3BFRA

The crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn]
total genus 78
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3bfrA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3bfrA02
2GDSA 3KKYA 1WB7A 1AP6A 1I0HA 1PL4A 4JYYA 2CE4A 1EN6A 2AW9A 1B06A 4YIOA 1MA1A 1JR9A 1EN5A 1GN6A 1IX9A 1BS3A 1GN4A 3IC9A 3MDSA 2ADPA 1XREA 1AVMA 1P7GA 4C7UA 1ZTEA 2QKAA 4X9QA 1ZLZA 5AG2A 1EN4A 4GUNA 1VEWA 3AK1A 1MMMA 1ZSPA 3CEIA 1BT8A 4E4EA 1QNMA 3AK2A 1N0JA 3EVKA 1AR5A 1MSDA 1LUVA 2RCVA 1EM1A 4JZGA 1AR4A 4FFKA 5A9GA 1GN3A 1XUQA 1ZUQA 4F6EA 4YIPA 3TJTA 1N0NA 1BSMA 1MNGA 3K9SA 3BFRA 3DC5A 3C3SA 3DC6A 1AP5A 1VARA 1XDCA 2ADQB 4BR6A 1IDSA 1PM9A 1JA8A 1Y67A 1KKCA 1XILA 1I08A 2CDYA 3OT7A 4JZ2A 1D5NA 2P4KA 3AK3A 1WB8A 3LSUA 1SZXA 1GN2A 2QKCA 3QVNA 3RN4A 1LUWA 1IXBA 3C3TA
chains in the Genus database with same CATH superfamily
1ENVA 2QM7A 3HPLC 1Q90D 4JI4O 4PA6A 2EZOA 3E8GA 1N36B 2F4VB 4JYYA 1GH6A 3FFQA 1YIJV 1JPXA 1R6TA 3L73H 1R3LC 2FL4A 4WFEA 5EYPB 3L72H 3KZIZ 1MG1A 4JI5O 3A2FA 2L6LA 3ICXA 5H5NA 5KMGB 4N23A 1G6UA 2NLJC 3K59A 5B1AB 1S5LZ 2DMXA 3CRQA 4PA3A 5LP6C 2ZNJA 1VQOV 4IGGA 2UU9O 2XNDG 4JI1B 1FFXA 3S3WA 3ML0A 4J11A 1ZAUA 1CP9A 5B3SC 3TETA 3G67A 2FMLA 3DGEA 2UXDO 2IW5A 3S3XA 3OR7C 4LF4B 3QO7A 3MD0A 1VF6A 2F66C 3D3IA 1H2SB 3BA8A 3ZEDA 2RDCA 1IVSA 1KBHA 2PF4E 1RM1B 5IJ0A 3LSSA 3BA9A 1H8EG 4ZI7B 5FPRA 2LFRA 4FFKA 3CCSV 1BQ0A 2A9HA 2EIKB 1ZUQA 3E8FA 3SJQC 1KP3A 4YIPA 4X1YA 2Q6AA 3ZIAG 1YJWV 1P49A 2XTAA 3DC6A 1XNQO 5B1NA 2PGGA 4G2KA 2QTSA 4PI0A 1R6KA 4JI4B 1L0LH 5IJ9A 4HBNA 4U3FH 5KUKA 4CS2A 3CS5A 2JRIA 3PN1A 1KB9F 2OTLV 1N34O 5LBQA 3HB3B 2EJ7A 2LO1A 1HR0B 4IT5A 1SKVA 1IXBA 4JI2O 5FL7G 4K0KB 1H2LA 1WB7A 1CEZA 5IYCO 2XHBA 4I4TA 5C8YA 1AB3A 1XEQA 1Y74B 3K5NA 4P9OA 4YIOA 4JASA 2R9IA 3L75H 4BWAA 1TAEA 4GX5A 3CX5F 5D5QA 1QHTA 3K06A 1BHAA 4X1YB 4TUYA 5BY1A 4X64O 2Q7HA 4WBNA 2BSKA 4H13B 2M7WA 4K8ZA 2HVJC 3OUFA 2N74A 1B6QA 1TGOA 2DE0X 2Q7GA 1S72V 3CEIA 1Q43A 4PDLA 4DR3B 1F51A 2DN9A 2QWPB 5LXTA 1QNMA 5H2FZ 1Y76A 2F95B 2E75B 2RJZA 2CAZC 3T1HO 3RYIA 2ZIMA 4IL6Z 1IZ3A 2A0LA 3TGUH 4JYBA 4CC5A 1JMKC 3TJTA 2UUCO 5DEDA 1H5WA 3LDDA 1URFA 1KQSU 1S77D 4MTGA 1AJPA 3CPWU 5LGTA 2HHHO 4ZOLB 3JAWB 4Q20A 1SRYA 2UXBB 2WA4A 2F1MA 1KKCA 2NN4A 3ASOB 3L70H 3APOA 2ZDIA 5B1BC 4DV7B 1R1BA 2WLHA 4CH5A 3U11A 1D5NA 2H3OA 2BOCC 4Q6GA 3P3NA 4WFFA 4J7ZA 3R65A 3UO3A 1WB8A 4EFBA 5EBMC 1IBKB 1HWYA 2PTMA 4JV5B 3HKDA 1P84F 1XL6A 4B3SB 1O9HA 4LWSA 5CA1B 4JTDB 1N36O 1Q8IA 2XAJA 1BHBA 5JVDB 4NXMO 1GM8A 2VWKA 4CH4A 2CE4A 4TOIA 2GUZB 1MA1A 1MABG 2KKWA 3T4DA 4LF4O 3AG4B 2NR5A 3ZHTA 1M9NA 1KUQA 4FZ1A 1W2BU 1FXHA 3CSXA 5DM6V 2HKOA 3G71V 5JCOC 3ZHUA 1ORQC 4RQFA 1IURA 4DR6B 1WLEA 1Q5OA 4NXMB 4B3RB 1W0JG 1MMMA 1XHZA 2OT5A 3BHPA 3ZJZA 4YHHB 3AK2A 3K57A 3EVKA 1AR5A 1PD3A 4TV9A 1TUBA 4JF3A 1K5QA 4LWSB 3RGBA 1VQ7V 2N04A 2KQXA 3JALA 3P3PA 5CBGA 1N32B 4JPRA 1XOUA 3DXRA 1QVGU 4B3TO 1NZ6A 3JASB 5LOVB 4UCRA 5L3DA 2AXTZ 1NKDA 2P67A 4NXNB 4FIPC 4JGSA 1VQ4V 4DV4O 3PJSK 3I56V 4DUZO 1NVPB 2ZINA 4J41A 2VRZA 4U3JB 3CRCA 4ZHQA 4WFGA 1HDJA 3JAKA 2QKCA 1H38A 5J2TA 1NR7A 3OGCC 5LOVA 1OCZC 2H94A 1FXKA 4QPKA 2O57A 2VQFO 5BR8B 5LMNB 3GWOA 1NT2B 2Q4PA 2IU0A 1Y76B 4O2BA 2VQEB 3GWKC 2QTOA 4EKWA 1N32O 1U96A 4KFMA 1JR9A 5GONA 2HP8A 4DV3O 3JAKB 5JJEB 1MOFA 4GZRB 1GN6A 5EIBC 4ICGA 1H2GA 2P6JA 5HFMA 5LMNO 2X6AA 3HR0A 3O65A 4I55A 2OWOA 3J80N 5FNVA 3BEHA 3ZX6A 2CTRA 4LF6B 4LF5O 4DR7O 3ZRSA 1VQMV 5JJJB 2X6BA 4DV6B 4FLTA 1YZBA 3ABMB 1EN4A 5EK0A 4UB8Z 4WCEV 5KA6A 4H44B 4WFAV 5L3EA 1J5EO 3K3WA 1YCIA 4HNAB 4QJFB 3ABLC 1KECA 4PV1B 5CBHA 4J9ZB 3D3QA 3JAMN 2ZD9A 4X66B 2RN9A 5IYZA 1IBMB 2YEVA 4R7CA 1AJQA 3ZRWA 4DUYO 2RQ6A 2QDOA 1UJWB 3H1HH 5DN6G 1OCOC 3AG3B 2D3OW 5CB4A 1HW7A 4LBEC 2RMKB 3T1YO 1QQCA 1JNBA 3QO8A 5LMUO 1YDXA 1XILA 2CDYA 4B3SO 4G28B 3BVOA 1NR1A 3OT7A 2YIBA 2EIMC 2P4KA 5KAFZ 3C90A 2X7RB 5KMGA 5LXTB 1NBMG 4I50B 5K1XA 1M57C 2YSUB 2E5LB 4DR1O 2CGNA 2YC0A 2EILB 4GYCB 2ZNIA 3AEIA 3ABMC 5KHHA 2R70A 4ABMA 3JATA 2HJDA 3H1IH 2WLNA 4JI1O 4AQYB 2Q69A 2PI4A 5JQGB 4EFEA 3SPJA 2HVKC 2K1EA 1ZL8A 5B66Z 1VQPV 5LGUA 