3BFRA

The crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn]
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 78
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3bfrA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3bfrA02
4GUNA 1VARA 4JYYA 1PL4A 1GN2A 2CE4A 3AK2A 1AP5A 1GN6A 1JA8A 1ZSPA 1PM9A 1IXBA 3QVNA 1BSMA 1I0HA 1IX9A 1XREA 1ZLZA 1QNMA 1N0NA 1D5NA 4YIPA 3AK1A 1AR4A 2QKAA 1AVMA 1I08A 3CEIA 4JZGA 1VEWA 1MA1A 1KKCA 1WB7A 3K9SA 3BFRA 3EVKA 2CDYA 1N0JA 4E4EA 1JR9A 1XILA 1GN4A 2RCVA 3TJTA 1P7GA 3KKYA 4C7UA 2ADPA 5A9GA 1EN6A 3C3TA 1ZUQA 1AR5A 1SZXA 2QKCA 3LSUA 2AW9A 1MMMA 3OT7A 4FFKA 1BT8A 4F6EA 3IC9A 4BR6A 3C3SA 2ADQB 1XDCA 1LUVA 1Y67A 1ZTEA 5AG2A 3MDSA 1EM1A 3AK3A 4X9QA 1MNGA 1EN4A 2GDSA 1B06A 1GN3A 1IDSA 3DC6A 4YIOA 1AP6A 1WB8A 3DC5A 1EN5A 4JZ2A 1XUQA 1BS3A 1LUWA 2P4KA 3RN4A 1MSDA
chains in the Genus database with same CATH superfamily
2EJ7A 4K35A 1GH6A 2AHZA 4X1IB 2QWOB 3CPWU 4FLZA 1FXKC 2QWQB 1KC8W 1QBZA 3SGIA 1R6KA 3H01A 3N2KA 4I50B 4DUYO 3UM7A 4LF9O 2P67A 5IYCO 5IJ9B 1SETA 1RP3B 3TXSA 2LGWA 3DXRB 1CEZA 1BHAA 1QLNA 3F5WC 2WLLB 2F4VO 3U0ZA 2NN4A 3L9DA 3P32A 2X6AA 4FM0A 1M4UA 3JD2A 2G38A 1G4YB 1YHQV 5LL6Y 1N34O 4LF6B 3HKBA 2PI4A 3IAYA 2ZDIC 4DV1B 3ASOC 4Z1MG 1URFA 4DR1B 3X2QB 3SYQA 4X1IA 1FYJA 3ML0A 1XL4A 2O57A 3G80A 4PA6A 3B8NA 2QWNB 4QE9A 3B4SA 5L3FA 4JTCB 3K5OA 4I50A 1H38A 4J10A 4X8AA 5IT9N 1A32A 1U96A 2BTOA 3DXRA 1PPJH 3R66A 2Q7EA 3SPCA 3ZRVA 5JCOC 3N27A 4DRXB 3OMAB 2IW5A 3AK3A 5KHGA 2IH1C 5EBWC 1H2SB 2K9PA 3W7TA 3AG2C 3M7MX 4FLTA 3I56V 2A7WA 1Q82W 4UVBA 3JARB 4YHHO 2XASA 2X7RB 5EBLC 1HNWO 4F6RA 2DYRB 4PDMA 1ZSPA 3GWKC 4B3SO 1NJIW 1WNSA 5HFLA 1ZAUA 3QG5A 4JI6O 4X20B 3L70H 1KBHA 2GSMB 5FPRA 1HNXB 2X0LA 4KHPB 4FK5C 4IL6Z 3E86A 2LW1A 3L73H 2FTKA 4B3TB 1HW7A 1PNMA 1FXKB 2ZINA 5EC2C 1XNRB 1PKXA 1JNBA 5BXZA 5IJ0B 5LOVB 4PI2A 2F95B 1YEWA 4PDRA 2LO1A 1SF9A 2XAHA 4MVMA 2WLIB 5LMUO 3HR0A 3OTOB 1QVFU 3AG4B 3JARA 4MVUA 1Q8IA 1HNZB 4GX1A 3J80N 1SZTA 4P2ZA 3CCLV 3SJAC 1E79G 5LP6B 5IYBO 3VBBA 4MTOA 1AR5A 1MABG 1GMGA 3BCCH 2Y0PA 4DR3B 2EBOA 3KG2A 3K04A 4X64O 2RMKB 2IM9A 3ZX6A 1XEQA 2E74B 2M6YA 1GO3F 4X1KB 4G28B 1VF5B 3T1HB 1OCZC 1FXKA 3HPLC 1LUVA 1TUBB 1PD3A 4RAIA 5KA5A 1X59A 5IJ0A 5IWAB 2AGAA 2N05A 1VP7A 3FKSG 1KP2A 1N36O 4I9WA 1XI1A 2ITCC 1O9GA 4U7NA 3FYEB 3T1CA 3AG3C 3G4SV 3E35A 3T4ZA 4QJFB 1L8DA 4LH7A 5KX5B 3K5LA 4FM2A 2JIZG 3VQYA 4MTXA 3AG2B 1PL4A 1PNKA 4R50A 1NI8A 3SYOA 3CCEV 2UXDB 2ZDIA 1IZ3A 2ZE8A 2A0LA 5IYZB 4OPAA 3I55V 3OM3B 5CBGA 3JYCA 5LYJB 4EKWA 2E75B 4JI0O 3ZMSA 4KL1A 4JI2B 1IX9A 1WAZA 4JI5O 4EB6A 4DUYB 1TUBA 1OJHA 4LF9B 1N0NA 4O4JA 4AQYB 3JATB 3CCMV 3WB2A 2Y69C 4NKGB 4GX5A 2ATKC 2OCHA 4UB6Z 1RFYA 5JCOA 2UXBO 3ABLC 4DW0A 3BFRA 1CP9A 2BTQB 2ETNA 2OTLV 5KX5A 4IIJA 1NH2D 2DW4A 2CDYA 3JCUZ 4H0LB 3W7WA 3K5MA 3FD9A 4U7OA 1N34B 2B9ZA 4FMTA 1NBMG 5KAFZ 1XQ8A 4JAAA 4N23A 4PELA 2Q6AA 5A9GA 5BMVB 2R70A 2QEXV 5IYZA 2DN9A 2R72A 3RYIB 4P9OA 3OT7A 1XBLA 3SYAA 4TUYB 2OIGA 2Q73A 3JALA 1XDCA 5AG2A 5J2UA 1WP7A 4ZBMA 4DK0A 5LMNO 3D8CA 4LWSB 2EIKB 1H2NA 1NR7A 3RWRD 2YSUB 1S76D 4QIWF 3CCUV 2YIBD 2IJKA 4FZ1A 1R3JC 5JH7A 4UCVA 1EBOA 3RT3C 1LUWA 2NLJC 1KP3A 4LNUB 3ZHQA 1J5EB 4GUNA 4J80A 5EZYB 3Q4HB 4DR6O 1Q6HA 5JQGB 3AG3B 4DUZB 3QVNA 1ZL8A 4YHHB 3CRAA 2XT9A 1HNWB 3RYIA 3RBZA 4LR3A 4CH3A 4JYCA 2D2CB 4MVQA 3G71V 4JYAO 1I0HA 2FYUH 4TUYA 5FL7G 2LW7A 4JI6B 2LQTA 3H1LH 1M1KW 4K3AA 1KB9F 4RWUA 1AR4A 1H2GA 1VQ4V 1YXBA 1K33A 4DR4B 1THZA 1VQ9V 1N8RW 2IJJA 1SQBH 1XNQO 3FB8C 1LR1A 3F7YC 1SQGA 4DV2O 2UXXA 1OCCC 1P7BA 1AI4A 2Y69B 2JJ2G 1R3IC 5EZYA 5LMUB 5CN0A 2OWOA 1GN4A 2X6BA 3ABLB 4O2AA 1DF4A 1JMKC 2EZOA 2EZPA 3E89A 2QKCA 3LSUA 1MMMA 1P49A 1N32O 3K3WA 5EYPB 1HR0B 4F6EA 1LNQA 2OT5A 3CRQA 2UUCB 3CC7V 2ADQB 4JASA 4W4LA 1QR8A 2UXNA 3SYCA 4DV7O 4NTXA 4XBFA 1NH2B 3JD3A 5CB4B 1V54C 3FAVB 3CCSV 1O9HA 1ROPA 1GN3A 2VQEO 1MSWD 3CCQV 1DF5A 1S5JA 3CCVV 1EN5A 1D5AA 1N36B 2ZIOA 2ITDC 3E2EA 3EXAA 3K58A 1K92A 5K1PA 1B6QA 1GM8A 3DSQA 4K0KB 1FAFA 2QWPB 3APQA 3AK2A 2JVDA 2JGDB 3OAAG 5H6RA 4DW1A 3LDDA 5H5NA 3ETEA 5EYPA 5J9PC 4PD4F 1V9PA 2YI8A 