDX A;  2KG7 A;  3CEI A;  1PD3 A;  3RYC B;  1P7B A;  2PTM A;  3EHB B;  4RAI A;  1J95 A;  4L87 A;  5DM6 V;  2IU3 A;  5IYZ A;  2Y0P A;  4X65 O;  4O4H A;  3UCS C;  2W0X A;  3BFR A;  4UB6 Z;  5E79 Z;  1TVK A;  3OMN B;  1Y6X A;  4PA7 A;  2QSA A;  2F23 A;  1Q82 W;  4DV5 B;  1WPX A;  4J42 A;  4JI1 O;  1Z5V A;  1N34 B;  2P5O A;  2ZM6 B;  3ZN1 A;  1H5W A;  1DTO A;  2PZS A;  5F2V O;  2ZD9 A;  1TGO A;  5L3B A;  2WLH A;  1VQ7 V;  2HVK C;  3JAR A;  2YSU B;  4BR6 A;  4YJ2 A;  4GKK O;  1V9P A;  1K73 W;  4HNA B;  5JH7 B;  4HYO A;  1I08 A;  3C3S A;  2GHY A;  4PV1 B;  4JAA A;  4PDV A;  3P30 A;  4CH4 A;  4X66 B;  1EBO A;  4G28 B;  3TXQ A;  3MHS C;  3ETE A;  2HP8 A;  3NR7 A;  4K3A A;  2Q7G A;  1QQC A;  1OCZ B;  1WLE A;  4WFB V;  1BSM A;  1VP7 A;  4JI1 B;  3ZHR A;  1Q90 D;  4WFE A;  1HNW O;  4GT1 A;  4MVZ A;  2LJ2 A;  1EM1 A;  4JI6 B;  3K08 A;  4RUF A;  2ZE8 A;  3FAV A;  2CTW A;  4LBE C;  4UVA A;  4Q6G A;  5IT9 N;  4EFB A;  4X89 A;  3MDS A;  3RVZ A;  1R6N A;  4FLV A;  4ZI7 A;  4JI5 O;  3B8N A;  3I56 V;  2NLJ C;  3JAS B;  5B1N A;  5H6R A;  2QA4 V;  5GON B;  1OV9 A;  4X20 A;  4FLY A;  5IWA O;  1K92 A;  2Z3Y A;  3H9V A;  3FX7 A;  5A9G A;  1R6K A;  5LXT A;  3F5W C;  2ZNJ A;  3STL C;  4EB6 B;  3OTO O;  1E1Q G;  3E22 A;  4OX9 O;  2YIC A;  2WPD G;  2KKW A;  1WN7 A;  1BGY H;  2ZIM A;  4JAV A;  1HNW B;  4JGS A;  3CSX A;  4AI8 A;  5J9P C;  3E86 A;  2RQ6 A;  1SRY A;  2IH1 C;  4U3J B;  2PY5 A;  1VQ4 V;  1SQX H;  1M57 C;  1PNL A;  5J2T B;  4X1I B;  1GM9 A;  5IWA B;  1MNG A;  2JS5 A;  2DQ0 A;  4MVO A;  2QDO A;  5IJ0 B;  1ZAU A;  1NH2 B;  2MW2 B;  4AIL C;  1NTM H;  4IIJ B;  4UCV A;  2EIJ B;  3L72 H;  4QE9 A;  2C2A A;  1JNB A;  3OTO B;  3CJH B;  5LBQ A;  4YHH B;  5LYJ B;  4X62 B;  3BPZ A;  1SC5 B;  1Q6I A;  2Q73 A;  4OX9 B;  4TV9 A;  2PGG A;  5EZY A;  1FKA O;  1IDS A;  5L3F A;  2YI8 A;  2F4V O;  1S3J A;  3FYE B;  3ZJZ A;  2GDS A;  5JCO A;  4DV6 O;  1OCR B;  1YI2 V;  1K5S A;  2EIL B;  1NTK H;  4GCZ A;  2KG7 B;  3UT5 A;  3KKY A;  4Z1V A;  1ENV A;  1D2D A;  2E76 B;  3T2M A;  1Y67 A;  2BTO A;  5FPO A;  1AI5 A;  4J9Y B;  3OT7 A;  5KA6 A;  3BA9 A;  3STZ C;  2ZXW B;  4A5U B;  4O4H B;  3J7A U;  2B5U A;  1FPO A;  1TVK B;  5DED A;  2EIM B;  