3LSUA

Crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
204
structure length
190
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNADYFAIWNVVNWEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Crystal Structure of SOD2 from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
total genus 61
structure length 190
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3lsuA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3lsuA02
1IDSA 3C3TA 1EN6A 3QVNA 1QNMA 1SZXA 1BT8A 1VEWA 3DC6A 1MNGA 3RN4A 1XILA 4F6EA 1JA8A 3TJTA 1IXBA 1AP6A 3CEIA 2GDSA 1ZLZA 3MDSA 1P7GA 2AW9A 1N0NA 1AR5A 1WB7A 1PM9A 1I08A 1EN5A 1D5NA 3AK3A 2CE4A 1JR9A 5AG2A 4JZ2A 3AK2A 4YIOA 1LUWA 1ZTEA 1XDCA 2ADPA 4X9QA 1MA1A 2ADQB 1GN4A 2P4KA 1MMMA 1VARA 1KKCA 1BSMA 4YIPA 1IX9A 4JZGA 3AK1A 4BR6A 1B06A 1EM1A 3LSUA 3C3SA 1Y67A 5A9GA 1AR4A 3EVKA 1XUQA 1I0HA 1LUVA 1GN6A 4GUNA 3IC9A 1MSDA 1XREA 4JYYA 1ZUQA 4E4EA 1PL4A 3K9SA 2RCVA 1AP5A 1AVMA 1GN2A 1EN4A 3KKYA 4FFKA 4C7UA 1WB8A 1BS3A 3OT7A 1ZSPA 1N0JA 3DC5A 2QKCA 2CDYA 1GN3A 3BFRA 2QKAA
chains in the Genus database with same CATH superfamily
4AILC 3RYCA 1K5SA 1TGOA 4PDRA 1EN6A 2HJDA 2VQFB 1SZXA 5CBFA 1ZLZA 4DK1A 3P3PA 4X66O 2RN9A 3BRCA 5B1AC 5LXTA 4ZI7A 2ILMA 2UXDO 3G6BA 2JGDB 5LOVA 2XHBA 4JI4O 2CGNA 4B7KA 4WFHA 5LMUB 2CGOA 4O2BA 4X1YB 2VQEB 4B3TO 3FD9A 1TAEA 3H01A 2LW7A 1BQZA 2B5UA 4NXMB 2WLIB 5IWAO 1YJWV 3JSLA 1FXKA 1QVGU 1KMIZ 1MMMA 1BE3H 3S3WA 1KECA 2PY5A 1O9HA 4TUYA 2HLDG 4J7JA 1VQ8V 5FPOA 4CZZA 2LO1A 1R3JC 3CCEV 4O4JA 5IYDO 2QE7G 5LYJB 1K9MW 3OMIB 3HKDB 3ZMZA 5LA6B 3BABA 4O2AA 2KB1A 1FFXA 1R6TA 4LNUA 1TUBB 1P7BA 1GKFA 2WLMA 2Q7HA 3ZCCA 4EKWA 5LMUO 4ABMA 1GH6A 2B1IA 2PF4E 2VQEO 2CAZC 1Y76B 1QQCA 1NVPB 2DN9A 3T4ZA 3CXHF 3CPWU 3BHPA 4NXMO 2N05A 1HP8A 4DV2B 3K5LA 3M7MX 3AEIA 1VMGA 2IM9A 