3N2GB 4JI0B 1I94B 1SA0B 2ZNIA 1OZ0A 2F23A 5CB4A 3T4DA 1R1BA 4R8CA 3EHBB 4FLWA 5JJJB 1K5QA 4MS2A 2UXCO 3ETQA 3BABA 3RVZA 2EILC 3B40A 4BIUA 4TOIA 3L72H 2JGUA 1F23A 4JAVA 2M7WA 2Y48A 5GONB 4WCEV 3HKCB 4RQEA 1Q81W 1WJZA 4UCSA 1SERA 2VRZA 4NTWA 2JGDA 1ENVA 4FLVA 1OCCB 1S5HC 2IJHA 1YJWV 2JRIA 3X2QC 2K1EA 2FL4A 2YUAA 2V7QG 3AEIA 3L75H 1QQCA 4CH4A 2ILMA 2YIBA 2W6JG 4DK1A 2F43G 1I5XA 4N21A 5CA1B 3U11A 3RFRA 1D2DA 2HJDA 3K03A 2BSKB 4Z1VA 3JCZA 2QDOA 5L3CA 3JASA 4U3JB 1JX9A 1YITV 4DV4O 1WN7A 2ARHA 4JI1O 5KA6A 2QR4A 3CP1A 1NT2B 1AJNA 2ZXWC 4DR2O 5GONA 4DV0O 5FNVB 3RN4A 3HKCA 1V54B 2DE0X 1F4MA 4IGGA 3TETA 5KHKA 2EX3A 1GN2A 3D36C 2W6IG 3UCSC 1HDJA 2KKWA 1N33O 1QVGU 3E8BA 4DR6B 2GHYA 5KUKA 3FB5C 2HLDG 5CA1A 1NS1A 1HWYA 1XHZA 2BSKA 2UUBO 4H44B 4JYAB 4YIPA 3AK1A 1K7DA 5D5QA 3TGUH 4ZI7B 5IE9A 4U3JA 4LF5O 3CEIA 1UFIA 3K9SA 5BR8B 5EK0A 4L8JA 2PGGA 1US6A 5FNVA 5A2QN 3P3PA 3JSNA 4GKJO 4I7ZB 2YEVB 3T1YO 2YC0A 1FPOA 2EILB 2F93B 4DV2B 2ADPA 4HBNA 3AG4C 4EEQA 5GTHZ 2WAMA 1FJGO 3P30A 3STLC 4NXMO 4CS4A 5CBHA 2WWWA 2CTPA 5LP6C 4YJ3A 3E22B 2UU9B 2E5LO 4NYKA 2ZD9A 1N32B 2OCCC 1M93A 2PYLA 1EN4A 2Q67A 1SQVH 1IBMB 3MAQA 4DV7B 1S77D 3LNMB 4CC5A 2CK3G 4KFMA 1AP6A 1QU7A 5IJ9A 2CTRA 4D6TH 4JZ2A 1K5SA 2VQEB 2WLLA 3BAAA 2YEVA 1IVSA 1GM9A 1WPXA 2QWRB 3A0HZ 1NVPB 3APOA 3JSLA 4U3FH 3RW0A 5DM6V 1VIBA 3LNNA 1IXBA 2ZXWB 4BIZA 2PTMA 3K57A 3ZRXA 2QM7A 1M5IA 2ZE5A 1QNMA 2VS0A 3A2FA 2EULA 3ETGA 4JI3B 3TXQA 5H2FZ 2YXHA 3A8TA 4MW8A 1MZEA 2W0XA 1JVMA 4UXNA 3ZHTA 1UPGA 3A0RA 2UXCB 1HP8A 4DRXA 1XMOO 2LGQA 1XILA 2Q0AA 4TV8B 1YZBA 2VWJA 1RSOB 2YIAA 1EN6A 1AB3A 1FFTB 3C3TA 1KKDA 4W4KA 1NKDA 3D36A 1YTFD 4IT5A 4UUJC 4FFKA 2AZ0A 1BT8A 2Q0OC 5KMGB 1ZWIC 4GX2A 1R6TA 3CHXA 4MVZA 1Z2GA 1VF6A 4ABMA 1COWG 1K4DC 4LF4O 3CRMA 4JPRA 4PDLA 4X20A 1H2LA 1QLEB 4PJ0Z 4JV5O 1AJQA 4FLYA 1DK1A 4B3RO 3FB6C 2GUZB 2OCCB 1WB8A 2EIKC 1K3EA 3CYOA 4I55B 4PV1B 1RPOA 2F66C 2GBOA 2H94A 2Q5ZA 1VQKV 4LP8A 3ABMC 4TV8A 2A9HA 3ZMTA 1RSOA 4TQFA 4DR2B 3UT5B 4JTDB 5JJEB 4DV0B 1GN6A 5LOVA 1VF7A 1BCCH 3S3XA 5L3GA 2WLIA 1N33B 1M9NA 2OIEA 1BL8A 5KMGA 3E8GA 5JVDB 2ZQMA 2EIJB 3JAMN 5LP6A 3CS5A 2YXYA 5K1XA 2RN9A 4LFCO 1MA1A 1KKCA 2GUZA 2JS3A 4QPJA 2H8PC 4J9YB 4X1KA 5B3SC 4E4EA 4I55A 4B3MO 3ZBHA 2NNUA 3RYHB 1K34A 1VQNV 3UT5A 4FPPA 3NR7A 5IDJA 5B1BC 4DR7O 4GKJB 2CTWA 2CGNA 2F4VB 3H1JH 4NB5A 2WSSG 2Y0IA 1TGOA 2V1DA 1VMGA 4KUMA 3LSQA 1AI7A 3ZCCA 1FJGB 3JAKB 3P3NA 4MVRA 4NXMB 5JVDA 4NXNO 4DV6O 3FYIB 4A5UB 3ZRWB 1DTOA 3K0GA 4OX9O 2LFSA 2E5LB 4AHCA 2ZNJA 3ETDA 1IDSA 3MHHC 5LYJA 4QGPA 5CBFA 2PY5A 3DC5A 2WA4A 4JF3A 3U10A 1Y6XA 2P4KA 3B09A 4IYIA 3GB7C 2JDIG 1Q7YW 1F7YA 1OCOB 1YTFB 1V55C 1VARA 1SRYA 3ZJZA 3JATA 1WPBA 2B5UA 4XDJA 1PV0A 4H37A 2H3OA 1Z5WA 2L6LA 3CWBH 4HNAB 1QR9A 5KLVH 2XNDG 2BTQA 3UO3A 4B7EA 3ABMB 2B1GA 3JAKA 3SDLA 1H8HG 4UV9A 5LA6B 3ICXA 4FJCC 3H1HH 2CTQA 3ZRWA 3HKEB 4WF9V 3HB3B 3A0BZ 3OMNB 3ZEDA 1S5LZ 5BMVA 3QF7A 1BZKA 4UVAA 1AILA 4CZZA 4O2BB 4DR5O 1VQ7V 3CRCA 1GKFA 2QE7G 4B3SB 4WFGA 2BOBC 4J7KA 1BE3H 2Q7HA 3H1IH 1B04A 1TVKB 2A79B 4RUEA 1I7FA 4JI4O 2JEUA 4LWSA 3CD6V 4JTAB 2RNBA 1JJOA 5B3SB 1XMOB 4HNAA 3JD4A 4F4LA 2WLNA 3B8MA 1Q43A 1XHXA 5LA6A 1SESA 3K5NA 4O4IB 1G6UA 4LNUA 2JK5C 5B1BB 4WBNB 1OCRB 3Q4HA 3WG7C 3HKEA 1EM1A 5CA0B 2CGOA 3RGBA 5JQGA 1G8MA 2WPDG 1N4CA 4PA4A 3OE7G 4B08A 3G6EV 4LF4B 2L35A 3ABUA 3AG7A 1RM1C 1BS3A 5LGNA 2CH7B 3H1KH 4X64B 4J41A 4JYYA 1I5YA 4O4HB 4X1YB 4TT3G 4I0XB 2VQFO 1AI5A 1H2KA 1SC5B 3LDCA 3ZMZA 4DR1O 1V55B 4JI8O 1IXMA 3ZMUA 4PA7A 2ZT9B 3G67A 3IJ4A 1L0NH 3K9AA 5FLXN 1YI2V 1AVMA 4K8XA 2QTSA 2UUAO 2F1MA 4JZGA 2WLKA 5L3BA 1GM7A 2ZE6A 2FKXA 1JFFB 4FM1A 2CH7A 4LFCB 2JS5A 1GRJA 4O4HA 4X1YA 2RCVA 4ICGA 3TJTA 3KKYA 4JI5B 1MOFA 4GT1A 4B3MB 2IU0A 3FAVA 1H5WA 4MW3A 2WLHA 4UVCA 4MTGA 1Y74B 4J11A 5H9CA 4DR7B 2QJ1A 2GV9A 2UXBB 4H33A 1EZVH 3M99B 4KHPO 3QNEA 4LH6A 5KUMA 3WU2Z 3JD1A 3CJHB 2DWDC 4B3TO 2Q7GA 5B1AC 4DV6B 1B06A 4CS3A 1JJ2U 4LF8O 4CC6A 3LUTB 2E76B 1R3LC 1XNRO 1BQ0A 2ZIMA 1PNLA 2BOCC 2PUSA 3WG7B 1JFFA 3BY6A 1NVPD 3E83A 2EIMC 5DEDA 4J7JA 3N2GA 4UCUA 5ITZB 4NVPA 2ZM6O 4CH6A 4E2LA 3W7UA 1SA0A 1M57C 