4Z1M G;  1IX9 A;  2F4V B;  1Q86 W;  1R3L C;  1N33 O;  2R9R B;  3WB2 A;  4DV6 B;  1VQK V;  2DJV A;  1YXB A;  1S5H C;  3BHP A;  2EIK B;  1YTF B;  1H2K A;  4WBN A;  2WSS G;  1F7Y A;  3SYP A;  3ETD A;  4QNH B;  3JAR B;  1BHA A;  4YJ2 B;  3BAB A;  3ZRV A;  1IBK O;  1FJG O;  4P9O A;  3HKE A;  2IH3 C;  2QM7 A;  2DYR C;  1YJN V;  3RGB A;  3LDC A;  4B08 A;  1VF5 B;  3GWK C;  5D5Q A;  4YJ3 A;  4J11 A;  1MG1 A;  1I0H A;  5FLX N;  4GUN A;  1N33 B;  3K0G A;  2XND G;  1HNZ B;  4JAU A;  5B1A C;  1JVM A;  1U97 A;  4FJC C;  3B09 A;  3FAV B;  3N2G A;  3I5D A;  1S5L Z;  1JPX A;  2JEU A;  1RM1 B;  2QGN A;  1SQQ H;  3FFQ A;  3SYA A;  3ZN0 A;  5EIB D;  4X20 B;  1FFX A;  1XHX A;  5GTI Z;  1IBK B;  2YIB D;  5LXT B;  1FOU A;  1KD1 W;  3E22 B;  4RQF A;  3G6E V;  2BOC C;  4TV8 B;  2ZKO A;  3CCL V;  1SQG A;  4K0K O;  2ITC C;  2L6L A;  2FL4 A;  4QPJ A;  2JGD A;  4NXN O;  1YF2 A;  3ZHT A;  1QLN A;  3VBB A;  4IHJ A;  2QWR B;  1GMG A;  3F7V C;  4NXM B;  1OCC B;  4CH3 A;  1IBL O;  3RFR A;  2ZDI A;  3QVN A;  4G27 B;  3ABL C;  1L1F A;  3OFN G;  1AJQ A;  4L8J A;  2IM9 A;  1IBM O;  3AG7 A;  3L75 H;  4AQY O;  2GTS A;  3RT3 C;  4H0L B;  4LF9 O;  4ZBM A;  4JI7 O;  5LGN A;  2VWJ A;  3PN1 A;  4TV9 B;  4HAM A;  5EZY B;  3RYI A;  1Q8I A;  1AP6 A;  3FB7 C;  3U10 A;  1N0J A;  2P7T C;  4LH7 A;  4LNU A;  4JTD B;  1K8A W;  4NXN B;  3KZI Z;  1JFF A;  2CTR A;  4IT5 A;  3SPH A;  1QBZ A;  1QU7 A;  5L3D A;  1RP3 B;  4NVP A;  1XNR B;  5JQG A;  3EFF K;  3RYH A;  3CRR A;  1ZSP A;  2Y69 C;  1IBM B;  1AR5 A;  2PUS A;  3UT5 B;  3P3N A;  4OXS A;  3TK1 A;  1R1B A;  2CGO A;  4J10 A;  4LF9 B;  1Y74 A;  5LGT A;  3P3P A;  3OUS A;  4JI7 B;  3SJC C;  2YUA A;  3LSS A;  2QR4 A;  3OR7 C;  4JYY A;  2ZIN A;  3OMA B;  1N32 O;  4ZKI A;  1GN4 A;  3ETG A;  2P90 A;  3T1Y O;  3E2E A;  1GN6 A;  4DV3 B;  1Q6U A;  1P7G A;  5B3S C;  2EIN C;  2F1M A;  2X0L A;  2ZR3 A;  3SGI A;  4GX0 A;  2CTQ A;  5H2F Z;  1VMG A;  2IBZ H;  3JAT A;  2N74 A;  5AG2 A;  5CA1 A;  3AG3 B;  2Q9L A;  1YTF D;  3ASN C;  1M93 A;  2A9H A;  4WBN B;  5D5P A;  1GK9 A;  3JCZ A;  3K04 A;  1N36 O;  1XNQ O;  1HW7 A;  2IJH A;  4LF5 B;  4HNA A;  5JH7 A;  1MMM A;  2P6J A;  2WA3 A;  3IC9 A;  4PD4 F;  3E89 A;  3UQ8 