3SPGA 3K79A 2V7QG 1YXBA 1AVMA 4H37A 2DQ3A 3K9AA 1DF4A 4XDJA 4CC6A 2F4VO 2UXNA 3G6BA 4X64B 2QWNB 1K92A 5F2VO 3JALB 4DW1A 1GK9A 1XBLA 2JGDA 3FAVB 2ETNA 1ZL8B 1I5YA 4LF7B 3LNNA 3G80A 4LFAB 3CRAA 4LCUC 2UXCO 4ZI7A 1OZ0A 2JVDA 1D2DA 4GX0A 3L74H 3WB1A 3DC5A 3KCYA 4KHPO 2M6YA 1XDCA 2ADQB 3T2MA 3CCEV 4F6RA 3TCUA 5IJ9B 4O4IA 3SPHA 3ZRWB 3RYCB 5IWAO 1FYJA 1K5SA 3BY6A 3I55V 5CB4B 2P5OA 1I94B 3CD6V 2F43G 2FB5A 4UCOA 2IH1C 2XAFA 2H8PC 3OUSA 1S76D 4U7NA 2ILMA 1MSWD 1I94O 1SQPH 3E83A 4ASUG 1R3IC 1YI2V 2EX3A 4CH6A 2P4VA 2UXBO 5LYJA 4K0KO 4ZBMA 1Q6UA 3SYAA 3MDSA 5IE9A 3BABA 1H8HG 1XHXA 3TXSA 4A5UB 1RSOB 2AHYA 4DRXB 4GUNA 2IH3C 1IXMA 3K0GA 5BXZA 1SQQH 2GUZA 2JDIG 4BIUA 4O4HB 5IY5B 4TWKA 3WU2Z 4O2BB 1AI7A 2LW7A 4TUYB 5LA6B 1G4YB 4IYIA 2RCVA 1R73A 2FTKA 4WBNB 3T4ZA 3H1JH 5CN0A 1VQLV 2AGAA 1Y6XA 1GN3A 1JOYA 3N2GB 5BMVB 3C3SA 1FKAO 4U3JA 2EINC 2HEPA 1VARA 1NJIW 1Y67A 2B1GA 4LF8O 3ZMUA 2HFEC 2ZR3A 2CTPA 2QJ1A 2Y0IA 2PI5A 3H9VA 4MVRA 5CMUA 2CH7B 1QU7A 4KUMA 3IGAC 2Y48A 1GM7A 1YF2A 1SA0B 4CH3A 1BZKA 5CA0A 5JWPA 1VQ9V 1Z2GA 3CWBH 4Z1MG 1LUWA 4EEQA 2DQ0A 4LR3A 3OR6C 4PHZA 4GT1A 3K5MA 3T1HB 3SYCA 4I0XA 1ZX3A 1NI8A 1HNWO 1IBLO 3E35A 3RYFA 3QNEA 3B4SA 1JQ0A 1J95A 3SR2C 3ZS8C 3CRMA 1FJGO 4XDLA 5J9PC 1QLEC 3CJHA 5A2QN 3B77A 1N33O 1GRJA 1M93A 1Q81W 1FFTB 4TV9B 1NTMH 2ZXWB 1VIBA 1BS3A 3NXSA 4UB6Z 3RT3C 1EBOA 5KX5A 3E86A 4B3RO 2QKAA 2YXLA 4X8AA 5JQGA 3B40A 4I0XB 4FM0A 1IBLB 4JI8B 1BT8A 1JJ2U 3WB0A 1KC8W 1V54B 4X89A 1MSDA 2OCCB 3CE2A 1HR0O 4PD4F 5KAIZ 4PA9A 2GSMB 3ZN0A 4FFBA 4EB6A 4O4IB 2Q5ZA 4FLXA 4RAIA 2XAHA 4J10A 4I55B 4RUEA 1BMFG 1Y66A 3ABTA 3Q4HB 5C93A 1SESA 5JH7B 1SQGA 1NQTA 2QE7G 1PM9A 1DK1A 3UQ8A 2CGOA 3SJBC 1WNSA 1OJHA 2EINB 4KXRA 3JYCA 3A8TA 2ZE6A 4I4TB 1P4RA 3CYOA 4QPJA 1H2KA 2DWEC 4UUJC 4FLUA 1K9MW 1XQ8A 1GM9A 3W7SA 2BTOA 2DWDC 1IBMO 3RYHB 1TVKB 2C2AA 3ETDA 4CZZA 2FYUH 3ABKB 2ARHA 1XNRB 3ZBHA 1B06A 5LA6A 5LP6A 1GMGA 1JFFA 1EN5A 4I5SA 2LJ2A 4NTYA 4ZKIA 4DV4B 1NVPD 4FK5C 4RO2A 4TQDA 1N8RW 2OCCC 4FM2A 4DV6O 2QGNA 3HKEB 2MK3A 4ZIBA 2LGWA 2N05A 3FAVA 2ADPA 1G8MA 1P7GA 1DLBA 4X9QA 2WA3A 4R6ZA 1HNZB 3M7MX 3O9OA 3M8AA 2MW2B 4IIJA 4PDRA 3JD1A 4JYAO 1SQXH 2IM9A 3E89A 4JI0B 2OCHA 3OAAG 1OV9A 2R72A 1L8DA 3HKCA 4WFBV 3CCLV 3K04A 1FJGB 5IYZB 1HNZO 5KUMA 2ZE7A 4X66O 1XUQA 5IWAB 2JGUA 2P7TC 4FLYA 3VQYA 2GBOA 1XMQB 2W0FC 1MNGA 4CS3A 1AP5A 4JAAA 2PY5A 5GW7A 2HJFC 4X88A 1PPJH 4GLXA 1YTFB 4MTOA 3MHHC 1X4TA 4DR4O 4FFBB 1D5AA 3W7XA 2R9RB 1S5HC 1XMQO 4XBFA 5B1OA 4JZ2A 2Q7EA 4B3MB 5IDJA 4JI2B 5KA5A 4KL1A 4JAUA 4BW5A 2R9AA 1E1QG 1RPOA 3JD0A 5EBLC 4UCSA 2GDSA 1YITV 1BE3H 1S5JA 2VWJA 2ZR2A 5EZYB 4FMTA 1Q82W 1AP6A 2W6IG 4AI8A 4U7OA 2YDEA 5EC1C 1S3JA 1YJNV 5LMUB 5L3CA 4F6RB 1Q3EA 4ZOLA 3ABKC 1VQKV 2BE3A 2ZE5A 4DR6O 2ZM6O 1MZFA 3RYFB 4Z1VA 2G38A 1VQNV 3U0ZA 3WG7B 3E22B 2VS0A 4UXNA 2A06H 3E8HA 2YUAA 3N27A 4LH7A 2AZ0A 2AHZA 1OCRC 4KP4A 2E5LO 3AG3C 4N21A 2IJIA 4JTAB 2FKXA 4DW0A 4DR1B 4O2AB 5CBFA 4GKKB 4E4EA 1YTFD 4HAMA 5KX5B 3ABUA 1PNKA 3UKMA 3AG1C 3MAQA 1NH2B 5IJ0B 3D36C 2UU9B 2ZM6B 4W4KA 1AR4A 2QWQB 3OE7G 2Q67A 4NKGB 1KYOF 3P30A 4AILC 3AG7A 3CJHB 5B5EZ 1JVMA 4BIZA 4DR2O 5GONB 2QKSA 4MTFA 1UFIA 2OTJV 1Y74A 3ETQA 3HKDB 5IY5C 3IAYA 2YXHA 1Q6IA 4LNUB 1THZA 4DR5O 3KCXA 4DK1A 3ZN1A 2VQFB 3W7WA 3BAAA 4MW3A 5LYJB 4B3MO 3FD9A 4P2ZA 5LP6B 3RVZA 3JSNA 5H6RA 2DW4A 4KHPB 1K73W 3T1CA 1RSOA 2OIEA 4B08A 4O4JA 4P9PA 1BCCH 3AG4C 4D7TA 4H33A 3ZHSA 1AJNA 1FAFA 1WA8A 5B1BB 1BQZA 1WA8B 4YJ3A 2EILC 4LF7O 1AR1B 3CXHF 4DR3O 1F7YA 1K7DA 2DYRC 2QA4V 1COWG 1Y4MA 5JCOA 2E74B 4PELA 3LDEA 4TV8B 1G1XB 1IBKO 2ZIOA 4HYOA 3JARA 2PYJA 3K5LA 2GHYA 3M99B 4CBCA 3CCQV 4JTCB 2EIKC 5HFLA 3UT5A 3ZMTA 2V4DA 5L3GA 3WB2A 2GV9A 3ZHRA 1F4MA 2JEUA 5E1AC 2P06A 3RFRA 1ZSPA 3X2QB 3K08A 3LNMB 4X1IA 2HG5C 4D7SA 1SQVH 3STZC 4LH6A 3HKBA 5ITZA 2ZXWC 2QM4A 3KG2A 1VF6C 4AQYO 1M4UA 2BSKB 4L87A 5EIBD 3AG1B 1N0NA 4Z2WA 3CCJV 4UVBA 3K9SA 1Q86W 4DYLA 2ATKC 2QEXV 1N34B 4MVUA 4B3TB 4BR6A 1TUEB 2YIAA 4FPPA 1XNRO 3ASNB 3JD4A 1T5EA 2WLKA 1FD9A 3G6EV 4X1IB 1PNLA 2BCCH 1SC5B 5LL6Y 1PL0A 2JK5C 3LSUA 3AG2C 3OMNB 3RN4A 1SF9A 1K34A 3WFVA 