3ZHVA 3PJSK 4X65O 1RM1B 3CCJV 5DN6G 4XDLA 1FXHA 1YVWA 3SJCC 4GKKO 1Y74A 2Q68A 4MT8A 2DJVA 2PYJA 5LMNB 3FFQA 4PA3A 1FFXB 4NTYA 3CB2A 3GVMA 5C93A 4I5SA 3WFVA 5GTIZ 4UV8A 1KU9A 5KAIZ 5LBQA 2HVKC 2P5OA 3VOUA 2P22C 5LGTA 3CMEV 3B77A 3W7SA 3QTCA 1WLEA 3BVOA 3N2KB 5E1AC 1BGYH 1KYOF 3O65A 3CRRA 4DR5B 2LJ2A 1NQTA 5ITZA 1JR9A 5CA3A 2ZE7A 1P7GA 1CPYA 2N74A 4C7UA 1T5EA 1PL0A 4IYHA 3VQWA 2IBZH 2PZSA 3OUFA 3ZRSA 1YIJV 2DMXA 4YXWG 4CH5A 4JI4B 5JWPA 3W7XA 4DV3O 1YJNV 1FFXA 3ZHSA 2XAJA 3HKBB 3H9VA 2Q9LA 2UXDO 1XNQB 5H6QA 2QKSA 1SQXH 2RJZA 2RQ6A 5FPOA 4DXWA 3NXSA 4JI2O 1K9MW 3ZHUA 2GDSA 1SQQH 3ABKB 2Q4PA 4QE7A 5EC1C 5C8YB 1VQ5V 1NZ6A 4AQYO 1S3JA 1XOUA 1XUQA 1Q86W 3CMAV 2P4VA 1BMFG 1QLEC 2A3QA 5B1AB 4PI0A 4TV9B 1FD9A 4GYCB 4XDKA 1E1RG 3LDEA 2HFEC 1JQ0A 2GTSA 1FS0G 3KDRA 1JA8A 4R7CA 4ZI7A 1VQPV 2EJRA 4AILC 5IY5C 1XMQO 2EIMB 4FFBB 3UKMA 1M57B 2VQFB 4JI7O 4Q6GA 3ZHRA 4JGSA 4JI8B 2XUMA 2AHYA 1K97A 1D5NA 4F6RB 2QKAA 1VQLV 3BHPA 4FLXA 4FZ0A 1YF2A 2HEPA 2KSDA 5C8YA 3RYCB 2A06H 3CXCU 2P6JA 2EIJC 3SJQC 2UUAB 4MVOA 2RDCA 1N0JA 4ZKIA 2PF4E 3E22A 5HFMA 4TV9A 2V4DA 3C90A 2JJ1G 2WLJA 4OPHA 3STZC 1M56C 1ZUQA 2IJIA 2Y4TA 3JAWB 4K8ZA 1F51A 3VQXA 1J5EO 3SJBC 4FFBA 4J9ZB 3JD0A 2XHBA 4DV5O 2ODMA 4G27B 2XAGA 4DUZO 3C3SA 2X6CA 1AJPA 3B2EE 1ZTEA 4WFAV 1K4CC 5KHIA 4X9QA 1TAEA 3BRCA 4HZ3A 3CE2A 1AROP 2ZR2A 3RYCA 4UCTA 4JAUA 1QHTA 4LF7O 3ABTA 4X88A 4LBEC 2R9RB 5EBMC 2QA4V 2ZKOA 4DR4O 3F7VC 1TA8A 4LF8B 2DYSC 1AP5A 3JAWA 2P7TC 1R3KC 4LCUC 2ZM6B 4YY3O 1OCOC 3M8AA 3TCUA 4IHJB 5B1OA 4X65B 4D7SA 3OD4A 3E8FA 1W0KG 2FMLA 1XREA 3OEEG 4GKKB 1K73W 4QPKA 3J7AU 2AXTZ 2IH3C 3DTUB 4WFBV 5IY5B 4DV4B 4JI1B 5KHJA 1BHBA 5LGUA 1SS3A 3KCXA 1I08A 3OUSA 4QNHB 1IBLO 1HR0O 3ZN0A 4LFBO 2UUCO 3ASOB 1DLBA 2LP7A 2P06A 3CXHF 1IBKO 1KD1W 1L1FA 1WP8A 4RUFA 4UCRA 5KHHA 4EB6B 4DYLA 4O4JB 1UJWB 2R9IA 1VQ6V 1JOYA 2UUBB 3SPHA 3ZS8C 4IHJA 2MK3A 2N04A 1M90W 4K0KO 5B1NA 4D7TA 4IIJB 2OYQA 4LF5B 1M56B 2R9AA 1H8EG 4DV3B 5IYDO 3BEHA 5EIBD 2KQXA 1FKAO 4GX0A 5GW7A 2HHHO 4LFAO 1EFRG 1IJGA 3CSXA 2CUGA 2ZR3A 4BIOA 1OCRC 3I5DA 4YIOA 3T1YB 3FX7A 4O4LB 1I94O 1H2MA 4MSWC 1W0JG 3ZN1A 1Y76B 3IGAC 3CC2V 4KP4A 5EIBC 2GTAA 4J7ZA 3JALB 2YICA 4PA9A 4R6ZA 1OHHG 2YIDA 4WFHA 5J2UB 3QO5A 2Y4UA 1QCEA 4HYOA 2QM8A 4H13B 4OXSA 3RYFB 4X89A 1U97A 1YDXA 1BSMA 5LHGA 2E3CA 3D3QA 2OTJV 5JH7B 2MW2B 2DYSB 1Y4MA 4Z2WA 1XMQB 3K08A 1FOUA 4GCZA 3RYHA 3SPJA 1NR1A 4JI7B 2Q8VA 3T2MA 2AZ2A 1ZL8B 4YJ2B 4KXRA 3PN1A 4CS2A 4G2KA 2BCCH 4X62O 4O4LA 3THOA 1KMIZ 3S3WA 1Y76A 3EVKA 3J81N 1JCHA 4MVSA 3FB7C 3AG1C 1NU1H 1R73A 1PP9H 3EFFK 4FLUA 2DQ0A 3OTFA 3RYFA 2VWKA 4ZIBA 3OEHG 2KG7B 4GZRB 4FVMA 1OCZB 2Z5UA 2AW9A 3CCRV 1R6NA 1SQFA 3IC7A 3MD0A 3IFXA 3OMIB 4NR1A 4UCOA 1JPXA 5LXTB 3IC9A 2XAFA 2W0FC 2BE3A 3KZIZ 1Q5OA 4DV5B 4AI8A 4O2AB 5J2TB 1S72V 1Q3EA 3WB0A 1W2BU 2HKOA 4I4TB 4YJ2A 4P30A 2XTAA 4X66O 4P9PA 3E8HA 3VQVA 4JYBA 3OR6C 4BW9A 3K0DA 3K59A 1SQPH 5B5EZ 1MSDA 1CXZB 3O9OA 4L87A 1FXVA 4LF7B 2Z3YA 2CE4A 1NTZH 2QM4A 2EINC 5BR8O 3D3IA 3K79A 2KG7A 2Q69A 3L74H 1EZJA 2XOKG 1KQSU 4O2BA 5DECA 2XAQA 4RQFA 5LXTA 4BWAA 1J95A 1ZX3A 4YY3B 4I9QA 2FB5A 2WLMA 4FIPC 1ZLZA 1VQ8V 5CMUA 4JV5B 1TVKA 4EFEA 4B3RB 3HKDB 1NTKH 1WA8B 5J2TA 3MHSC 1XL6A 4I4TA 4LF6O 3UO2A 3CC4V 2QTOA 2UU9O 1ORQC 4DV1O 1VEWA 3OGCC 1GAXA 1WB7A 4B7KA 1IBLB 3ASNC 2QSAA 2HVJC 4LFBB 4MTFA 4O4IA 2CAZC 4PDVA 4WBNA 1IBMO 1K8AW 4Q20A 2YS8A 5LHHA 3L71H 1IBKB 1P84F 5CA0A 5LHIA 4TWKA 4BAYA 4WFFA 1AR1B 4OGQB 5F2VO 4CBCA 4UB8Z 3AG1B 1DGSA 1GTOA 1NTMH 1SZXA 2DWEC 1YJ9V 1S0VA 4DO2A 2NR5A 3QO7A 3OGIB 1RPRA 4UFZA 3WB1A 3HKDA 4LC1A 1Y67A 3MDSA 1WA8A 1VQOV 2Z0AA 4I0XA 5D5PA 1Q90D 1BQZA 1TUEB 1KUQA 4LFAB 2HHHB 1W59A 3SPIA 3TK1A 5TISZ 4JI3O 1P4RA 5L3DA 3ABKC 3BA8A 2ZCEA 1E1QG 3K06A 2HJFC 3GWOA 1HNXO 1KECA 4PHZA 1X4TA 1PM9A 3JASB 1YCIA 4NXNB 3KCYA 5BY1A 2HP8A 4WFEA 4OX9B 4TQDA 2HG5C 3OR7C 2EINB 1Z5VA 3R65A 4BW5A 4ASUG 3LSSA 1B3QA 4ZHQB 5E79Z 5B66Z 5L3EA 3ZMVA 1Y66A 2PI5A 2YXLA 3OTOO 1YSCA 1VQMV 2B1IA 4ZOLB 1SKVA 1HNZO 3SYPA 2C2AA 1MG1A 4TSFG 2QGNA 1GK9A 2YDEA 4X62B 2DOSA 3SR2C 4DR3O 2HR3A 3OFNG 3UQ8A 3CJHA 3ASNB 3ZIAG 1Q6IA 3T1HO 1L0LH 2IU3A 4HAMA 3RVYA 3BA9A 5IWAO 4BR6A 1G1XB 3DGEA 1OV9A 1F4NA 3QO8A 2P90A 2JEXA 2D3OW 3F5TA 3G6BA 4RO2A 4ZHQA 5JJNB 1MNGA 2KB1A 3BPZA 4EFBA 4ZOLA 1MZFA 1Q6UA 3DC6A 1IURA 5BZBA 1VF6C 2WA3A 2DQ3A 4J42A 2DYRC 3OW2U 4YJ3B 1AI6A 2LFRA 4X66B 4GLXA 2YI9A 3CX5F 3SPGA