4LCUC 3VBBA 2RMKB 1KUQA 2ZXWB 2DQ0A 2JK5C 2A0LA 5LHGA 5FNVA 5IJ0B 1TVKA 4XDLA 3STZC 2Y69C 2JJ2G 4HNAA 2ZE6A 2QR4A 5KX5B 1JR9A 4MSWC 1DTOA 4PA3A 1L0LH 2CTPA 4DR7O 4TWKA 4H37A 1ZTEA 4P30A 3AG4B 1WPXA 2OT5A 4G28B 4BIOA 2ETNA 1RP3B 4DV2O 3CRCA 1VARA 4ZOLB 4PI2A 2P5OA 4BIUA 3JASB 3RYFB 1K4CC 3ZRWA 2ZNJA 3JAKA 4R6ZA 1JFFB 4J7KA 4RO2A 1US6A 1GK9A 2QDOA 3Q4HB 4BAYA 3ABMB 3P3NA 3QNEA 3RYIA 4QPJA 4YJ3A 2L35A 2DMXA 5B5EZ 3ICXA 3IC9A 3I56V 1RSOA 3RVYA 3N2GA 1ZL8B 1NT2B 1V9PA 3MHHC 3GWOA 3E22A 5H9CA 4I9WA 1NR7A 4Z2WA 5JQGA 1ZUQA 2UXCB 5H5NA 4JPRA 4WFEA 5HFMA 2WLHA 3CWBH 3BFRA 2HVKC 3X2QC 3C3TA 1NI8A 4MVMA 4JAVA 4LF7B 2Q4PA 2ZNIA 1OCZC 3VQYA 4AHCA 4XDKA 2DE0X 2Y0IA 4J41A 1N32B 2D3OW 1M5IA 4JI1B 2KG7A 1NKDA 5CA1B 3OGCC 3FAVB 2JVDA 2XOKG 1N36B 1N34B 1SESA 1LNQA 1EBOA 1KBHA 3ZEDA 4PDMA 2O57A 1WLEA 1YTFD 2UXCO 3CXCU 2HP8A 3ZBHA 1SS3A 1GN4A 2ARHA 4JYAB 1JJOA 3JAWB 1CP9A 1SQBH 2OTLV 3SPHA 3FB7C 4UV9A 3X2QB 2VS0A 2OTJV 1BHAA 1V55C 2BTOA 4I50A 1XMQB 1NZ6A 2IJJA 3L75H 1IBKO 1GRJA 3K58A 4ZHQA 3W7TA 2QM8A 1WAZA 3W7SA 3H9VA 2ZD9A 4I55B 4LF7O 2XT9A 3EXAA 3JD0A 5FLXN 1W2BU 4FZ1A 3OD4A 2PGGA 4DR2B 1I0HA 4CH6A 3THOA 4HYOA 4FLWA 1AILA 2GV9A 3RYCB 2RJZA 3PJSK 3G80A 1N32O 3E8HA 2LFSA 1F4NA 4GLXA 1YJ9V 5KMGA 2CH7A 4MVRA 2DWEC 3B40A 4F6RA 1N36O 1YTFB 1N34O 2FKXA 3PN1A 5LXTB 4ZI7B 1E1QG 4DO2A 2RCVA 4X20B 3W7XA 3LSSA 1N33B 2QM7A 3F7VC 3KKYA 4EFEA 1YJNV 3SJCC 3BCCH 3OT7A 4O2BB 4JYAO 4N23A 2CDYA 1V55B 3UQ8A 2VWKA 4LFAB 3ZN0A 2WLIA 1XL4A 3UO2A 1XMQO 5B3SC 4AI8A 3U11A 2YI8A 2F66C 4Q20A 4NTXA 3OGIB 3B2EE 4JTAB 1FXKB 2GDSA 1PM9A 4DR2O 4MVOA 5IYBO 4TUYB 1FPOA 2E76B 4O4JB 2WLNA 4RQFA 4ZBMA 2GHYA 5KUKA 4MVSA 4O2AB 3APQA 3MHSC 4YIOA 4ICGA 5EC1C 1LUWA 3VOUA 1FFXB 4LNUB 4X65B 3ASNB 3J81N 5KAIZ 4H44B 1QHTA 3AG3B 2ZDIA 1U97A 4J10A 1DF5A 2ADQB 1N33O 1Y76A 