A;  1NI8 A;  1N32 B;  1I7F A;  1ZLZ A;  2PI4 A;  3T1Y B;  2A7W A;  3CCM V;  4YJ3 B;  1NS1 A;  2HKO A;  4GKJ O;  4CC6 A;  4WCE V;  2QJ1 A;  2G38 A;  2WLK A;  1NVP B;  2Z0A A;  3CRM A;  1BL8 A;  4X88 A;  2CTP A;  1OCO C;  5BXZ A;  1PL4 A;  3CB2 A;  1P49 A;  1KKC A;  2YI9 A;  2UUB O;  3N2G B;  1QLE C;  5LP6 C;  1B3Q A;  3CYO A;  4MT8 A;  1B06 A;  3B40 A;  3JAS A;  2IW5 A;  2QWN B;  3IC7 A;  5LL6 Y;  1N36 B;  1FXK C;  1FFX B;  3CWB H;  3FD9 A;  3CD6 V;  4PHZ A;  1FXH A;  5JWP A;  3JD1 A;  3OW2 U;  4DV0 O;  2CE4 A;  2E3C A;  4GKJ B;  1JCH A;  1K4D C;  2XAQ A;  1Y4M A;  3ZCC A;  4R7C A;  4I0X A;  5FL7 G;  1NR7 A;  4CBC A;  4IHJ B;  2UUB B;  2IJJ A;  3X2Q C;  2K9P A;  4I50 A;  4U3J A;  2X7R B;  1QR9 A;  3P32 A;  3OTF A;  2XAG A;  1HR0 O;  3IAY A;  5BMV A;  2P4K A;  2XTA A;  3ZHQ A;  3G4S V;  3G71 V;  4FM0 A;  2Y0I A;  3WG7 B;  4X1Y A;  3CJH A;  4XDL A;  4IL6 Z;  4DV0 B;  2WWW A;  5LYJ A;  2DE0 X;  1AIL A;  4BWA A;  1J5E O;  1XQ8 A;  4LC1 A;  4JI3 B;  1BS3 A;  3K79 A;  2AHZ A;  3RYI B;  3FB8 C;  4WFA V;  2W0F C;  3T1H O;  1CXZ B;  4JI2 O;  3C3T A;  2AGA A;  3D36 C;  2FYU H;  1JFF B;  4I9W A;  4H37 A;  3CPW U;  2LFR A;  2DYS C;  3HKB A;  1D5A A;  5JQG B;  4TT3 G;  3ABT A;  3JAK A;  1V54 B;  2O57 A;  3NXS A;  2HHH O;  1HR0 B;  4XDK A;  4ASU G;  2OWO A;  4W4L A;  2JJ2 G;  4WF9 V;  1ORQ C;  1Y74 B;  1ROP A;  2BSK A;  3TGU H;  1J5E B;  3VQX A;  1DGS A;  3ABK B;  4LFA O;  4UCU A;  4PA4 A;  3T1H B;  5LMN O;  1RPO A;  4JI2 B;  1NQT A;  3AG4 C;  3OMI B;  1VQ9 V;  2UUA O;  3SPG A;  5KMG A;  2OCC C;  2Y48 A;  1SET A;  4R8C A;  2A79 B;  4YXW G;  2YEV A;  1YEW A;  3JAT B;  5CA1 B;  4G2K A;  2HHH B;  3R65 A;  2AHY A;  1BZK A;  3ASO C;  1CP9 A;  5BR8 O;  1Y66 A;  1H2N A;  3LSU A;  5IY5 C;  4B3S O;  1GRJ A;  1H2L A;  3BCC H;  4B7E A;  3RYF A;  4UCT A;  4FM1 A;  1EZJ A;  2Q67 A;  4RO2 A;  4X65 B;  4LFA B;  3SYC A;  1PNM A;  1Q7Y W;  1FD9 A;  4FIP C;  3W7X A;  1SZX A;  1N8R W;  1JQ0 A;  1KU9 A;  1TUB A;  5LMN B;  2VS0 A;  5KAF Z;  1QCE A;  5IE9 A;  1NVP D;  1PPJ H;  3CS5 A;  3B2E E;  1SF9 A;  2UUA B;  2Q8V A;  4LFC O;  4I9Q A;  1K4C C;  4FZ0 A;  3S3X A;  3FKS G;  1SS3 A;  4IYH A;  4UV8 A;  5EC2 C;  1AB3 A;  4MTX A;  