2KB1A 1HNXO 3FKSG 4FVMA 4MVQA 4OX9B 1AI5A 3EFFK 4NTXA 1NS1A 1NH2D 4O4HA 1FS0G 4JYCA 4QIWF 4I9WA 4GKKO 5FPOA 2JS5A 4X62O 3JD3A 2Z0AA 4J7KA 3X2QC 4JI7O 4DV1B 1NTKH 4J42A 2EJRA 2BOBC 3JCUZ 1J5EB 4JI7B 2DYRB 1O9GA 3IFXA 1GN4A 3JATB 4F4LA 1KP2A 4YJ3B 2PUSA 4R50A 4FLZA 3OMAB 4JI8O 1R3KC 5JH7A 1E79G 1ZLZA 4DV0O 5AG2A 3ABLB 4TT3G 4I7ZB 2EZPA 3CMAV 1XMOB 4DR7B 4LF6O 4DXWA 4TV8A 3EHBB 1R3JC 3SPCA 3ASNC 3BCCH 2LFSA 4J80A 3F7YC 4J7JA 1PKXA 4LFCO 1N0JA 1L0NH 1E1RG 3SJAC 3N2KA 4DV3B 1LUVA 3RWRD 5EYPA 3ZMSA 1WJZA 3W7UA 4JI0O 4TQFA 4K3AA 2ODMA 3OW2U 3CCMV 4F6EA 2YIDA 2F23A 4DV7O 3CCVV 4DUYB 1BSMA 2VQEO 1YJ9V 2UUAO 3Q4HA 2HHHB 2QR4A 4H0LB 1RP3B 3E8BA 1V55B 4L8JA 5DECA 1K3EA 2K9PA 3OTFA 1RFYA 2UUCB 2EIMB 3E22A 3NR7A 4HZ3A 3OFNG 2ZCEA 3RYHA 1W59A 4UV9A 2CTWA 2E76B 5IYBO 1M57B 4XDKA 3J81N 2LP7A 4D6TH 4X20A 2Y4UA 2UUAB 4JI6B 3TK1A 2EBOA 5FNVB 1VF7A 3QG5A 1Z5WA 1KU9A 4UV8A 1CXZB 1U97A 4E2LA 1IJGA 4UCVA 4UVAA 1VF5B 3E2EA 2KG7A 1P7BA 4IHJA 4K35A 5KHGA 1AILA 4DV5O 4RUFA 5J2UB 2F93B 1XREA 2IBZH 4R8CA 3G4SV 1FXKB 1ZTEA 2WLMA 3H01A 3CXCU 2WLLA 2XUMA 1VEWA 1SQFA 2WWWA 4YJ2B 2LGQA 2WAMA 4QE7A 1H2MA 2YIBD 1JFFB 4JI3O 2B9ZA 5TISZ 2B1IA 3WG7C 3K58A 4X62B 5JVDA 1K4DC 2IJKA 1DF5A 5B3SB 5EZYA 4OX9O 3CB2A 5H9CA 2XAGA 4UFZA 4I50A 4GX2A 1HNXB 3FYIB 3SDLA 4RQEA 4OXSA 1XNQB 3RYIB 1LR1A 4DR2B 3FB6C 4X1KA 2Q68A 1WP8A 3OEHG 2E3CA 2IU3A 2KSDA 1N33B 1XMOO 1VQ5V 3CHXA 3B8NA 1FXVA 3U10A 5BR8O 3OMIB 4DO2A 1XL4A 3DTUB 4JI3B 4O4LA 1SA0A 4NB5A 1OCZB 1FXKC 2GTSA 4DR4B 1EN6A 2A7WA 4O2AA 3B8MA 1VMGA 4BAYA 3A0BZ 3LSQA 5BMVA 4NR1A 2XOKG 1QVFU 3SYQA 2JIZG 4G27B 2EULA 2UXCB 3FYEB 3JD2A 5JJNB 1KD1W 3RW0A 2CTQA 1GTOA 1Q6HA 4JI5B 3ZCCA 3H1LH 3QTCA 4NYKA 2JJ1G 2UUBB 3UCSC 3FX7A 5E79Z 2IJHA 4DV2B 3J7AU 4RWUA 1LNQA 2P90A 1OCOB 1DGSA 2CUGA 3CC2V 3AK1A 4DV2O 4LFCB 5GTIZ 1SERA 3VQXA 3IC7A 3DXRB 2ITDC 2PZSA 4MVZA 1A32A 1SQBH 1WPXA 2OIGA 3F7VC 4LC1A 2ZE8A 3SGIA 4LNUA 4GCZA 1M5IA 1RPRA 3F5TA 4O4LB 1OCCC 3VOUA 1ROPA 1VQ8V 1VP7A 4MVSA 4GKJB 3OD4A 1AI4A 1GAXA 5LGNA 1FPOA 2W6JG 2DYSC 3UT5B 5H6QA 2B5UA 1N4CA 1NTZH 1PNMA 2RNBA 4MW8A 4TSFG 2PYLA 1YVWA 1OHHG 3ZHVA 4K8XA 2QM8A 5BZBA 3AG2B 1B04A 4LF8B 2Z3YA 1M90W 3JASA 1GN2A 3LUTB 1Z5VA 2QWRB 5L3FA 4PJ0Z 3KKYA 2GTAA 1KKDA 1I7FA 3LDCA 5K1PA 1I0HA 1PL4A 3ASOC 4IYHA 3P32A 1OCRB 1TA8A 1UPGA 3QF7A 1KMIZ 1NU1H 3VQWA 2A79B 2CH7A 2LW1A 1EZVH 1RM1C 4QE9A 1US6A 4YY3O 3A0RA 5L3BA 1SETA 2HR3A 4WF9V 5IYDO 3IC9A 3B2EE 2ZDIC 1QLNA 4YY3B 2X0LA 1K8AW 3JCZA 4PA7A 2XAQA 1QCEA 4IHJB 4O4JB 4QGPA 3K0DA 4DR5B 2Z5UA 3CC7V 2ZKOA 5GTHZ 1QLEB 3R66A 1K33A 3RVYA 3EXAA 3STLC 2WPDG 5EBWC 1K4CC 4LFBB 3HKBB 5ITZB 4JZGA 4X65O 1AI6A 1SZTA 1AROP 4UCTA 2KG7B 4JV5O 3T1YB 1QR8A 1DTOA 4MS2A 4DRXA 2JGDB 3ETEA 1OCCB 1IDSA 5J2TB 2YEVB 3ZHQA 3ZRXA 5EC2C 3BPZA 1M56B 2DYSB 1V54C 4MVMA 4JI6O 2X6CA 5D5PA 4PI2A 1GO3F 3AK3A 4QNHB 3H1KH 3ZMZA 5CA3A 4DUZB 2BTQB 1BL8A 3D8CA 3C3TA 1VQ6V 1V55C 2YI9A 1SS3A 4GKJO 2WLIA 4FLVA 3ETGA 1PP9H 3DSQA 2D2CB 2Q8VA 2JJ2G 1FFXB 1X59A 2P22C 3JSLA 2DJVA 4BW9A 1IX9A 1W0KG 4IIJB 3CCUV 1V9PA 3APQA 4ZHQB 4OPHA 2Y69B 2UUBO 4X65B 1ZWIC 1JCHA 3I5DA 3CRRA 1QBZA 4YHHO 4C7UA 1HNWB 5KLVH 3SJCC 4CS4A 4OGQB 2Q0OC 2A3QA 2W0XA 4J9YB 4MSWC 4P30A 1WN7A 2WSSG 1CPYA 2JEXA 4LF9O 1JJOA 2QWOB 4AHCA 2DOSA 4OPAA 4W4LA 1M56C 1EZJA 2Q73A 5FLXN 2YS8A 3OGIB 3W7TA 3ZRVA 5A9GA 2Q0AA 2WLIB 4DV1O 2QSAA 2YXYA 1GKFA 1FOUA 1WAZA 3VBBA 2XASA 3ZMVA 4LF5B 1L1FA 5IT9N 4PDVA 3IJ4A 1BGYH 1I08A 3OEEG 1JX9A 1WP7A 4B7EA 3SPIA 3K03A 2EIJC 3CMEV 4JAVA 2XT9A 2V1DA 4FZ0A 4JYAB 1XI1A 4UVCA 4LFBO 2JS3A 3CC4V 4MTXA 3N2KB 4FLWA 4BIOA 1SZXA 1F23A 1K97A 1Q7YW 2YICA 3UM7A 3JAWA 1HP8A 4EB6B 2WLJA 2CK3G 2ITCC 1F4NA 5J2UA 1EFRG 2Q9LA 4PDMA 3F5WC 2AW9A 4LP8A 3JARB 2ZQMA 2UXDB 2ZT9B 1B3QA 3L71H 1I5XA 3L9DA 1TUBB 3FB8C 1R6NA 3FB5C 4LF9B 2AZ2A 5C8YB 3RYCA 2Y0PA 3MHSC 3B09A 4NXNO 1YEWA 3CP1A 2LQTA 4GX1A 4MT8A 2Y69C 1YSCA 1TVKA 1YHQV 3KDRA 5KHJA 3SYPA 2NNUA 3D36A 5B1AC 4DK0A 3GB7C 3N2GA 3A0HZ 3K5OA 1MZEA 3THOA 3HKCB 4X1KB 3HKEA 2EIJB 5CA1A 5KHKA 5KHIA 1EM1A 4PA4A 3SYOA 3UO2A 4X20B 4FJCC 3RBZA 2Y4TA 1QR9A 4WFHA 3OTOB 4DV0B 3BFRA 3FB7C 5CA0B 4YJ2A 4NVPA 2IJJA 1JA8A 2UXXA 4I9QA 2BTQA 4YXWG 2WLLB 2YI8A 3GVMA 5LHHA 4UCUA 4MVOA 4NTWA 5LHGA 3QO5A 3OTOO 3TXQA 3VQVA 1H2NA 4HNAA 5LHIA 1PV0A 4FM1A 4B7KA 3BRCA 4LFAO 1M1KW 2HLDG 1WPBA 2OYQA 3OM3B 3QVNA 2L35A 4DV5B 1S0VA 3CCRV