chains in the Genus database with same CATH topology
4GUNA 1VARA 4JYYA 1PL4A 1GN2A 2CE4A 3AK2A 1AP5A 1GN6A 3KDRA 1JA8A 1ZSPA 1PM9A 1IXBA 3QVNA 1BSMA 1I0HA 1IX9A 1XREA 1ZLZA 1QNMA 1N0NA 1D5NA 4YIPA 3AK1A 1AR4A 2QKAA 1AVMA 1I08A 3CEIA 4JZGA 1VEWA 1MA1A 1KKCA 1WB7A 3K9SA 3BFRA 3EVKA 2CDYA 1N0JA 4E4EA 1JR9A 1XILA 1GN4A 2RCVA 3TJTA 1P7GA 3KKYA 4C7UA 2ADPA 5A9GA 1EN6A 3C3TA 1ZUQA 1AR5A 1SZXA 2QKCA 3LSUA 2AW9A 1MMMA 3OT7A 4FFKA 1BT8A 4F6EA 3IC9A 4BR6A 3C3SA 2ADQB 1XDCA 1LUVA 1Y67A 1ZTEA 5AG2A 3MDSA 1EM1A 3AK3A 4X9QA 1MNGA 1EN4A 2GDSA 1B06A 1GN3A 1IDSA 3DC6A 4YIOA 1AP6A 1WB8A 3DC5A 1EN5A 4JZ2A 1XUQA 1BS3A 1LUWA 2P4KA 3RN4A 1MSDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUN A;  1VAR A;  4JYY A;  1PL4 A;  1GN2 A;  2CE4 A;  3AK2 A;  1AP5 A;  1GN6 A;  1JA8 A;  1ZSP A;  1PM9 A;  1IXB A;  3QVN A;  1BSM A;  1I0H A;  1IX9 A;  1XRE A;  1ZLZ A;  1QNM A;  1N0N A;  1D5N A;  4YIP A;  3AK1 A;  1AR4 A;  2QKA A;  1AVM A;  1I08 A;  3CEI A;  4JZG A;  1VEW A;  1MA1 A;  1KKC A;  1WB7 A;  3K9S A;  3BFR A;  3EVK A;  2CDY A;  1N0J A;  4E4E A;  1JR9 A;  1XIL A;  1GN4 A;  2RCV A;  3TJT A;  1P7G A;  3KKY A;  4C7U A;  2ADP A;  5A9G A;  1EN6 A;  3C3T A;  1ZUQ A;  1AR5 A;  1SZX A;  2QKC A;  3LSU A;  2AW9 A;  1MMM A;  3OT7 A;  4FFK A;  1BT8 A;  4F6E A;  3IC9 A;  4BR6 A;  3C3S A;  2ADQ B;  1XDC A;  1LUV A;  1Y67 A;  1ZTE A;  5AG2 A;  3MDS A;  1EM1 A;  3AK3 A;  4X9Q A;  1MNG A;  1EN4 A;  2GDS A;  1B06 A;  1GN3 A;  1IDS A;  3DC6 A;  4YIO A;  1AP6 A;  1WB8 A;  3DC5 A;  1EN5 A;  4JZ2 A;  1XUQ A;  1BS3 A;  1LUW A;  2P4K A;  3RN4 A;  1MSD A; 
#chains in the Genus database with same CATH topology
 2EJ7 A;  4K35 A;  1GH6 A;  2AHZ A;  4X1I B;  2QWO B;  3CPW U;  4FLZ A;  1FXK C;  2QWQ B;  1KC8 W;  1QBZ A;  3SGI A;  1R6K A;  3H01 A;  3N2K A;  4I50 B;  4DUY O;  3UM7 A;  4LF9 O;  2P67 A;  5IYC O;  5IJ9 B;  1SET A;  1RP3 B;  3TXS A;  2LGW A;  3DXR B;  1CEZ A;  1BHA A;  1QLN A;  3F5W C;  2WLL B;  2F4V O;  3U0Z A;  2NN4 A;  3L9D A;  3P32 A;  2X6A A;  4FM0 A;  1M4U A;  3JD2 A;  2G38 A;  1G4Y B;  1YHQ V;  5LL6 Y;  1N34 O;  4LF6 B;  3HKB A;  2PI4 A;  3IAY A;  2ZDI C;  4DV1 B;  3ASO C;  4Z1M G;  1URF A;  4DR1 B;  3X2Q B;  3SYQ A;  4X1I A;  1FYJ A;  3ML0 A;  1XL4 A;  2O57 A;  3G80 A;  4PA6 A;  3B8N A;  2QWN B;  4QE9 A;  3B4S A;  5L3F A;  4JTC B;  3K5O A;  4I50 A;  1H38 A;  4J10 A;  4X8A A;  5IT9 N;  1A32 A;  1U96 A;  2BTO A;  3DXR A;  1PPJ H;  3R66 A;  2Q7E A;  3SPC A;  3ZRV A;  5JCO C;  3N27 A;  4DRX B;  3OMA B;  2IW5 A;  3AK3 A;  5KHG A;  2IH1 C;  5EBW C;  1H2S B;  2K9P A;  3W7T A;  3AG2 C;  3M7M X;  4FLT A;  3I56 V;  2A7W A;  1Q82 W;  4UVB A;  3JAR B;  4YHH O;  2XAS A;  2X7R B;  5EBL C;  1HNW O;  4F6R A;  2DYR B;  4PDM A;  1ZSP A;  3GWK C;  4B3S O;  1NJI W;  1WNS A;  5HFL A;  1ZAU A;  3QG5 A;  4JI6 O;  4X20 B;  3L70 H;  1KBH A;  2GSM B;  5FPR A;  1HNX B;  2X0L A;  4KHP B;  4FK5 C;  4IL6 Z;  3E86 A;  2LW1 A;  3L73 H;  2FTK A;  4B3T B;  1HW7 A;  1PNM A;  1FXK B;  2ZIN A;  5EC2 C;  1XNR B;  1PKX A;  1JNB A;  5BXZ A;  5IJ0 B;  5LOV B;  4PI2 A;  2F95 B;  1YEW A;  4PDR A;  2LO1 A;  1SF9 A;  2XAH A;  4MVM A;  2WLI B;  5LMU O;  3HR0 A;  3OTO B;  1QVF U;  3AG4 B;  3JAR A;  4MVU A;  1Q8I A;  1HNZ B;  4GX1 A;  3J80 N;  1SZT A;  4P2Z A;  3CCL V;  3SJA C;  1E79 G;  5LP6 B;  5IYB O;  3VBB A;  4MTO A;  1AR5 A;  1MAB G;  1GMG A;  3BCC H;  2Y0P A;  4DR3 B;  2EBO A;  3KG2 A;  3K04 A;  4X64 O;  2RMK B;  2IM9 A;  3ZX6 A;  1XEQ A;  2E74 B;  2M6Y A;  1GO3 F;  4X1K B;  4G28 B;  1VF5 B;  3T1H B;  1OCZ C;  1FXK A;  3HPL C;  1LUV A;  1TUB B;  1PD3 A;  4RAI A;  5KA5 A;  1X59 A;  5IJ0 A;  5IWA B;  2AGA A;  2N05 A;  1VP7 A;  3FKS G;  1KP2 A;  1N36 O;  4I9W A;  1XI1 A;  2ITC C;  1O9G A;  4U7N A;  3FYE B;  3T1C A;  3AG3 