1YCI A;  3IGA C;  3L70 H;  3BY6 A;  5BR8 B;  4DXW A;  5KHJ A;  4YY3 O;  3HKC A;  3U11 A;  4EFE A;  1EZV H;  1A32 A;  1IXB A;  1SZT A;  2R70 A;  3ZX6 A;  2IJI A;  4GKK B;  5LHI A;  4Q20 A;  1KBH A;  4BIO A;  1PP9 H;  2A0L A;  2ADP A;  2BCC H;  2VRZ A;  1N0N A;  1FAF A;  4WFF A;  5KHK A;  1H2S B;  2DOS A;  1OZ0 A;  4TV8 A;  5LMU O;  2ARH A;  1JMK C;  5KHI A;  4NYK A;  4LFC B;  3L9D A;  4LCU C;  4I0X B;  1QHT A;  2E5L O;  2F95 B;  1SKV A;  2CAZ C;  3E35 A;  2F93 B;  3OAA G;  4I50 B;  4JI5 B;  3LSQ A;  1KQS U;  4JYB A;  4YY3 B;  1AR1 B;  2HVJ C;  5BMV B;  3OUF A;  5KUM A;  2UUC O;  3ABU A;  2N04 A;  5EIB C;  1EN5 A;  1ARO P;  2RJZ A;  2EUL A;  1TA8 A;  4JTA B;  5GTH Z;  4FLT A;  2VQF O;  3HPL C;  3W7U A;  4X1Y B;  3OGI B;  2UU9 O;  5KA5 A;  2QEX V;  5B1B B;  5LMU B;  1VQL V;  4UUJ C;  2QTS A;  1Q81 W;  1NJI W;  4HZ3 A;  4MTF A;  2YDE A;  1JJO A;  2EX3 A;  4DYL A;  3HKB B;  4CH6 A;  3JAK B;  4LH6 A;  1PM9 A;  4DR2 O;  1URF A;  2DWE C;  2UUC B;  1F4N A;  4NKG B;  3BAA A;  3IJ4 A;  2X6C A;  2Q69 A;  2HR3 A;  1H2G A;  4UV9 A;  2WLN A;  3CRC A;  4MVM A;  3ICX A;  4LF7 O;  2VQF B;  1L8D A;  2EBO A;  2QWQ B;  4KP4 A;  4B3M O;  2BSK B;  5EBM C;  2ZE5 A;  2UU9 B;  4TUY A;  1I5X A;  3K59 A;  3PJS K;  2WLJ A;  3M7M X;  1NZ6 A;  2Y4T A;  1H38 A;  2PYL A;  4I5S A;  3ZHU A;  1MAB G;  3N2K A;  5KMG B;  3AK1 A;  4PDL A;  3K9S A;  2YEV B;  3G67 A;  1BMF G;  1SER A;  1OCR C;  2EIL C;  4DR2 B;  1VF6 C;  3RVY A;  5CA3 A;  2WLI A;  1NR1 A;  4D7T A;  2XAH A;  1X4T A;  4F4L A;  3UO2 A;  4D7S A;  2LW1 A;  4LF7 B;  5LHG A;  3DC6 A;  1M56 B;  3RYF B;  3DXR A;  1GH6 A;  4WFG A;  4J80 A;  2UXD O;  4R6Z A;  2M6Y A;  1AP5 A;  3SDL A;  4CC5 A;  3AEI A;  1WA8 B;  2WA4 A;  3CC4 V;  1TUB B;  4N23 A;  4E4E A;  2BOB C;  1NT2 B;  4NR1 A;  4DO2 A;  3ABM B;  2EIM C;  4DUY O;  2Q68 A;  5FNV A;  2X6A A;  1YJW V;  1K9M W;  4HBN A;  2OIG A;  3AK3 A;  3JAL A;  3FYI B;  1G4Y B;  1NTZ H;  3QO7 A;  3RWR D;  1YHQ V;  2EIK C;  4DV1 O;  2Z5U A;  1QVG U;  3HKC B;  5CB4 A;  3BA8 A;  4OPH A;  1R3I C;  4FFB B;  4UVB A;  1JR9 A;  4DK1 A;  3SJA C;  5EK0 A;  2MK3 A;  1I94 O;  1FJG B;  5EBL C;  5H5N A;  2HLD G;  4PA6 A;  2YC0 A;  3ZMZ A;  3SYQ A;  2UXD B;  