chains in the Genus database with same CATH topology
2GDSA 3KKYA 1WB7A 1AP6A 1I0HA 1PL4A 4JYYA 2CE4A 1EN6A 2AW9A 1B06A 4YIOA 1MA1A 1JR9A 1EN5A 1GN6A 1IX9A 1BS3A 1GN4A 3IC9A 3MDSA 2ADPA 1XREA 1AVMA 1P7GA 4C7UA 1ZTEA 2QKAA 4X9QA 1ZLZA 5AG2A 3KDRA 1EN4A 4GUNA 1VEWA 3AK1A 1MMMA 1ZSPA 3CEIA 1BT8A 4E4EA 1QNMA 3AK2A 1N0JA 3EVKA 1AR5A 1MSDA 1LUVA 2RCVA 1EM1A 4JZGA 1AR4A 4FFKA 5A9GA 1GN3A 1XUQA 1ZUQA 4F6EA 4YIPA 3TJTA 1N0NA 1BSMA 1MNGA 3K9SA 3BFRA 3DC5A 3C3SA 3DC6A 1AP5A 1VARA 1XDCA 2ADQB 4BR6A 1IDSA 1PM9A 1JA8A 1Y67A 1KKCA 1XILA 1I08A 2CDYA 3OT7A 4JZ2A 1D5NA 2P4KA 3AK3A 1WB8A 3LSUA 1SZXA 1GN2A 2QKCA 3QVNA 3RN4A 1LUWA 1IXBA 3C3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GDS A;  3KKY A;  1WB7 A;  1AP6 A;  1I0H A;  1PL4 A;  4JYY A;  2CE4 A;  1EN6 A;  2AW9 A;  1B06 A;  4YIO A;  1MA1 A;  1JR9 A;  1EN5 A;  1GN6 A;  1IX9 A;  1BS3 A;  1GN4 A;  3IC9 A;  3MDS A;  2ADP A;  1XRE A;  1AVM A;  1P7G A;  4C7U A;  1ZTE A;  2QKA A;  4X9Q A;  1ZLZ A;  5AG2 A;  1EN4 A;  4GUN A;  1VEW A;  3AK1 A;  1MMM A;  1ZSP A;  3CEI A;  1BT8 A;  4E4E A;  1QNM A;  3AK2 A;  1N0J A;  3EVK A;  1AR5 A;  1MSD A;  1LUV A;  2RCV A;  1EM1 A;  4JZG A;  1AR4 A;  4FFK A;  5A9G A;  1GN3 A;  1XUQ A;  1ZUQ A;  4F6E A;  4YIP A;  3TJT A;  1N0N A;  1BSM A;  1MNG A;  3K9S A;  3BFR A;  3DC5 A;  3C3S A;  3DC6 A;  1AP5 A;  1VAR A;  1XDC A;  2ADQ B;  4BR6 A;  1IDS A;  1PM9 A;  1JA8 A;  1Y67 A;  1KKC A;  1XIL A;  1I08 A;  2CDY A;  3OT7 A;  4JZ2 A;  1D5N A;  2P4K A;  3AK3 A;  1WB8 A;  3LSU A;  1SZX A;  1GN2 A;  2QKC A;  3QVN A;  3RN4 A;  1LUW A;  1IXB A;  3C3T A; 
#chains in the Genus database with same CATH topology
 1ENV A;  2QM7 A;  3HPL C;  1Q90 D;  4JI4 O;  4PA6 A;  2EZO A;  3E8G A;  1N36 B;  2F4V B;  4JYY A;  1GH6 A;  3FFQ A;  1YIJ V;  1JPX A;  1R6T A;  3L73 H;  1R3L C;  2FL4 A;  4WFE A;  5EYP B;  3L72 H;  3KZI Z;  1MG1 A;  4JI5 O;  3A2F A;  2L6L A;  3ICX A;  5H5N A;  5KMG B;  4N23 A;  1G6U A;  2NLJ C;  3K59 A;  5B1A B;  1S5L Z;  2DMX A;  3CRQ A;  4PA3 A;  5LP6 C;  2ZNJ A;  1VQO V;  4IGG A;  2UU9 O;  2XND G;  4JI1 B;  1FFX A;  3S3W A;  3ML0 A;  4J11 A;  1ZAU A;  1CP9 A;  5B3S C;  3TET A;  3G67 A;  2FML A;  3DGE A;  2UXD O;  2IW5 A;  3S3X A;  3OR7 C;  4LF4 B;  3QO7 A;  3MD0 A;  1VF6 A;  2F66 C;  3D3I A;  1H2S B;  3BA8 A;  3ZED A;  2RDC A;  1IVS A;  1KBH A;  2PF4 E;  1RM1 B;  5IJ0 A;  3LSS A;  3BA9 A;  1H8E G;  4ZI7 B;  5FPR A;  2LFR A;  4FFK A;  3CCS V;  1BQ0 A;  2A9H A;  2EIK B;  1ZUQ A;  3E8F A;  3SJQ C;  1KP3 A;  4YIP A;  4X1Y A;  2Q6A A;  3ZIA G;  1YJW V;  1P49 A;  2XTA A;  3DC6 A;  1XNQ O;  5B1N A;  2PGG A;  4G2K A;  2QTS A;  4PI0 A;  1R6K A;  4JI4 B;  1L0L H;  5IJ9 A;  4HBN A;  4U3F H;  5KUK A;  4CS2 A;  3CS5 A;  2JRI A;  3PN1 A;  1KB9 F;  2OTL V;  1N34 O;  5LBQ A;  3HB3 B;  2EJ7 A;  2LO1 A;  1HR0 B;  4IT5 A;  1SKV A;  1IXB A;  4JI2 O;  5FL7 G;  4K0K B;  1H2L A;  1WB7 A;  1CEZ A;  5IYC O;  2XHB A;  4I4T A;  5C8Y A;  1AB3 A;  1XEQ A;  1Y74 B;  3K5N A;  4P9O A;  4YIO A;  4JAS A;  2R9I A;  3L75 H;  4BWA A;  1TAE A;  4GX5 A;  3CX5 F;  5D5Q A;  1QHT A;  3K06 A;  1BHA A;  4X1Y B;  4TUY A;  5BY1 A;  4X64 O;  2Q7H A;  4WBN A;  2BSK A;  4H13 B;  2M7W A;  4K8Z A;  2HVJ C;  3OUF A;  2N74 A;  1B6Q A;  1TGO A;  2DE0 X;  2Q7G A;  1S72 V;  3CEI A;  1Q43 A;  4PDL A;  4DR3 B;  1F51 A;  2DN9 A;  2QWP B;  5LXT A;  1QNM A;  5H2F Z;  1Y76 A;  2F95 B;  2E75 B;  2RJZ A;  2CAZ C;  3T1H O;  3RYI A;  2ZIM A;  4IL6 Z;  1IZ3 A;  2A0L A;  3TGU H;  4JYB A;  4CC5 A;  1JMK C;  3TJT A;  2UUC O;  5DED A;  1H5W A;  3LDD A;  1URF A;  1KQS U;  1S77 D;  4MTG A;  1AJP A;  3CPW U;  5LGT A;  2HHH O;  4ZOL B;  3JAW B;  4Q20 A;  1SRY A;  2UXB B;  2WA4 A;  2F1M A;  1KKC A;  2NN4 A;  3ASO B;  3L70 H;  3APO A;  2ZDI A;  5B1B C;  4DV7 B;  1R1B A;  2WLH