2HG5C 2Q67A 2EBOA 2JIZG 4MTXA 1YHQV 2G38A 2K9PA 1JMKC 1K8AW 4LFAO 1RPOA 4BR6A 3NXSA 4U3FH 2R72A 4U7OA 2ZIOA 4FFBA 3OE7G 5B1OA 5A9GA 3QO8A 3E89A 3OMAB 1HWYA 5EIBC 1S5JA 1K4DC 5LGUA 5EZYA 5L3GA 1XHZA 4G2KA 2YEVA 1VIBA 1K33A 4OXSA 1DLBA 3DGEA 4JYBA 5FNVB 1NS1A 1D2DA 5BZBA 4OPAA 1I5YA 1OHHG 3BA8A 4NR1A 4BW5A 4WFGA 3JYCA 4X65O 4HNAB 1SKVA 5EBLC 1KC8W 2HR3A 1VQKV 2QKCA 4FMTA 2OYQA 2H94A 4I5SA 3W7WA 4P2ZA 3TETA 1QNMA 1MZFA 1GM7A 1XNRB 1AI6A 1MABG 3DC6A 3R66A 3HKEA 5B66Z 5DM6V 5BMVB 4K8XA 1AP6A 3D36A 2W6IG 1IZ3A 3T1HB 4TSFG 1P4RA 1SQGA 3EHBB 4DR4B 4UUJC 3A0RA 5L3EA 4FLYA 1Q6UA 4TV8A 2F4VB 3AG2B 4UFZA 4J80A 3OTFA 4LP8A 1E1RG 5EK0A 4F4LA 3SDLA 2KQXA 4WCEV 1Q5OA 3RYIB 2IU3A 5EYPA 3AK2A 3A0HZ 1H2NA 4YJ3B 1W59A 3K3WA 4X9QA 3VQXA 1F7YA 1BGYH 1RSOB 2P4KA 3E22B 4NVPA 2QJ1A 5JQGB 1MSWD 3SYAA 4H33A 1G8MA 1H2SB 4O4IA 2E74B 1CPYA 5E79Z 1EM1A 5KA6A 1XNRO 1M57B 2BOBC 1XUQA 3T1YB 5IY5B 1Q6IA 1PD3A 3U0ZA 3WG7C 3T1HO 4HAMA 4DR4O 1XREA 2XTAA 1VQPV 5LHHA 2F4VO 1YXBA 3BAAA 3ETEA 3ZS8C 3D3QA 3ZHVA 2DYRB 1Y66A 2PUSA 1AP5A 1YITV 2KG7B 3SYPA 1GN2A 4FFKA 3LNMB 1WB8A 4FIPC 5CN0A 1BS3A 1ROPA 1WJZA 2M7WA 5CBGA 3SPJA 3STLC 1W0JG 4MVZA 2QWOB 3ABKB 4FLZA 1K73W 1HNZB 4X88A 1H38A 3JAWA 2OIEA 4AQYB 1VP7A 2Z3YA 2XAFA 2MK3A 3KCXA 3S3XA 4LH6A 3MDSA 1QLNA 1N0NA 4QNHB 4I50B 3T1YO 1AI5A 4ZHQB 4DV7B 2B1GA 1JOYA 1WP7A 1SZTA 4ZIBA 5KLVH 4IHJB 1XHXA 2PTMA 4FVMA 5JH7A 4NYKA 5KHGA 1VF6A 5D5QA 5KMGB 2CH7B 1K34A 2ZCEA 3EFFK 2ITDC 2YS8A 1EZJA 4X20A 3TK1A 1BSMA 4FJCC 2RQ6A 3ZMTA 4F6RB 4XDJA 4JZGA 3JCZA 1HNZO 3LSUA 3BVOA 4AQYO 3TGUH 4DUYB 3C3SA 3JD1A 5GW7A 3EVKA 4UB8Z 4WBNA 2A7WA 2AZ0A 4JTCB 2X6BA 4BW9A 5KHIA 3RFRA 1FKAO 2IJIA 3OR6C 2BCCH 4DV7O 3QG5A 2UU9B 1B3QA 2CTRA 1LR1A 1NH2D 3FFQA 2ZQMA 1IURA 2ZXWC 1L0NH 3SPCA 4IIJA 4JI5B 1IBLB 3T2MA 1E79G 4JTDB 5BR8B 1Y6XA 