4U7O A;  3JYC A;  3CCJ V;  1GTO A;  1R3K C;  1HP8 A;  1LR1 A;  2BTQ B;  2OTL V;  2JDI G;  4N21 A;  3GVM A;  4K8Z A;  3ABL B;  2HEP A;  5A2Q N;  1T5E A;  1JJ2 U;  3JD4 A;  2V4D A;  4FFK A;  2RNB A;  3RW0 A;  4DV2 O;  3DTU B;  1BQ0 A;  1EFR G;  4XDJ A;  1LUV A;  3ZMU A;  4QIW F;  3CC7 V;  1WJZ A;  1ZWI C;  4U7N A;  4O2B B;  4JTC B;  4QJF B;  1VQO V;  4DV1 B;  4BW9 A;  1RM1 C;  5LA6 B;  1Q5O A;  3CRQ A;  2ZR2 A;  1H2M A;  4X1K A;  1I94 B;  1NH2 D;  4B7K A;  3LUT B;  1Z2G A;  1GN2 A;  4U3F H;  5J2U B;  1YIJ V;  3AG1 B;  3F5T A;  2Y69 B;  2OT5 A;  1W2B U;  3HR0 A;  1Z5W A;  4DR7 O;  4K0K B;  2ETN A;  1SQP H;  4DV2 B;  2ITD C;  3DSQ A;  2E74 B;  1E79 G;  2HG5 C;  4R50 A;  2QKA A;  2GV9 A;  3D8C A;  1MZF A;  4LF4 O;  1TUE B;  1IBL B;  3QTC A;  1OCC C;  1GM8 A;  5K1P A;  2AXT Z;  1WAZ A;  1M1K W;  5B3S B;  2EIN B;  4AQY B;  3A2F A;  1W0J G;  2YXL A;  2EJR A;  4DR5 O;  2YS8 A;  4P9P A;  1XMO O;  2L35 A;  3KCX A;  3A0R A;  4TUY B;  4DR4 O;  1ZUQ A;  5JVD A;  4B3R O;  4DR7 B;  4YIO A;  1VQ8 V;  2HJD A;  2AW9 A;  4FMT A;  2JRI A;  1XRE A;  3N2K B;  1L0N H;  1P84 F;  4JI0 O;  2D3O W;  3THO A;  2UXN A;  3K06 A;  4BIU A;  4TWK A;  5JCO C;  4LF4 B;  2F43 G;  3ZRW A;  2JK5 C;  2WLI B;  2PYJ A;  5L3E A;  1RFY A;  4KXR A;  4X9Q A;  3K9A A;  2NN4 A;  2V1D A;  3QO8 A;  3TET A;  4P30 A;  4DR5 B;  3T4Z A;  2R9A A;  4BIZ A;  4RWU A;  2XT9 A;  4KFM A;  3DXR B;  3QF7 A;  4QGP A;  1XMO B;  4H44 B;  2HJF C;  4DR4 B;  2OYQ A;  4DR6 O;  2EZO A;  5LP6 B;  4B3R B;  3UKM A;  3ZRX A;  2X6B A;  1M4U A;  3CHX A;  1VAR A;  4PEL A;  5EC1 C;  2VQE O;  2Q4P A;  4JI0 B;  1Y76 A;  5FNV B;  3OD4 A;  4F6R A;  3R66 A;  3K3W A;  2Q7E A;  3JAL B;  4E2L A;  1KMI Z;  2ODM A;  1L0L H;  3VOU A;  3E8G A;  1YVW A;  4DV4 O;  4GZR B;  1XNQ B;  5EBW C;  3M8A A;  4O4I A;  5CMU A;  5CB4 B;  4EKW A;  4F6E A;  1THZ A;  3UO3 A;  5TIS Z;  4CH5 A;  5B1O A;  3OR6 C;  1SA0 B;  1HNX O;  1JX9 A;  1P4R A;  5K1X A;  4TQF A;  2ZQM A;  4DR6 B;  1R73 A;  3K03 A;  3ZMT A;  2P22 C;  3AG2 B;  4JAS A;  3L71 H;  5IJ9 A;  3IFX A;  1OJH A;  5KUK A;  1IVS A;  1I5Y A;  4PDR A;  1B04 A;  2M7W A;  2ZNI A;  1Q43 A;  1N4C A;  5IDJ A;  4JI8 O;  2XHB A;  3A0B Z;  3RN4 A;  1WB7 