A;  4CH5 A;  3U11 A;  1D5N A;  2H3O A;  2BOC C;  4Q6G A;  3P3N A;  4WFF A;  4J7Z A;  3R65 A;  3UO3 A;  1WB8 A;  4EFB A;  5EBM C;  1IBK B;  1HWY A;  2PTM A;  4JV5 B;  3HKD A;  1P84 F;  1XL6 A;  4B3S B;  1O9H A;  4LWS A;  5CA1 B;  4JTD B;  1N36 O;  1Q8I A;  2XAJ A;  1BHB A;  5JVD B;  4NXM O;  1GM8 A;  2VWK A;  4CH4 A;  2CE4 A;  4TOI A;  2GUZ B;  1MA1 A;  1MAB G;  2KKW A;  3T4D A;  4LF4 O;  3AG4 B;  2NR5 A;  3ZHT A;  1M9N A;  1KUQ A;  4FZ1 A;  1W2B U;  1FXH A;  3CSX A;  5DM6 V;  2HKO A;  3G71 V;  5JCO C;  3ZHU A;  1ORQ C;  4RQF A;  1IUR A;  4DR6 B;  1WLE A;  1Q5O A;  4NXM B;  4B3R B;  1W0J G;  1MMM A;  1XHZ A;  2OT5 A;  3BHP A;  3ZJZ A;  4YHH B;  3AK2 A;  3K57 A;  3EVK A;  1AR5 A;  1PD3 A;  4TV9 A;  1TUB A;  4JF3 A;  1K5Q A;  4LWS B;  3RGB A;  1VQ7 V;  2N04 A;  2KQX A;  3JAL A;  3P3P A;  5CBG A;  1N32 B;  4JPR A;  1XOU A;  3DXR A;  1QVG U;  4B3T O;  1NZ6 A;  3JAS B;  5LOV B;  4UCR A;  5L3D A;  2AXT Z;  1NKD A;  2P67 A;  4NXN B;  4FIP C;  4JGS A;  1VQ4 V;  4DV4 O;  3PJS K;  3I56 V;  4DUZ O;  1NVP B;  2ZIN A;  4J41 A;  2VRZ A;  4U3J B;  3CRC A;  4ZHQ A;  4WFG A;  1HDJ A;  3JAK A;  2QKC A;  1H38 A;  5J2T A;  1NR7 A;  3OGC C;  5LOV A;  1OCZ C;  2H94 A;  1FXK A;  4QPK A;  2O57 A;  2VQF O;  5BR8 B;  5LMN B;  3GWO A;  1NT2 B;  2Q4P A;  2IU0 A;  1Y76 B;  4O2B A;  2VQE B;  3GWK C;  2QTO A;  4EKW A;  1N32 O;  1U96 A;  4KFM A;  1JR9 A;  5GON A;  2HP8 A;  4DV3 O;  3JAK B;  5JJE B;  1MOF A;  4GZR B;  1GN6 A;  5EIB C;  4ICG A;  1H2G A;  2P6J A;  5HFM A;  5LMN O;  2X6A A;  3HR0 A;  3O65 A;  4I55 A;  2OWO A;  3J80 N;  5FNV A;  3BEH A;  3ZX6 A;  2CTR A;  4LF6 B;  4LF5 O;  4DR7 O;  3ZRS A;  1VQM V;  5JJJ B;  2X6B A;  4DV6 B;  4FLT A;  1YZB A;  3ABM B;  1EN4 A;  5EK0 A;  4UB8 Z;  4WCE V;  5KA6 A;  4H44 B;  4WFA V;  5L3E A;  1J5E O;  3K3W A;  1YCI A;  4HNA B;  4QJF B;  3ABL C;  1KEC A;  4PV1 B;  5CBH A;  4J9Z B;  3D3Q A;  3JAM N;  2ZD9 A;  4X66 B;  2RN9 A;  5IYZ A;  1IBM B;  2YEV A;  4R7C A;  1AJQ A;  3ZRW A;  4DUY O;  2RQ6 A;  2QDO A;  1UJW B;  3H1H H;  5DN6 G;  1OCO C;  3AG3 B;  2D3O W;  5CB4 A;  1HW7 A;  4LBE C;  2RMK B;  3T1Y O;  1QQC A;  1JNB A;  3QO8 A;  5LMU O;  1YDX A;  1XIL A;  2CDY A;  4B3S O;  4G28 B;  3BVO A;  1NR1 A;  3OT7 A;  2YIB A;  2EIM C;  2P4K A;  5KAF Z;  3C90 A;  2X7R B;  5KMG A;  5LXT B;  1NBM G;  4I50 B;  5K1X A;  1M57 C;  2YSU B;  2E5L B;  4DR1 O;  2CGN A;  2YC0 A;  2EIL B;  4GYC B;  2ZNI A;  3AEI A;  3ABM C;  5KHH A;  2R70 A;  4ABM A;  3JAT A;  2HJD A;  3H1I H;  2WLN A;  4JI1 O;  4AQY B;  2Q69 A;  2PI4 A;  5JQG B;  4EFE A;  3SPJ A;  2HVK C;  2K1E A;  1ZL8 A;  5B66 Z;  1VQP V;  5LGU A;  3SPG A;  3K79 A;  2V7Q G;  1YXB A;  1AVM A;  4H37 A;  2DQ3 A;  3K9A A;  1DF4 A;  4XDJ A;  4CC6 A;  2F4V O;  2UXN A;  3G6B A;  4X64 B;  2QWN B;  1K92 A;  5F2V O;  3JAL B;  4DW1 A;  1GK9 A;  1XBL A;  2JGD A;  3FAV B;  2ETN A;  1ZL8 B;  1I5Y A;  4LF7 B;  3LNN A;  3G80 A;  4LFA B;  3CRA A;  4LCU C;  2UXC O;  4ZI7 A;  1OZ0 A;  2JVD A;  1D2D A;  4GX0 A;  3L74 H;  3WB1 A;  3DC5 A;  3KCY A;  4KHP O;  2M6Y A;  1XDC A;  2ADQ B;  3T2M A;  3CCE V;  4F6R A;  3TCU A;  5IJ9 B;  4O4I A;  3SPH A;  3ZRW B;  3RYC B;  5IWA O;  1FYJ A;  1K5S A;  3BY6 A;  3I55 V;  5CB4 B;  2P5O A;  1I94 B;  3CD6 V;  2F43 G;  2FB5 A;  4UCO A;  2IH1 C;  2XAF A;  2H8P C;  3OUS A;  1S76 D;  4U7N A;  2ILM A;  1MSW D;  1I94 O;  1SQP H;  3E83 A;  4ASU G;  1R3I C;  1YI2 V;  2EX3 A;  4CH6 A;  2P4V A;  2UXB O;  5LYJ A;  4K0K O;  4ZBM A;  1Q6U A;  3SYA A;  3MDS A;  5IE9 A;  3BAB A;  1H8H G;  1XHX A;  3TXS A;  4A5U B;  1RSO B;  2AHY A;  4DRX B;  4GUN A;  2IH3 C;  1IXM A;  3K0G A;  5BXZ A;  1SQQ H;  2GUZ A;  2JDI G;  4BIU A;  4O4H B;  5IY5 B;  4TWK A;  3WU2 Z;  4O2B B;  1AI7 A;  2LW7 A;  4TUY B;  5LA6 B;  1G4Y B;  4IYI A;  2RCV A;  1R73 A;  2FTK A;  4WBN B;  3T4Z A;  3H1J H;  5CN0 A;  1VQL V;  2AGA A;  1Y6X A;  1GN3 A;  1JOY A;  3N2G B;  5BMV B;  3C3S A;  1FKA O;  4U3J A;  2EIN C;  2HEP A;  1VAR A;  1NJI W;  1Y67 A;  2B1G A;  4LF8 O;  3ZMU A;  2HFE C;  2ZR3 A;  2CTP A;  2QJ1 