C;  3G4S V;  3E35 A;  3T4Z A;  4QJF B;  1L8D A;  4LH7 A;  5KX5 B;  3K5L A;  4FM2 A;  2JIZ G;  3VQY A;  4MTX A;  3AG2 B;  1PL4 A;  1PNK A;  4R50 A;  1NI8 A;  3SYO A;  3CCE V;  2UXD B;  2ZDI A;  1IZ3 A;  2ZE8 A;  2A0L A;  5IYZ B;  4OPA A;  3I55 V;  3OM3 B;  5CBG A;  3JYC A;  5LYJ B;  4EKW A;  2E75 B;  4JI0 O;  3ZMS A;  4KL1 A;  4JI2 B;  1IX9 A;  1WAZ A;  4JI5 O;  4EB6 A;  4DUY B;  1TUB A;  1OJH A;  4LF9 B;  1N0N A;  4O4J A;  4AQY B;  3JAT B;  3CCM V;  3WB2 A;  2Y69 C;  4NKG B;  4GX5 A;  2ATK C;  2OCH A;  4UB6 Z;  1RFY A;  5JCO A;  2UXB O;  3ABL C;  4DW0 A;  3BFR A;  1CP9 A;  2BTQ B;  2ETN A;  2OTL V;  5KX5 A;  4IIJ A;  1NH2 D;  2DW4 A;  2CDY A;  3JCU Z;  4H0L B;  3W7W A;  3K5M A;  3FD9 A;  4U7O A;  1N34 B;  2B9Z A;  4FMT A;  1NBM G;  5KAF Z;  1XQ8 A;  4JAA A;  4N23 A;  4PEL A;  2Q6A A;  5A9G A;  5BMV B;  2R70 A;  2QEX V;  5IYZ A;  2DN9 A;  2R72 A;  3RYI B;  4P9O A;  3OT7 A;  1XBL A;  3SYA A;  4TUY B;  2OIG A;  2Q73 A;  3JAL A;  1XDC A;  5AG2 A;  5J2U A;  1WP7 A;  4ZBM A;  4DK0 A;  5LMN O;  3D8C A;  4LWS B;  2EIK B;  1H2N A;  1NR7 A;  3RWR D;  2YSU B;  1S76 D;  4QIW F;  3CCU V;  2YIB D;  2IJK A;  4FZ1 A;  1R3J C;  5JH7 A;  4UCV A;  1EBO A;  3RT3 C;  1LUW A;  2NLJ C;  1KP3 A;  4LNU B;  3ZHQ A;  1J5E B;  4GUN A;  4J80 A;  5EZY B;  3Q4H B;  4DR6 O;  1Q6H A;  5JQG B;  3AG3 B;  4DUZ B;  3QVN A;  1ZL8 A;  4YHH B;  3CRA A;  2XT9 A;  1HNW B;  3RYI A;  3RBZ A;  4LR3 A;  4CH3 A;  4JYC A;  2D2C B;  4MVQ A;  3G71 V;  4JYA O;  1I0H A;  2FYU H;  4TUY A;  5FL7 G;  2LW7 A;  4JI6 B;  2LQT A;  3H1L H;  1M1K W;  4K3A A;  1KB9 F;  4RWU A;  1AR4 A;  1H2G A;  1VQ4 V;  1YXB A;  1K33 A;  4DR4 B;  1THZ A;  1VQ9 V;  1N8R W;  2IJJ A;  1SQB H;  1XNQ O;  3FB8 C;  1LR1 A;  3F7Y C;  1SQG A;  4DV2 O;  2UXX A;  1OCC C;  1P7B A;  1AI4 A;  2Y69 B;  2JJ2 G;  1R3I C;  5EZY A;  5LMU B;  5CN0 A;  2OWO A;  1GN4 A;  2X6B A;  3ABL B;  4O2A A;  1DF4 A;  1JMK C;  2EZO A;  2EZP A;  3E89 A;  2QKC A;  3LSU A;  1MMM A;  1P49 A;  1N32 O;  3K3W A;  5EYP B;  1HR0 B;  4F6E A;  1LNQ A;  2OT5 A;  3CRQ A;  2UUC B;  3CC7 V;  2ADQ B;  4JAS A;  4W4L A;  1QR8 A;  2UXN A;  3SYC A;  4DV7 O;  4NTX A;  4XBF A;  1NH2 B;  3JD3 A;  5CB4 B;  1V54 C;  3FAV B;  3CCS V;  1O9H A;  1ROP A;  1GN3 A;  2VQE O;  1MSW D;  3CCQ V;  1DF5 A;  1S5J A;  3CCV V;  1EN5 A;  1D5A A;  1N36 B;  2ZIO A;  2ITD C;  3E2E A;  3EXA A;  3K58 A;  1K92 A;  5K1P A;  1B6Q A;  1GM8 A;  3DSQ A;  4K0K B;  1FAF A;  2QWP B;  3APQ A;  3AK2 A;  2JVD A;  2JGD B;  3OAA G;  5H6R A;  4DW1 A;  3LDD A;  5H5N A;  3ETE A;  5EYP A;  5J9P C;  4PD4 F;  1V9P A;  2YI8 A;  3N2G B;  4JI0 B;  1I94 B;  1SA0 B;  2ZNI A;  1OZ0 A;  2F23 A;  5CB4 A;  3T4D A;  1R1B A;  4R8C A;  3EHB B;  4FLW A;  5JJJ B;  1K5Q A;  4MS2 A;  2UXC O;  3ETQ A;  3BAB A;  3RVZ A;  2EIL C;  3B40 A;  4BIU A;  4TOI A;  3L72 H;  2JGU A;  1F23 A;  4JAV A;  2M7W A;  2Y48 A;  5GON B;  4WCE V;  3HKC B;  4RQE A;  1Q81 W;  1WJZ A;  4UCS A;  1SER A;  2VRZ A;  4NTW A;  2JGD A;  1ENV A;  4FLV A;  1OCC B;  1S5H C;  2IJH A;  1YJW V;  2JRI A;  3X2Q C;  2K1E A;  2FL4 A;  2YUA A;  2V7Q G;  3AEI A;  3L75 H;  1QQC A;  4CH4 A;  2ILM A;  2YIB A;  2W6J G;  4DK1 A;  2F43 G;  1I5X A;  4N21 A;  5CA1 B;  3U11 A;  3RFR A;  1D2D A;  2HJD A;  3K03 A;  2BSK B;  4Z1V A;  3JCZ A;  2QDO A;  5L3C A;  3JAS A;  4U3J B;  1JX9 A;  1YIT V;  4DV4 O;  1WN7 A;  2ARH A;  4JI1 O;  5KA6 A;  2QR4 A;  3CP1 A;  1NT2 B;  1AJN A;  2ZXW C;  4DR2 O;  5GON A;  4DV0 O;  5FNV B;  3RN4 A;  3HKC A;  1V54 B;  2DE0 X;  1F4M A;  4IGG A;  3TET A;  5KHK A;  2EX3 A;  1GN2 A;  3D36 C;  2W6I G;  3UCS C;  1HDJ A;  2KKW A;  1N33 O;  1QVG U;  3E8B A;  4DR6 B;  2GHY A;  5KUK A;  3FB5 C;  2HLD G;  5CA1 A;  1NS1 A;  1HWY A;  1XHZ A;  2BSK A;  2UUB O;  4H44 B;  4JYA B;  4YIP A;  3AK1 A;  1K7D A;  5D5Q A;  3TGU H;  4ZI7 B;  5IE9 A;  4U3J A;  4LF5 O;  3CEI A;  1UFI A;  3K9S A;  5BR8 B;  5EK0 A;  4L8J A;  2PGG A;  1US6 A;  5FNV A;  5A2Q N;  3P3P A;  3JSN A;  4GKJ O;  4I7Z B;  2YEV B;  3T1Y O;  2YC0 A;  1FPO A;  2EIL B;  2F93 B;  4DV2 B;  