4UCVA 2IU0A 3SPGA 2BE3A 4KXRA 3VQWA 1M9NA 4ASUG 3RVZA 1NJIW 4LR3A 1WNSA 1H2GA 1H2KA 2K1EA 2FYUH 2X0LA 2XNDG 4DR7B 2QA4V 2GUZA 4W4KA 1SQPH 1IBMB 1IXBA 4DUYO 3L72H 2XAQA 1HW7A 1R1BA 4LBEC 3AG4C 2CK3G 4DV4B 3HB3B 5GONA 2LQTA 5IE9A 2Y4TA 5JJEB 4Z1MG 2QWRB 4FFBB 2CE4A 3RYHA 2W6JG 3HPLC 2UU9O 3ABLB 4R7CA 5AG2A 1NU1H 1Q43A 3LSQA 4UVBA 3C90A 5EZYB 2ADPA 4QPKA 3W7UA 4P9PA 1IBLO 4JI5O 3WB1A 2YEVB 3ABMC 5BR8O 4I4TA 1BHBA 3J80N 3B8MA 3WB2A 4RUFA 4YXWG 2ZR2A 1NTZH 4JYCA 5H6RA 2N74A 1I94B 5EC2C 4CH5A 5DECA 2WWWA 2Q6AA 2QTSA 3CCLV 1FJGB 1IBMO 3SYCA 1H2MA 1SETA 5H2FZ 4YJ2A 1J5EB 5BXZA 5BMVA 1QCEA 3K06A 4DV4O 3KDRA 2ZINA 3KZIZ 2HJFC 3HKEB 1KD1W 1THZA 3JCUZ 4D7TA 5JWPA 2JDIG 3E83A 3GWKC 4MS2A 3CHXA 1KP2A 2P6JA 1QR8A 4TV8B 1URFA 4GX0A 1Q6HA 3A8TA 3T1CA 2EILB 4O4LA 3OR7C 2W0FC 5IT9N 5EYPB 2UXBB 4B08A 2RNBA 3BA9A 2NLJC 1JCHA 4IL6Z 1I94O 4NTWA 1P84F 4W4LA 3CCSV 3OAAG 4OX9O 1JA8A 4B7EA 1PKXA 1SC5B 2EZOA 1FJGO 4KUMA 3ZJZA 3ETGA 1J5EO 1UPGA 4O4IB 4DV0B 4UVAA 2M6YA 3K9AA 5E1AC 3SPIA 1H8HG 1IBKB 3JSNA 4Z1VA 2EZPA 2P90A 4FPPA 2OIGA 1MA1A 2DOSA 1M56C 3BY6A 3IC7A 1CXZB 5EBWC 3FB5C 4GKKB 4LF9O 4GZRB 3CRRA 2UXBO 1VQ7V 1G6UA 1FYJA 3A2FA 2D2CB 2EINB 4U3JA 3H1IH 3H1KH 4JF3A 2LJ2A 4PA7A 2ATKC 4DV0O 4DRXA 2YICA 1PNLA 2GTAA 1XI1A 4GX5A 1KKDA 2QKSA 3LUTB 4PJ0Z 4UCTA 1AVMA 1M56B 1FXKC 4IHJA 1EN4A 4DR3O 2R9RB 2E5LB 1VF5B 4GKKO 3BEHA 5L3BA 5JH7B 2F95B 1HNXO 1CEZA 4MW8A 3JATA 1ORQC 1Q86W 1XILA 2EIKB 1OV9A 3QTCA 4LF4B 1S5LZ 4LF8B 1UFIA 4I9QA 4UCUA 4K0KB 1AR5A 3ASNC 1XQ8A 3CYOA 3CC7V 1VQMV 2Q8VA 3AG3C 1GMGA 1YCIA 4CS3A 3E8FA 4I0XA 3NR7A 4DXWA 1BZKA 3SJBC 4UCRA 4WBNB 4UXNA 4DV3B 3CRMA 1AJNA 3SR2C 4CH4A 4TQDA 2BTQB 4OGQB 4TOIA 1L1FA 3CMAV 2Y48A 4RQEA 1F4MA 1S5HC 4HZ3A 2N04A 2E5LO 5LP6A 4X64B 5JVDA 4IIJB 3E86A 1VQLV 3UCSC 2RDCA 1R3KC 3K0DA 5J2TA 4MTOA 