A;  4LWS A;  3T1C A;  2AZ2 A;  1O9H A;  2UXX A;  2R72 A;  4UCS A;  2LQT A;  4DV4 B;  3WU2 Z;  3O65 A;  3B8M A;  3UM7 A;  4DK0 A;  5C93 A;  3CCV V;  4X1K B;  1CEZ A;  1ZL8 A;  1HNX B;  3SYO A;  4CS2 A;  1PV0 A;  1V55 B;  1E1R G;  3ML0 A;  3T4D A;  1DF4 A;  3BRC A;  1U96 A;  2JIZ G;  4NTX A;  1IXM A;  5B5E Z;  2W6I G;  3FB6 C;  3LNM B;  3C90 A;  2CH7 A;  5HFM A;  3ZIA G;  1DLB A;  4DR1 O;  1BQZ A;  3QNE A;  4H13 B;  4X64 O;  5B66 Z;  2RN9 A;  1QNM A;  2ZDI C;  2Q5Z A;  2ADQ B;  1XEQ A;  5KX5 A;  3AG4 B;  3E8H A;  1S77 D;  1XIL A;  3OE7 G;  2ATK C;  1XI1 A;  3LNN A;  3I55 V;  1WPB A;  1UJW B;  3WG7 C;  3DC5 A;  3N27 A;  3MD0 A;  3ZMS A;  2ILM A;  5DEC A;  1XBL A;  5JVD B;  2YXY A;  2YXH A;  2E75 B;  4NB5 A;  4JYC A;  3HB3 B;  5IY5 B;  4UXN A;  1US6 A;  1NKD A;  2F66 C;  2H8P C;  4MVU A;  5GW7 A;  4DR1 B;  4GX5 A;  2DMX A;  4X64 B;  3EXA A;  5L3C A;  2CDY A;  4KUM A;  3ZRW B;  1V54 C;  4X66 O;  3SJB C;  1UFI A;  4DRX A;  4MVR A;  1M90 W;  2QKS A;  4ICG A;  1PKX A;  4DW1 A;  4JZ2 A;  4FLZ A;  1K34 A;  5JJE B;  1D5N A;  3VQW A;  4JI6 O;  5C8Y A;  1NU1 H;  2FML A;  3ABK C;  3WB1 A;  3Q4H A;  4J9Z B;  2DWD C;  1WA8 A;  1SQB H;  1WP8 A;  1KP2 A;  4O2A B;  4KHP O;  1CPY A;  2XAF A;  1NBM G;  1Y76 B;  2D2C B;  5DN6 G;  4AHC A;  4F6R B;  4BW5 A;  1LUW A;  1SQV H;  2Y4U A;  4FZ1 A;  3D3Q A;  4K35 A;  4W4K A;  2UXB O;  1XL6 A;  4IYI A;  4B3S B;  1FS0 G;  1DK1 A;  4UCO A;  4O4I B;  4FFB A;  3TCU A;  1F23 A;  3W7W A;  4I7Z B;  2LW7 A;  2P06 A;  4ZIB A;  3K0D A;  1EN4 A;  2Q7H A;  4JYA O;  1MOF A;  2LGW A;  4GLX A;  2H94 A;  3H1I H;  2R9I A;  5IJ9 B;  2QTO A;  1M9N A;  1AI4 A;  4QE7 A;  3JD2 A;  2BTQ A;  4KHP B;  1M57 B;  1OCZ C;  4JF3 A;  1K33 A;  3G80 A;  4KL1 A;  3CCS V;  2Q0A A;  4LF6 O;  1ZX3 A;  2HFE C;  2XOK G;  4LWS B;  3K57 A;  1R6T A;  4O2B A;  4YHH O;  2PF4 E;  3JAW A;  4UB8 Z;  2UXB B;  2JS3 A;  4JPR A;  4X62 O;  1BHB A;  5LA6 A;  1MZE A;  4O4L B;  3ZBH A;  4TQD A;  2GUZ A;  2KB1 A;  2B9Z A;  3ETQ A;  3ZED A;  4XBF A;  3K5N A;  1ZL8 B;  4MTG A;  1XMQ O;  5L3G A;  4JYA B;  1SES A;  2UXC O;  3JSL A;  5CA0 A;  4CZZ A;  4TOI A;  2KSD A;  5ITZ A;  1S76 D;  1F4M A;  5J2U A;  4PDM A;  2ZT9 B;  3TXS A;  4ABM