A;  2Y0I A;  2PI5 A;  3H9V A;  4MVR A;  5CMU A;  2CH7 B;  1QU7 A;  4KUM A;  3IGA C;  2Y48 A;  1GM7 A;  1YF2 A;  1SA0 B;  4CH3 A;  1BZK A;  5CA0 A;  5JWP A;  1VQ9 V;  1Z2G A;  3CWB H;  4Z1M G;  1LUW A;  4EEQ A;  2DQ0 A;  4LR3 A;  3OR6 C;  4PHZ A;  4GT1 A;  3K5M A;  3T1H B;  3SYC A;  4I0X A;  1ZX3 A;  1NI8 A;  1HNW O;  1IBL O;  3E35 A;  3RYF A;  3QNE A;  3B4S A;  1JQ0 A;  1J95 A;  3SR2 C;  3ZS8 C;  3CRM A;  1FJG O;  4XDL A;  5J9P C;  1QLE C;  3CJH A;  5A2Q N;  3B77 A;  1N33 O;  1GRJ A;  1M93 A;  1Q81 W;  1FFT B;  4TV9 B;  1NTM H;  2ZXW B;  1VIB A;  1BS3 A;  3NXS A;  4UB6 Z;  3RT3 C;  1EBO A;  5KX5 A;  3E86 A;  4B3R O;  2QKA A;  2YXL A;  4X8A A;  5JQG A;  3B40 A;  4I0X B;  4FM0 A;  1IBL B;  4JI8 B;  1BT8 A;  1JJ2 U;  3WB0 A;  1KC8 W;  1V54 B;  4X89 A;  1MSD A;  2OCC B;  3CE2 A;  1HR0 O;  4PD4 F;  5KAI Z;  4PA9 A;  2GSM B;  3ZN0 A;  4FFB A;  4EB6 A;  4O4I B;  2Q5Z A;  4FLX A;  4RAI A;  2XAH A;  4J10 A;  4I55 B;  4RUE A;  1BMF G;  1Y66 A;  3ABT A;  3Q4H B;  5C93 A;  1SES A;  5JH7 B;  1SQG A;  1NQT A;  2QE7 G;  1PM9 A;  1DK1 A;  3UQ8 A;  2CGO A;  3SJB C;  1WNS A;  1OJH A;  2EIN B;  4KXR A;  3JYC A;  3A8T A;  2ZE6 A;  4I4T B;  1P4R A;  3CYO A;  4QPJ A;  1H2K A;  2DWE C;  4UUJ C;  4FLU A;  1K9M W;  1XQ8 A;  1GM9 A;  3W7S A;  2BTO A;  2DWD C;  1IBM O;  3RYH B;  1TVK B;  2C2A A;  3ETD A;  4CZZ A;  2FYU H;  3ABK B;  2ARH A;  1XNR B;  3ZBH A;  1B06 A;  5LA6 A;  5LP6 A;  1GMG A;  1JFF A;  1EN5 A;  4I5S A;  2LJ2 A;  4NTY A;  4ZKI A;  4DV4 B;  1NVP D;  4FK5 C;  4RO2 A;  4TQD A;  1N8R W;  2OCC C;  4FM2 A;  4DV6 O;  2QGN A;  3HKE B;  2MK3 A;  4ZIB A;  2LGW A;  2N05 A;  3FAV A;  2ADP A;  1G8M A;  1P7G A;  1DLB A;  4X9Q A;  2WA3 A;  4R6Z A;  1HNZ B;  3M7M X;  3O9O A;  3M8A A;  2MW2 B;  4IIJ A;  4PDR A;  3JD1 A;  4JYA O;  1SQX H;  2IM9 A;  3E89 A;  4JI0 B;  2OCH A;  3OAA G;  1OV9 A;  2R72 A;  1L8D A;  3HKC A;  4WFB V;  3CCL V;  3K04 A;  1FJG B;  5IYZ B;  1HNZ O;  5KUM A;  2ZE7 A;  4X66 O;  1XUQ A;  5IWA B;  2JGU A;  2P7T C;  4FLY A;  3VQY A;  2GBO A;  1XMQ B;  2W0F C;  1MNG A;  4CS3 A;  1AP5 A;  4JAA A;  2PY5 A;  5GW7 A;  2HJF C;  4X88 A;  1PPJ H;  4GLX A;  1YTF B;  4MTO A;  3MHH C;  1X4T A;  4DR4 O;  4FFB B;  1D5A A;  3W7X A;  2R9R B;  1S5H C;  1XMQ O;  4XBF A;  5B1O A;  4JZ2 A;  2Q7E A;  4B3M B;  5IDJ A;  4JI2 B;  5KA5 A;  4KL1 A;  4JAU A;  4BW5 A;  2R9A A;  1E1Q G;  1RPO A;  3JD0 A;  5EBL C;  4UCS A;  2GDS A;  1YIT V;  1BE3 H;  1S5J A;  2VWJ A;  2ZR2 A;  5EZY B;  4FMT A;  1Q82 W;  1AP6 A;  2W6I G;  4AI8 A;  4U7O A;  2YDE A;  5EC1 C;  1S3J A;  1YJN V;  5LMU B;  5L3C A;  4F6R B;  1Q3E A;  4ZOL A;  3ABK C;  1VQK V;  2BE3 A;  2ZE5 A;  4DR6 O;  2ZM6 O;  1MZF A;  3RYF B;  4Z1V A;  2G38 A;  1VQN V;  3U0Z A;  3WG7 B;  3E22 B;  2VS0 A;  4UXN A;  2A06 H;  3E8H A;  2YUA A;  3N27 A;  4LH7 A;  2AZ0 A;  2AHZ A;  1OCR C;  4KP4 A;  2E5L O;  3AG3 C;  4N21 A;  2IJI A;  4JTA B;  2FKX A;  4DW0 A;  4DR1 B;  4O2A B;  5CBF A;  4GKK B;  4E4E A;  1YTF D;  4HAM A;  5KX5 B;  3ABU A;  1PNK A;  3UKM A;  3AG1 C;  3MAQ A;  1NH2 B;  5IJ0 B;  3D36 C;  2UU9 B;  2ZM6 B;  4W4K A;  1AR4 A;  2QWQ B;  3OE7 G;  2Q67 A;  4NKG B;  1KYO F;  3P30 A;  4AIL C;  3AG7 A;  3CJH B;  5B5E Z;  1JVM A;  4BIZ A;  4DR2 O;  5GON B;  2QKS A;  4MTF A;  1UFI A;  2OTJ V;  1Y74 A;  3ETQ A;  3HKD B;  5IY5 C;  3IAY A;  2YXH A;  1Q6I A;  4LNU B;  1THZ A;  4DR5 O;  3KCX A;  4DK1 A;  3ZN1 A;  2VQF B;  3W7W A;  3BAA A;  4MW3 A;  5LYJ B;  4B3M O;  3FD9 A;  4P2Z A;  5LP6 B;  3RVZ A;  3JSN A;  5H6R A;  2DW4 A;  4KHP B;  1K73 W;  3T1C A;  1RSO A;  2OIE A;  4B08 A;  4O4J A;  4P9P A;  1BCC H;  3AG4 C;  4D7T A;  4H33 A;  3ZHS A;  1AJN A;  1FAF A;  1WA8 A;  5B1B B;  1BQZ A;  1WA8 B;  4YJ3 A;  2EIL C;  4LF7 O;  1AR1 B;  3CXH F;  4DR3 O;  1F7Y A;  1K7D A;  2DYR C;  2QA4 V;  1COW G;  1Y4M A;  5JCO A;  2E74 B;  4PEL A;  3LDE A;  4TV8 B;  1G1X B;  1IBK O;  2ZIO A;  4HYO A;  3JAR A;  2PYJ A;  3K5L A;  2GHY A;  3M99 B;  4CBC A;  3CCQ V;  4JTC B;  2EIK C;  5HFL A;  3UT5 A;  3ZMT A;  2V4D A;  5L3G A;  3WB2 