2ADP A;  4HBN A;  3AG4 C;  4EEQ A;  5GTH Z;  2WAM A;  1FJG O;  3P30 A;  3STL C;  4NXM O;  4CS4 A;  5CBH A;  2WWW A;  2CTP A;  5LP6 C;  4YJ3 A;  3E22 B;  2UU9 B;  2E5L O;  4NYK A;  2ZD9 A;  1N32 B;  2OCC C;  1M93 A;  2PYL A;  1EN4 A;  2Q67 A;  1SQV H;  1IBM B;  3MAQ A;  4DV7 B;  1S77 D;  3LNM B;  4CC5 A;  2CK3 G;  4KFM A;  1AP6 A;  1QU7 A;  5IJ9 A;  2CTR A;  4D6T H;  4JZ2 A;  1K5S A;  2VQE B;  2WLL A;  3BAA A;  2YEV A;  1IVS A;  1GM9 A;  1WPX A;  2QWR B;  3A0H Z;  1NVP B;  3APO A;  3JSL A;  4U3F H;  3RW0 A;  5DM6 V;  1VIB A;  3LNN A;  1IXB A;  2ZXW B;  4BIZ A;  2PTM A;  3K57 A;  3ZRX A;  2QM7 A;  1M5I A;  2ZE5 A;  1QNM A;  2VS0 A;  3A2F A;  2EUL A;  3ETG A;  4JI3 B;  3TXQ A;  5H2F Z;  2YXH A;  3A8T A;  4MW8 A;  1MZE A;  2W0X A;  1JVM A;  4UXN A;  3ZHT A;  1UPG A;  3A0R A;  2UXC B;  1HP8 A;  4DRX A;  1XMO O;  2LGQ A;  1XIL A;  2Q0A A;  4TV8 B;  1YZB A;  2VWJ A;  1RSO B;  2YIA A;  1EN6 A;  1AB3 A;  1FFT B;  3C3T A;  1KKD A;  4W4K A;  1NKD A;  3D36 A;  1YTF D;  4IT5 A;  4UUJ C;  4FFK A;  2AZ0 A;  1BT8 A;  2Q0O C;  5KMG B;  1ZWI C;  4GX2 A;  1R6T A;  3CHX A;  4MVZ A;  1Z2G A;  1VF6 A;  4ABM A;  1COW G;  1K4D C;  4LF4 O;  3CRM A;  4JPR A;  4PDL A;  4X20 A;  1H2L A;  1QLE B;  4PJ0 Z;  4JV5 O;  1AJQ A;  4FLY A;  1DK1 A;  4B3R O;  3FB6 C;  2GUZ B;  2OCC B;  1WB8 A;  2EIK C;  1K3E A;  3CYO A;  4I55 B;  4PV1 B;  1RPO A;  2F66 C;  2GBO A;  2H94 A;  2Q5Z A;  1VQK V;  4LP8 A;  3ABM C;  4TV8 A;  2A9H A;  3ZMT A;  1RSO A;  4TQF A;  4DR2 B;  3UT5 B;  4JTD B;  5JJE B;  4DV0 B;  1GN6 A;  5LOV A;  1VF7 A;  1BCC H;  3S3X A;  5L3G A;  2WLI A;  1N33 B;  1M9N A;  2OIE A;  1BL8 A;  5KMG A;  3E8G A;  5JVD B;  2ZQM A;  2EIJ B;  3JAM N;  5LP6 A;  3CS5 A;  2YXY A;  5K1X A;  2RN9 A;  4LFC O;  1MA1 A;  1KKC A;  2GUZ A;  2JS3 A;  4QPJ A;  2H8P C;  4J9Y B;  4X1K A;  5B3S C;  4E4E A;  4I55 A;  4B3M O;  3ZBH A;  2NNU A;  3RYH B;  1K34 A;  1VQN V;  3UT5 A;  4FPP A;  3NR7 A;  5IDJ A;  5B1B C;  4DR7 O;  4GKJ B;  2CTW A;  2CGN A;  2F4V B;  3H1J H;  4NB5 A;  2WSS G;  2Y0I A;  1TGO A;  2V1D A;  1VMG A;  4KUM A;  3LSQ A;  1AI7 A;  3ZCC A;  1FJG B;  3JAK B;  3P3N A;  4MVR A;  4NXM B;  5JVD A;  4NXN O;  4DV6 O;  3FYI B;  4A5U B;  3ZRW B;  1DTO A;  3K0G A;  4OX9 O;  2LFS A;  2E5L B;  4AHC A;  2ZNJ A;  3ETD A;  1IDS A;  3MHH C;  5LYJ A;  4QGP A;  5CBF A;  2PY5 A;  3DC5 A;  2WA4 A;  4JF3 A;  3U10 A;  1Y6X A;  2P4K A;  3B09 A;  4IYI A;  3GB7 C;  2JDI G;  1Q7Y W;  1F7Y A;  1OCO B;  1YTF B;  1V55 C;  1VAR A;  1SRY A;  3ZJZ A;  3JAT A;  1WPB A;  2B5U A;  4XDJ A;  1PV0 A;  4H37 A;  2H3O A;  1Z5W A;  2L6L A;  3CWB H;  4HNA B;  1QR9 A;  5KLV H;  2XND G;  2BTQ A;  3UO3 A;  4B7E A;  3ABM B;  2B1G A;  3JAK A;  3SDL A;  1H8H G;  4UV9 A;  5LA6 B;  3ICX A;  4FJC C;  3H1H H;  2CTQ A;  3ZRW A;  3HKE B;  4WF9 V;  3HB3 B;  3A0B Z;  3OMN B;  3ZED A;  1S5L Z;  5BMV A;  3QF7 A;  1BZK A;  4UVA A;  1AIL A;  4CZZ A;  4O2B B;  4DR5 O;  1VQ7 V;  3CRC A;  1GKF A;  2QE7 G;  4B3S B;  4WFG A;  2BOB C;  4J7K A;  1BE3 H;  2Q7H A;  3H1I H;  1B04 A;  1TVK B;  2A79 B;  4RUE A;  1I7F A;  4JI4 O;  2JEU A;  4LWS A;  3CD6 V;  4JTA B;  2RNB A;  1JJO A;  5B3S B;  1XMO B;  4HNA A;  3JD4 A;  4F4L A;  2WLN A;  3B8M A;  1Q43 A;  1XHX A;  5LA6 A;  1SES A;  3K5N A;  4O4I B;  1G6U A;  4LNU A;  2JK5 C;  5B1B B;  4WBN B;  1OCR B;  3Q4H A;  3WG7 C;  3HKE A;  1EM1 A;  5CA0 B;  2CGO A;  3RGB A;  5JQG A;  1G8M A;  2WPD G;  1N4C A;  4PA4 A;  3OE7 G;  4B08 A;  3G6E V;  4LF4 B;  2L35 A;  3ABU A;  3AG7 A;  1RM1 C;  1BS3 A;  5LGN A;  2CH7 B;  3H1K H;  4X64 B;  4J41 A;  4JYY A;  1I5Y A;  4O4H B;  4X1Y B;  4TT3 G;  4I0X B;  2VQF O;  1AI5 A;  1H2K A;  1SC5 B;  3LDC A;  3ZMZ A;  4DR1 O;  1V55 B;  4JI8 O;  1IXM A;  3ZMU A;  4PA7 A;  2ZT9 B;  3G67 A;  3IJ4 A;  1L0N H;  3K9A A;  5FLX N;  1YI2 V;  1AVM A;  4K8X A;  2QTS A;  2UUA O;  2F1M A;  4JZG A;  2WLK A;  5L3B A;  1GM7 A;  2ZE6 A;  2FKX A;  1JFF B;  4FM1 A;  2CH7 A;  4LFC B;  2JS5 A;  1GRJ A;  4O4H A;  4X1Y A;  2RCV A;  4ICG A;  3TJT A;  3KKY A;  4JI5 B;  1MOF A;  4GT1 