A;  4FPP A;  4LF6 B;  4J7K A;  4PA3 A;  2CH7 B;  2E5L B;  3M99 B;  3GWO A;  1BT8 A;  1KB9 F;  2GBO A;  3FB5 C;  1VQM V;  5KHG A;  3D3I A;  1JOY A;  1AI7 A;  2B1G A;  5KX5 B;  1XMQ B;  4CS4 A;  2KQX A;  5EYP B;  4BAY A;  2UXC B;  5BY1 A;  3LDE A;  2QM8 A;  1G6U A;  2EIJ C;  3CX5 F;  3CXH F;  1EN6 A;  1VQN V;  5B1B C;  3S3W A;  1RSO A;  1YZB A;  1YIT V;  1VEW A;  1FYJ A;  4JV5 O;  3WFV A;  1YJ9 V;  3TJT A;  1BCC H;  2FB5 A;  5IYZ B;  2DYR B;  3BVO A;  1WP7 A;  5CBH A;  2WLL A;  1AR4 A;  1VQ6 V;  4P2Z A;  4MW3 A;  4DRX B;  5KHH A;  4MSW C;  2DW4 A;  2XAS A;  3K58 A;  1KEC A;  1H8E G;  5CBG A;  4B3M B;  5B1A B;  3H1L H;  1HNZ O;  5C8Y B;  1RPR A;  1PL0 A;  2ZXW C;  5E1A C;  3SR2 C;  3MHH C;  3Q4H B;  5LP6 A;  3JCU Z;  1DF5 A;  2QKC A;  1XUQ A;  3K5M A;  2WAM A;  1IZ3 A;  1FXK A;  4JV5 B;  2DQ3 A;  1WNS A;  3H01 A;  3JD0 A;  1MSD A;  3EVK A;  1AJP A;  1S72 V;  2XUM A;  4NTW A;  4MVQ A;  1K5Q A;  2P4V A;  3E8B A;  2OCH A;  1UPG A;  3DGE A;  3ZHV A;  3W7T A;  2LO1 A;  4PI0 A;  1MA1 A;  3CCE V;  1K3E A;  4I4T A;  1SQF A;  2CGN A;  2ZIO A;  1G8M A;  1M56 C;  3B4S A;  4O4J A;  3VQY A;  1SA0 A;  3KCY A;  3CCU V;  4CS3 A;  1HDJ A;  1VQ5 V;  3OEE G;  1GM7 A;  2OIE A;  1KYO F;  4NXM O;  2VWK A;  4ZI7 B;  3ZS8 C;  3OGC C;  2NR5 A;  5JJJ B;  1GN3 A;  4DUY B;  3L74 H;  4IGG A;  2QM4 A;  3ABM C;  5H6Q A;  1VQP V;  2ZE6 A;  5KLV H;  1PNK A;  3JAW B;  2RCV A;  3HKD A;  4GX1 A;  3SPI A;  2GUZ B;  5LGU A;  3OM3 B;  4RQE A;  3K5L A;  1R3J C;  4ZHQ A;  3WB0 A;  3MAQ A;  2B1I A;  3D36 A;  4FLX A;  3SJQ C;  2QWP B;  5CA0 B;  3JD3 A;  1XDC A;  3J81 N;  5BZB A;  2RDC A;  2YID A;  3LDD A;  1FFT B;  5ITZ B;  5IYD O;  1XHZ A;  1XNR O;  3VQV A;  2WLM A;  1LNQ A;  4MVS A;  3G6B A;  3CME V;  2DN9 A;  4UVC A;  2JGU A;  2LFS A;  2YIA A;  1AI6 A;  4RUE A;  2CK3 G;  5LOV A;  2CUG A;  2JJ1 G;  4DV7 O;  4B3T O;  2Q6A A;  2EZP A;  1K7D A;  4DW0 A;  3RBZ A;  3KDR A;  4DV3 O;  4ZOL A;  1ZTE A;  1XL4 A;  4J7Z A;  3CE2 A;  3W7S A;  2BE3 A;  3ZHS A;  1O9G A;  5CN0 A;  3SPJ A;  1S0V A;  1QR8 A;  4I55 A;  4MW8 A;  4J41 A;  1H8H G;  3ASN B;  3AG1 C;  1RSO B;  3B77 A;  1YSC A;  3H1H H;  1IUR A;  3F7Y C;  3RYC A;  2P67 A;  3JAM N;  3APQ A;  