A;  2GV9 A;  3ZHR A;  1F4M A;  2JEU A;  5E1A C;  2P06 A;  3RFR A;  1ZSP A;  3X2Q B;  3K08 A;  3LNM B;  4X1I A;  2HG5 C;  4D7S A;  1SQV H;  3STZ C;  4LH6 A;  3HKB A;  5ITZ A;  2ZXW C;  2QM4 A;  3KG2 A;  1VF6 C;  4AQY O;  1M4U A;  2BSK B;  4L87 A;  5EIB D;  3AG1 B;  1N0N A;  4Z2W A;  3CCJ V;  4UVB A;  3K9S A;  1Q86 W;  4DYL A;  2ATK C;  2QEX V;  1N34 B;  4MVU A;  4B3T B;  4BR6 A;  1TUE B;  2YIA A;  4FPP A;  1XNR O;  3ASN B;  3JD4 A;  1T5E A;  2WLK A;  1FD9 A;  3G6E V;  4X1I B;  1PNL A;  2BCC H;  1SC5 B;  5LL6 Y;  1PL0 A;  2JK5 C;  3LSU A;  3AG2 C;  3OMN B;  3RN4 A;  1SF9 A;  1K34 A;  3WFV A;  2KB1 A;  1HNX O;  3FKS G;  4FVM A;  4MVQ A;  4OX9 B;  1AI5 A;  3EFF K;  4NTX A;  1NS1 A;  1NH2 D;  4O4H A;  1FS0 G;  4JYC A;  4QIW F;  4I9W A;  4GKK O;  5FPO A;  2JS5 A;  4X62 O;  3JD3 A;  2Z0A A;  4J7K A;  3X2Q C;  4JI7 O;  4DV1 B;  1NTK H;  4J42 A;  2EJR A;  2BOB C;  3JCU Z;  1J5E B;  4JI7 B;  2DYR B;  1O9G A;  3IFX A;  1GN4 A;  3JAT B;  4F4L A;  1KP2 A;  4YJ3 B;  2PUS A;  4R50 A;  4FLZ A;  3OMA B;  4JI8 O;  1R3K C;  5JH7 A;  1E79 G;  1ZLZ A;  4DV0 O;  5AG2 A;  3ABL B;  4TT3 G;  4I7Z B;  2EZP A;  3CMA V;  1XMO B;  4DR7 B;  4LF6 O;  4DXW A;  4TV8 A;  3EHB B;  1R3J C;  3SPC A;  3ASN C;  3BCC H;  2LFS A;  4J80 A;  3F7Y C;  4J7J A;  1PKX A;  4LFC O;  1N0J A;  1L0N H;  1E1R G;  3SJA C;  3N2K A;  4DV3 B;  1LUV A;  3RWR D;  5EYP A;  3ZMS A;  1WJZ A;  3W7U A;  4JI0 O;  4TQF A;  4K3A A;  2ODM A;  3OW2 U;  3CCM V;  4F6E A;  2YID A;  2F23 A;  4DV7 O;  3CCV V;  4DUY B;  1BSM A;  2VQE O;  1YJ9 V;  2UUA O;  3Q4H A;  2HHH B;  2QR4 A;  4H0L B;  1RP3 B;  3E8B A;  1V55 B;  4L8J A;  5DEC A;  1K3E A;  2K9P A;  3OTF A;  1RFY A;  2UUC B;  2EIM B;  3E22 A;  3NR7 A;  4HZ3 A;  3OFN G;  2ZCE A;  3RYH A;  1W59 A;  4UV9 A;  2CTW A;  2E76 B;  5IYB O;  1M57 B;  4XDK A;  3J81 N;  2LP7 A;  4D6T H;  4X20 A;  2Y4U A;  2UUA B;  4JI6 B;  3TK1 A;  2EBO A;  5FNV B;  1VF7 A;  3QG5 A;  1Z5W A;  1KU9 A;  4UV8 A;  1CXZ B;  1U97 A;  4E2L A;  1IJG A;  4UCV A;  4UVA A;  1VF5 B;  3E2E A;  2KG7 A;  1P7B A;  4IHJ A;  4K35 A;  5KHG A;  1AIL A;  4DV5 O;  4RUF A;  5J2U B;  2F93 B;  1XRE A;  2IBZ H;  4R8C A;  3G4S V;  1FXK B;  1ZTE A;  2WLM A;  3H01 A;  3CXC U;  2WLL A;  2XUM A;  1VEW A;  1SQF A;  2WWW A;  4YJ2 B;  2LGQ A;  2WAM A;  4QE7 A;  1H2M A;  2YIB D;  1JFF B;  4JI3 O;  2B9Z A;  5TIS Z;  2B1I A;  3WG7 C;  3K58 A;  4X62 B;  5JVD A;  1K4D C;  2IJK A;  1DF5 A;  5B3S B;  5EZY A;  4OX9 O;  3CB2 A;  5H9C A;  2XAG A;  4UFZ A;  4I50 A;  4GX2 A;  1HNX B;  3FYI B;  3SDL A;  4RQE A;  4OXS A;  1XNQ B;  3RYI B;  1LR1 A;  4DR2 B;  3FB6 C;  4X1K A;  2Q68 A;  1WP8 A;  3OEH G;  2E3C A;  2IU3 A;  2KSD A;  1N33 B;  1XMO O;  1VQ5 V;  3CHX A;  3B8N A;  1FXV A;  3U10 A;  5BR8 O;  3OMI B;  4DO2 A;  1XL4 A;  3DTU B;  4JI3 B;  4O4L A;  1SA0 A;  4NB5 A;  1OCZ B;  1FXK C;  2GTS A;  4DR4 B;  1EN6 A;  2A7W A;  4O2A A;  3B8M A;  1VMG A;  4BAY A;  3A0B Z;  3LSQ A;  5BMV A;  4NR1 A;  2XOK G;  1QVF U;  3SYQ A;  2JIZ G;  4G27 B;  2EUL A;  2UXC B;  3FYE B;  3JD2 A;  5JJN B;  1KD1 W;  3RW0 A;  2CTQ A;  1GTO A;  1Q6H A;  4JI5 B;  3ZCC A;  3H1L H;  3QTC A;  4NYK A;  2JJ1 G;  2UUB B;  3UCS C;  3FX7 A;  5E79 Z;  2IJH A;  4DV2 B;  3J7A U;  4RWU A;  1LNQ A;  2P90 A;  1OCO B;  1DGS A;  2CUG A;  3CC2 V;  3AK1 A;  4DV2 O;  4LFC B;  5GTI Z;  1SER A;  3VQX A;  3IC7 A;  3DXR B;  2ITD C;  2PZS A;  4MVZ A;  1A32 A;  1SQB H;  1WPX A;  2OIG A;  3F7V C;  4LC1 A;  2ZE8 A;  3SGI A;  4LNU A;  4GCZ A;  1M5I A;  1RPR A;  3F5T A;  4O4L B;  1OCC C;  3VOU A;  1ROP A;  1VQ8 V;  1VP7 A;  4MVS A;  4GKJ B;  3OD4 A;  1AI4 A;  1GAX A;  5LGN A;  1FPO A;  2W6J G;  2DYS C;  3UT5 B;  5H6Q A;  2B5U A;  1N4C A;  1NTZ H;  1PNM A;  2RNB A;  4MW8 A;  4TSF G;  2PYL A;  1YVW A;  1OHH G;  3ZHV A;  4K8X A;  2QM8 A;  5BZB A;  3AG2 B;  1B04 A;  4LF8 B;  2Z3Y A;  1M90 W;  3JAS A;  1GN2 A;  3LUT B;  1Z5V A;  2QWR B;  5L3F A;  4PJ0 Z;  3KKY A;  2GTA A;  1KKD A;  1I7F A;  3LDC A;  5K1P A;  1I0H A;  1PL4 A;  3ASO C;  4IYH A;  3P32 A;  1OCR B;  1TA8 