A;  4B3M B;  2IU0 A;  3FAV A;  1H5W A;  4MW3 A;  2WLH A;  4UVC A;  4MTG A;  1Y74 B;  4J11 A;  5H9C A;  4DR7 B;  2QJ1 A;  2GV9 A;  2UXB B;  4H33 A;  1EZV H;  3M99 B;  4KHP O;  3QNE A;  4LH6 A;  5KUM A;  3WU2 Z;  3JD1 A;  3CJH B;  2DWD C;  4B3T O;  2Q7G A;  5B1A C;  4DV6 B;  1B06 A;  4CS3 A;  1JJ2 U;  4LF8 O;  4CC6 A;  3LUT B;  2E76 B;  1R3L C;  1XNR O;  1BQ0 A;  2ZIM A;  1PNL A;  2BOC C;  2PUS A;  3WG7 B;  1JFF A;  3BY6 A;  1NVP D;  3E83 A;  2EIM C;  5DED A;  4J7J A;  3N2G A;  4UCU A;  5ITZ B;  4NVP A;  2ZM6 O;  4CH6 A;  4E2L A;  3W7U A;  1SA0 A;  1M57 C;  3ZHV A;  3PJS K;  4X65 O;  1RM1 B;  3CCJ V;  5DN6 G;  4XDL A;  1FXH A;  1YVW A;  3SJC C;  4GKK O;  1Y74 A;  2Q68 A;  4MT8 A;  2DJV A;  2PYJ A;  5LMN B;  3FFQ A;  4PA3 A;  1FFX B;  4NTY A;  3CB2 A;  3GVM A;  5C93 A;  4I5S A;  3WFV A;  5GTI Z;  4UV8 A;  1KU9 A;  5KAI Z;  5LBQ A;  2HVK C;  2P5O A;  3VOU A;  2P22 C;  5LGT A;  3CME V;  3B77 A;  3W7S A;  3QTC A;  1WLE A;  3BVO A;  3N2K B;  5E1A C;  1BGY H;  1KYO F;  3O65 A;  3CRR A;  4DR5 B;  2LJ2 A;  1NQT A;  5ITZ A;  1JR9 A;  5CA3 A;  2ZE7 A;  1P7G A;  1CPY A;  2N74 A;  4C7U A;  1T5E A;  1PL0 A;  4IYH A;  3VQW A;  2IBZ H;  2PZS A;  3OUF A;  3ZRS A;  1YIJ V;  2DMX A;  4YXW G;  4CH5 A;  4JI4 B;  5JWP A;  3W7X A;  4DV3 O;  1YJN V;  1FFX A;  3ZHS A;  2XAJ A;  3HKB B;  3H9V A;  2Q9L A;  2UXD O;  1XNQ B;  5H6Q A;  2QKS A;  1SQX H;  2RJZ A;  2RQ6 A;  5FPO A;  4DXW A;  3NXS A;  4JI2 O;  1K9M W;  3ZHU A;  2GDS A;  1SQQ H;  3ABK B;  2Q4P A;  4QE7 A;  5EC1 C;  5C8Y B;  1VQ5 V;  1NZ6 A;  4AQY O;  1S3J A;  1XOU A;  1XUQ A;  1Q86 W;  3CMA V;  2P4V A;  1BMF G;  1QLE C;  2A3Q A;  5B1A B;  4PI0 A;  4TV9 B;  1FD9 A;  4GYC B;  4XDK A;  1E1R G;  3LDE A;  2HFE C;  1JQ0 A;  2GTS A;  1FS0 G;  3KDR A;  1JA8 A;  4R7C A;  4ZI7 A;  1VQP V;  2EJR A;  4AIL C;  5IY5 C;  1XMQ O;  2EIM B;  4FFB B;  3UKM A;  1M57 B;  2VQF B;  4JI7 O;  4Q6G A;  3ZHR A;  4JGS A;  4JI8 B;  2XUM A;  2AHY A;  1K97 A;  1D5N A;  4F6R B;  2QKA A;  1VQL V;  3BHP A;  4FLX A;  4FZ0 A;  1YF2 A;  2HEP A;  2KSD A;  5C8Y A;  3RYC B;  2A06 H;  3CXC U;  2P6J A;  2EIJ C;  3SJQ C;  2UUA B;  4MVO A;  2RDC A;  1N0J A;  4ZKI A;  2PF4 E;  3E22 A;  5HFM A;  4TV9 A;  2V4D A;  3C90 A;  2JJ1 G;  2WLJ A;  4OPH A;  3STZ C;  1M56 C;  1ZUQ A;  2IJI A;  2Y4T A;  3JAW B;  4K8Z A;  1F51 A;  3VQX A;  1J5E O;  3SJB C;  4FFB A;  4J9Z B;  3JD0 A;  2XHB A;  4DV5 O;  2ODM A;  4G27 B;  2XAG A;  4DUZ O;  3C3S A;  2X6C A;  1AJP A;  3B2E E;  1ZTE A;  4WFA V;  1K4C C;  5KHI A;  4X9Q A;  1TAE A;  3BRC A;  4HZ3 A;  3CE2 A;  1ARO P;  2ZR2 A;  3RYC A;  4UCT A;  4JAU A;  1QHT A;  4LF7 O;  3ABT A;  4X88 A;  4LBE C;  2R9R B;  5EBM C;  2QA4 V;  2ZKO A;  4DR4 O;  3F7V C;  1TA8 A;  4LF8 B;  2DYS C;  1AP5 A;  3JAW A;  2P7T C;  1R3K C;  4LCU C;  2ZM6 B;  4YY3 O;  1OCO C;  3M8A A;  3TCU A;  4IHJ B;  5B1O A;  4X65 B;  4D7S A;  3OD4 A;  3E8F A;  1W0K G;  2FML A;  1XRE A;  3OEE G;  4GKK B;  1K73 W;  4QPK A;  3J7A U;  2AXT Z;  2IH3 C;  3DTU B;  4WFB V;  5IY5 B;  4DV4 B;  4JI1 B;  5KHJ A;  1BHB A;  5LGU A;  1SS3 A;  3KCX A;  1I08 A;  3OUS A;  4QNH B;  1IBL O;  1HR0 O;  3ZN0 A;  4LFB O;  2UUC O;  3ASO B;  1DLB A;  2LP7 A;  2P06 A;  3CXH F;  1IBK O;  1KD1 W;  1L1F A;  1WP8 A;  4RUF A;  4UCR A;  5KHH A;  4EB6 B;  4DYL A;  4O4J B;  1UJW B;  2R9I A;  1VQ6 V;  1JOY A;  2UUB B;  3SPH A;  3ZS8 C;  4IHJ A;  2MK3 A;  2N04 A;  1M90 W;  4K0K O;  5B1N A;  4D7T A;  4IIJ B;  2OYQ A;  4LF5 B;  1M56 B;  2R9A A;  1H8E G;  4DV3 B;  5IYD O;  3BEH A;  5EIB D;  2KQX A;  1FKA O;  4GX0 A;  5GW7 A;  2HHH O;  4LFA O;  1EFR G;  1IJG A;  3CSX A;  2CUG A;  2ZR3 A;  4BIO A;  1OCR C;  3I5D A;  4YIO A;  3T1Y B;  3FX7 A;  4O4L B;  1I94 O;  1H2M A;  4MSW C;  1W0J G;  3ZN1 A;  1Y76 B;  3IGA C;  3CC2 V;  4KP4 A;  5EIB C;  2GTA A;  4J7Z A;  3JAL B;  2YIC A;  4PA9 A;  4R6Z A;  1OHH G;  2YID A;  4WFH A;  5J2U B;  3QO5 A;  2Y4U A;  1QCE A;  4HYO A;  2QM8 A;  4H13 B;  4OXS A;  3RYF B;  4X89 A;  1U97 A;  1YDX A;  1BSM A;  5LHG A;  2E3C A;  3D3Q A;  2OTJ V;  5JH7 B;  