4MTO A;  2IJK A;  3CC2 V;  1GO3 F;  1HWY A;  4LF5 O;  4LF8 O;  4LP8 A;  3QO5 A;  1QVF U;  2WLL B;  2JEX A;  4DV7 B;  4B3T B;  2AZ0 A;  2NNU A;  3CRA A;  1B6Q A;  1AJN A;  3ZMV A;  2ZCE A;  2EJ7 A;  4X8A A;  2PI5 A;  1VIB A;  1MSW D;  1F51 A;  1OCO B;  3APO A;  2QWO B;  3ZRS A;  4PJ0 Z;  1KC8 W;  1Q6H A;  1QLE B;  4Z2W A;  3O9O A;  1TAE A;  1G1X B;  4O2A A;  1FXK B;  1K97 A;  3JSN A;  1FXV A;  4LF8 B;  3HKE B;  4GYC B;  3CXC U;  5CBF A;  4UCR A;  3BEH A;  3AG3 C;  3U0Z A;  4QPK A;  3A8T A;  2GSM B;  4DUZ O;  4I4T B;  4O4J B;  3SPC A;  2K1E A;  4JZG A;  4JI4 O;  1GKF A;  1WB8 A;  1XOU A;  3X2Q B;  4OGQ B;  3CMA V;  2GTA A;  3GB7 C;  2VQE B;  1M5I A;  2A3Q A;  3K5O A;  4TSF G;  5GON A;  3H1J H;  3L73 H;  4LR3 A;  1GAX A;  2YIB A;  5HFL A;  4FLU A;  4DR3 O;  4YIP A;  4EB6 A;  2OTJ V;  1IJG A;  4FVM A;  1W59 A;  3CP1 A;  4MS2 A;  2RMK B;  4JI3 O;  4O4L A;  3HKD B;  2IU0 A;  5JJN B;  4DUZ B;  1KP3 A;  4ZHQ B;  5FPR A;  2JVD A;  3KG2 A;  2JGD B;  2W6J G;  4JI4 B;  2Q0O C;  2QE7 G;  3AK2 A;  2DYS B;  5H9C A;  1S5J A;  4PA9 A;  4UFZ A;  3AG2 C;  4D6T H;  1OHH G;  2V7Q G;  4LFB O;  1KKD A;  5IYC O;  3E8F A;  4OPA A;  3CCQ V;  4NTY A;  5J2T A;  4X1I A; 
#chains in the Genus database with same CATH homology
 1AP5 A;  1EN5 A;  2QKA A;  3DC5 A;  1AR4 A;  2GDS A;  4JYY A;  4E4E A;  1GN4 A;  4F6E A;  1BSM A;  3LSU A;  1XDC A;  1GN6 A;  1P7G A;  1AVM A;  1EM1 A;  3AK3 A;  4C7U A;  3KKY A;  3MDS A;  2P4K A;  5AG2 A;  1Y67 A;  1SZX A;  3OT7 A;  1JA8 A;  2CDY A;  2QKC A;  1XUQ A;  1ZUQ A;  3TJT A;  1JR9 A;  5A9G A;  3RN4 A;  1WB7 A;  1PM9 A;  4YIO A;  4JZG A;  1BS3 A;  3CEI A;  1IX9 A;  1MSD A;  2AW9 A;  3EVK A;  4JZ2 A;  3KDR A;  1MMM A;  1WB8 A;  1XRE A;  3IC9 A;  1D5N A;  3QVN A;  1ZTE A;  3C3T A;  1ZLZ A;  4FFK A;  1IXB A;  1BT8 A;  1MA1 A;  3BFR A;  1LUV A;  4X9Q A;  2ADP A;  1N0N A;  4YIP A;  1PL4 A;  1LUW A;  1AP6 A;  1KKC A;  3AK1 A;  1N0J A;  3K9S A;  1MNG A;  1B06 A;  1GN3 A;  1VAR A;  1EN6 A;  3AK2 A;  1GN2 A;  1I0H A;  1ZSP A;  4BR6 A;  4GUN A;  1EN4 A;  1QNM A;  3DC6 A;  1VEW A;  2ADQ B;  1I08 A;  3C3S A;  1AR5 A;  2CE4 A;  2RCV A;  1IDS A;  1XIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...