A;  1UPG A;  3QF7 A;  1KMI Z;  1NU1 H;  3VQW A;  2A79 B;  2CH7 A;  2LW1 A;  1EZV H;  1RM1 C;  4QE9 A;  1US6 A;  4YY3 O;  3A0R A;  5L3B A;  1SET A;  2HR3 A;  4WF9 V;  5IYD O;  3IC9 A;  3B2E E;  2ZDI C;  1QLN A;  4YY3 B;  2X0L A;  1K8A W;  3JCZ A;  4PA7 A;  2XAQ A;  1QCE A;  4IHJ B;  4O4J B;  4QGP A;  3K0D A;  4DR5 B;  2Z5U A;  3CC7 V;  2ZKO A;  5GTH Z;  1QLE B;  3R66 A;  1K33 A;  3RVY A;  3EXA A;  3STL C;  2WPD G;  5EBW C;  1K4C C;  4LFB B;  3HKB B;  5ITZ B;  4JZG A;  4X65 O;  1AI6 A;  1SZT A;  1ARO P;  4UCT A;  2KG7 B;  4JV5 O;  3T1Y B;  1QR8 A;  1DTO A;  4MS2 A;  4DRX A;  2JGD B;  3ETE A;  1OCC B;  1IDS A;  5J2T B;  2YEV B;  3ZHQ A;  3ZRX A;  5EC2 C;  3BPZ A;  1M56 B;  2DYS B;  1V54 C;  4MVM A;  4JI6 O;  2X6C A;  5D5P A;  4PI2 A;  1GO3 F;  3AK3 A;  4QNH B;  3H1K H;  3ZMZ A;  5CA3 A;  4DUZ B;  2BTQ B;  1BL8 A;  3D8C A;  3C3T A;  1VQ6 V;  1V55 C;  2YI9 A;  1SS3 A;  4GKJ O;  2WLI A;  4FLV A;  3ETG A;  1PP9 H;  3DSQ A;  2D2C B;  2Q8V A;  2JJ2 G;  1FFX B;  1X59 A;  2P22 C;  3JSL A;  2DJV A;  4BW9 A;  1IX9 A;  1W0K G;  4IIJ B;  3CCU V;  1V9P A;  3APQ A;  4ZHQ B;  4OPH A;  2Y69 B;  2UUB O;  4X65 B;  1ZWI C;  1JCH A;  3I5D A;  3CRR A;  1QBZ A;  4YHH O;  4C7U A;  1HNW B;  5KLV H;  3SJC C;  4CS4 A;  4OGQ B;  2Q0O C;  2A3Q A;  2W0X A;  4J9Y B;  4MSW C;  4P30 A;  1WN7 A;  2WSS G;  1CPY A;  2JEX A;  4LF9 O;  1JJO A;  2QWO B;  4AHC A;  2DOS A;  4OPA A;  4W4L A;  1M56 C;  1EZJ A;  2Q73 A;  5FLX N;  2YS8 A;  3OGI B;  3W7T A;  3ZRV A;  5A9G A;  2Q0A A;  2WLI B;  4DV1 O;  2QSA A;  2YXY A;  1GKF A;  1FOU A;  1WAZ A;  3VBB A;  2XAS A;  3ZMV A;  4LF5 B;  1L1F A;  5IT9 N;  4PDV A;  3IJ4 A;  1BGY H;  1I08 A;  3OEE G;  1JX9 A;  1WP7 A;  4B7E A;  3SPI A;  3K03 A;  2EIJ C;  3CME V;  4JAV A;  2XT9 A;  2V1D A;  4FZ0 A;  4JYA B;  1XI1 A;  4UVC A;  4LFB O;  2JS3 A;  3CC4 V;  4MTX A;  3N2K B;  4FLW A;  4BIO A;  1SZX A;  1F23 A;  1K97 A;  1Q7Y W;  2YIC A;  3UM7 A;  3JAW A;  1HP8 A;  4EB6 B;  2WLJ A;  2CK3 G;  2ITC C;  1F4N A;  5J2U A;  1EFR G;  2Q9L A;  4PDM A;  3F5W C;  2AW9 A;  4LP8 A;  3JAR B;  2ZQM A;  2UXD B;  2ZT9 B;  1B3Q A;  3L71 H;  1I5X A;  3L9D A;  1TUB B;  3FB8 C;  1R6N A;  3FB5 C;  4LF9 B;  2AZ2 A;  5C8Y B;  3RYC A;  2Y0P A;  3MHS C;  3B09 A;  4NXN O;  1YEW A;  3CP1 A;  2LQT A;  4GX1 A;  4MT8 A;  2Y69 C;  1YSC A;  1TVK A;  1YHQ V;  3KDR A;  5KHJ A;  3SYP A;  2NNU A;  3D36 A;  5B1A C;  4DK0 A;  3GB7 C;  3N2G A;  3A0H Z;  3K5O A;  1MZE A;  3THO A;  3HKC B;  4X1K B;  3HKE A;  2EIJ B;  5CA1 A;  5KHK A;  5KHI A;  1EM1 A;  4PA4 A;  3SYO A;  3UO2 A;  4X20 B;  4FJC C;  3RBZ A;  2Y4T A;  1QR9 A;  4WFH A;  3OTO B;  4DV0 B;  3BFR A;  3FB7 C;  5CA0 B;  4YJ2 A;  4NVP A;  2IJJ A;  1JA8 A;  2UXX A;  4I9Q A;  2BTQ A;  4YXW G;  2WLL B;  2YI8 A;  3GVM A;  5LHH A;  4UCU A;  4MVO A;  4NTW A;  5LHG A;  3QO5 A;  3OTO O;  3TXQ A;  3VQV A;  1H2N A;  4HNA A;  5LHI A;  1PV0 A;  4FM1 A;  4B7K A;  3BRC A;  4LFA O;  1M1K W;  2HLD G;  1WPB A;  2OYQ A;  3OM3 B;  3QVN A;  2L35 A;  4DV5 B;  1S0V A;  3CCR V; 
#chains in the Genus database with same CATH homology
 2GDS A;  3KKY A;  1WB7 A;  1AP6 A;  1I0H A;  1PL4 A;  4JYY A;  2CE4 A;  1EN6 A;  2AW9 A;  1B06 A;  4YIO A;  1MA1 A;  1JR9 A;  1EN5 A;  1GN6 A;  1IX9 A;  1BS3 A;  1GN4 A;  3IC9 A;  3MDS A;  2ADP A;  1XRE A;  1AVM A;  1P7G A;  4C7U A;  1ZTE A;  2QKA A;  4X9Q A;  1ZLZ A;  5AG2 A;  3KDR A;  1EN4 A;  4GUN A;  1VEW A;  3AK1 A;  1MMM A;  1ZSP A;  3CEI A;  1BT8 A;  4E4E A;  1QNM A;  3AK2 A;  1N0J A;  3EVK A;  1AR5 A;  1MSD A;  1LUV A;  2RCV A;  1EM1 A;  4JZG A;  1AR4 A;  4FFK A;  5A9G A;  1GN3 A;  1XUQ A;  1ZUQ A;  4F6E A;  4YIP A;  3TJT A;  1N0N A;  1BSM A;  1MNG A;  3K9S A;  3BFR A;  3DC5 A;  3C3S A;  3DC6 A;  1AP5 A;  1VAR A;  1XDC A;  2ADQ B;  4BR6 A;  1IDS A;  1PM9 A;  1JA8 A;  1Y67 A;  1KKC A;  1XIL A;  1I08 A;  2CDY A;  3OT7 A;  4JZ2 A;  1D5N A;  2P4K A;  3AK3 A;  1WB8 A;  3LSU A;  1SZX A;  1GN2 A;  2QKC A;  3QVN A;  3RN4 A;  1LUW A;  1IXB A;  3C3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...