2MW2 B;  2DYS B;  1Y4M A;  4Z2W A;  1XMQ B;  3K08 A;  1FOU A;  4GCZ A;  3RYH A;  3SPJ A;  1NR1 A;  4JI7 B;  2Q8V A;  3T2M A;  2AZ2 A;  1ZL8 B;  4YJ2 B;  4KXR A;  3PN1 A;  4CS2 A;  4G2K A;  2BCC H;  4X62 O;  4O4L A;  3THO A;  1KMI Z;  3S3W A;  1Y76 A;  3EVK A;  3J81 N;  1JCH A;  4MVS A;  3FB7 C;  3AG1 C;  1NU1 H;  1R73 A;  1PP9 H;  3EFF K;  4FLU A;  2DQ0 A;  3OTF A;  3RYF A;  2VWK A;  4ZIB A;  3OEH G;  2KG7 B;  4GZR B;  4FVM A;  1OCZ B;  2Z5U A;  2AW9 A;  3CCR V;  1R6N A;  1SQF A;  3IC7 A;  3MD0 A;  3IFX A;  3OMI B;  4NR1 A;  4UCO A;  1JPX A;  5LXT B;  3IC9 A;  2XAF A;  2W0F C;  2BE3 A;  3KZI Z;  1Q5O A;  4DV5 B;  4AI8 A;  4O2A B;  5J2T B;  1S72 V;  1Q3E A;  3WB0 A;  1W2B U;  2HKO A;  4I4T B;  4YJ2 A;  4P30 A;  2XTA A;  4X66 O;  4P9P A;  3E8H A;  3VQV A;  4JYB A;  3OR6 C;  4BW9 A;  3K0D A;  3K59 A;  1SQP H;  5B5E Z;  1MSD A;  1CXZ B;  3O9O A;  4L87 A;  1FXV A;  4LF7 B;  2Z3Y A;  2CE4 A;  1NTZ H;  2QM4 A;  2EIN C;  5BR8 O;  3D3I A;  3K79 A;  2KG7 A;  2Q69 A;  3L74 H;  1EZJ A;  2XOK G;  1KQS U;  4O2B A;  5DEC A;  2XAQ A;  4RQF A;  5LXT A;  4BWA A;  1J95 A;  1ZX3 A;  4YY3 B;  4I9Q A;  2FB5 A;  2WLM A;  4FIP C;  1ZLZ A;  1VQ8 V;  5CMU A;  4JV5 B;  1TVK A;  4EFE A;  4B3R B;  3HKD B;  1NTK H;  1WA8 B;  5J2T A;  3MHS C;  1XL6 A;  4I4T A;  4LF6 O;  3UO2 A;  3CC4 V;  2QTO A;  2UU9 O;  1ORQ C;  4DV1 O;  1VEW A;  3OGC C;  1GAX A;  1WB7 A;  4B7K A;  1IBL B;  3ASN C;  2QSA A;  2HVJ C;  4LFB B;  4MTF A;  4O4I A;  2CAZ C;  4PDV A;  4WBN A;  1IBM O;  1K8A W;  4Q20 A;  2YS8 A;  5LHH A;  3L71 H;  1IBK B;  1P84 F;  5CA0 A;  5LHI A;  4TWK A;  4BAY A;  4WFF A;  1AR1 B;  4OGQ B;  5F2V O;  4CBC A;  4UB8 Z;  3AG1 B;  1DGS A;  1GTO A;  1NTM H;  1SZX A;  2DWE C;  1YJ9 V;  1S0V A;  4DO2 A;  2NR5 A;  3QO7 A;  3OGI B;  1RPR A;  4UFZ A;  3WB1 A;  3HKD A;  4LC1 A;  1Y67 A;  3MDS A;  1WA8 A;  1VQO V;  2Z0A A;  4I0X A;  5D5P A;  1Q90 D;  1BQZ A;  1TUE B;  1KUQ A;  4LFA B;  2HHH B;  1W59 A;  3SPI A;  3TK1 A;  5TIS Z;  4JI3 O;  1P4R A;  5L3D A;  3ABK C;  3BA8 A;  2ZCE A;  1E1Q G;  3K06 A;  2HJF C;  3GWO A;  1HNX O;  1KEC A;  4PHZ A;  1X4T A;  1PM9 A;  3JAS B;  1YCI A;  4NXN B;  3KCY A;  5BY1 A;  2HP8 A;  4WFE A;  4OX9 B;  4TQD A;  2HG5 C;  3OR7 C;  2EIN B;  1Z5V A;  3R65 A;  4BW5 A;  4ASU G;  3LSS A;  1B3Q A;  4ZHQ B;  5E79 Z;  5B66 Z;  5L3E A;  3ZMV A;  1Y66 A;  2PI5 A;  2YXL A;  3OTO O;  1YSC A;  1VQM V;  2B1I A;  4ZOL B;  1SKV A;  1HNZ O;  3SYP A;  2C2A A;  1MG1 A;  4TSF G;  2QGN A;  1GK9 A;  2YDE A;  4X62 B;  2DOS A;  3SR2 C;  4DR3 O;  2HR3 A;  3OFN G;  3UQ8 A;  3CJH A;  3ASN B;  3ZIA G;  1Q6I A;  3T1H O;  1L0L H;  2IU3 A;  4HAM A;  3RVY A;  3BA9 A;  5IWA O;  4BR6 A;  1G1X B;  3DGE A;  1OV9 A;  1F4N A;  3QO8 A;  2P90 A;  2JEX A;  2D3O W;  3F5T A;  3G6B A;  4RO2 A;  4ZHQ A;  5JJN B;  1MNG A;  2KB1 A;  3BPZ A;  4EFB A;  4ZOL A;  1MZF A;  1Q6U A;  3DC6 A;  1IUR A;  5BZB A;  1VF6 C;  2WA3 A;  2DQ3 A;  4J42 A;  2DYR C;  3OW2 U;  4YJ3 B;  1AI6 A;  2LFR A;  4X66 B;  4GLX A;  2YI9 A;  3CX5 F;  3SPG A; 
#chains in the Genus database with same CATH homology
 4GUN A;  1VAR A;  4JYY A;  1PL4 A;  1GN2 A;  2CE4 A;  3AK2 A;  1AP5 A;  1GN6 A;  3KDR A;  1JA8 A;  1ZSP A;  1PM9 A;  1IXB A;  3QVN A;  1BSM A;  1I0H A;  1IX9 A;  1XRE A;  1ZLZ A;  1QNM A;  1N0N A;  1D5N A;  4YIP A;  3AK1 A;  1AR4 A;  2QKA A;  1AVM A;  1I08 A;  3CEI A;  4JZG A;  1VEW A;  1MA1 A;  1KKC A;  1WB7 A;  3K9S A;  3BFR A;  3EVK A;  2CDY A;  1N0J A;  4E4E A;  1JR9 A;  1XIL A;  1GN4 A;  2RCV A;  3TJT A;  1P7G A;  3KKY A;  4C7U A;  2ADP A;  5A9G A;  1EN6 A;  3C3T A;  1ZUQ A;  1AR5 A;  1SZX A;  2QKC A;  3LSU A;  2AW9 A;  1MMM A;  3OT7 A;  4FFK A;  1BT8 A;  4F6E A;  3IC9 A;  4BR6 A;  3C3S A;  2ADQ B;  1XDC A;  1LUV A;  1Y67 A;  1ZTE A;  5AG2 A;  3MDS A;  1EM1 A;  3AK3 A;  4X9Q A;  1MNG A;  1EN4 A;  2GDS A;  1B06 A;  1GN3 A;  1IDS A;  3DC6 A;  4YIO A;  1AP6 A;  1WB8 A;  3DC5 A;  1EN5 A;  4JZ2 A;  1XUQ A;  1BS3 A;  1LUW A;  2P4K A;  3RN4 A;  1MSD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...