2V1DA 2OCCB 3CRQA 4LF6B 4QIWF 4LF4O 1AR4A 1Y4MA 2DW4A 4LF8O 2JEUA 4B3RB 4GKJB 4WFBV 4K0KO 4D7SA 2JS3A 1MZEA 4MTGA 2YXYA 1Q3EA 2GUZB 1PV0A 4JI0B 1WA8A 3QO5A 3IAYA 2V7QG 1OCOC 5KHHA 1J95A 3U10A 4DV3O 5GONB 1SA0A 3K9SA 4P9OA 3QO7A 3AG1C 3B8NA 3RYHB 1R6NA 1V54B 1HNWO 4DV5B 3DC5A 3P30A 4X64O 2EX3A 4DW1A 3CS5A 3JD4A 3AG2C 1AROP 1MNGA 2E3CA 3OFNG 3CP1A 3H1LH 3OTOB 2AZ2A 2JRIA 4NB5A 4I4TB 2WPDG 4LF6O 3CEIA 3CD6V 5GTIZ 2H8PC 5EIBD 5IDJA 2P06A 3CC2V 4O4HA 4B3RO 4GKJO 1M1KW 3AG7A 2A3QA 1DF4A 5CMUA 1BQ0A 1OJHA 1H8EG 3K0GA 4LFCB 3E8BA 1FAFA 1F23A 2WA4A 1OCOB 4LWSA 4JI0O 3UO3A 4YJ2B 3ML0A 3OEEG 4MTFA 3UM7A 5J9PC 3JALA 4PI0A 1M57C 3AG1B 5KAFZ 4DV1B 2UUAB 2YIAA 5EBMC 5C93A 5IY5C 4TV9A 2DQ3A 2LFRA 2YI9A 4DV5O 4YIPA 4BWAA 3ETDA 1S77D 1ZAUA 2XASA 5CBHA 2OWOA 1K97A 3WB0A 5FPRA 3ZX6A 3OTOO 2QEXV 2DYRC 4O4LB 2Q0OC 1KQSU 1BMFG 1LUVA 2HHHB 1OCRB 1PP9H 2UXXA 2ZT9B 1FXHA 4PA9A 1QR9A 1R3LC 3A0BZ 4MT8A 4TT3G 1JNBA 3ABKC 4LFCO 1G1XB 3N2KA 1R73A 1W0KG 1M90W 4J11A 3ZMUA 1R6KA 4DV1O 2UUAO 2JEXA 2DJVA 4QE7A 3OM3B 3ZMSA 3I5DA 5KHJA 1B6QA 3FB6C 1XMOB 1N0JA 2HFEC 3CCJV 2A79B 2P22C 4FK5C 1YDXA 2ZE8A 3O9OA 3G67A 3GB7C 1BT8A 1VEWA 1YVWA 1YI2V 3IGAC 3TXQA 4ZKIA 3B4SA 4IYIA 5CA3A 3LDDA 1FS0G 1YF2A 3ZRXA 3RBZA 1P49A 3CRAA 2DWDC 4UV8A 3H1JH 4QE9A 4J9YB 4JV5B 1KB9F 5ITZA 2HHHO 2XAJA 4U3JB 4X1KA 3O65A 1QBZA 3ZIAG 2PI4A 3L73H 4DRXB 4OPHA 2A9HA 2NR5A 4UVCA 4R50A 4DV6B 3KG2A 3SJAC 3CSXA 3DTUB 1S0VA 3CB2A 1XMOO 1HR0B 2WSSG 2F23A 3F5WC 3RT3C 3G4SV 3ZN1A 5CA0A 1ZX3A 4X1IA 3OEHG 4PA4A 1COWG 1L8DA 2ZKOA 3VQVA 5LMNO 2IW5A 3H1HH 2H3OA 3P32A 2GBOA 1R3IC 3HR0A 3D8CA 3JATB 4RUEA 4JV5O 4LFBB 1XBLA 4L87A 4N21A 2IH3C 2LGQA 2Y4UA 5L3CA 2WAMA 2ZDIC 1NBMG 1Q7YW 2QWNB 4JI6B 5K1PA 4I0XB 1QLEB 2Q68A 1EFRG 4KHPB 4JASA 4DV6O 2BTQA 1AJQA 2YXLA 3TCUA 1FXVA 1HR0O 4NXNB 3ABTA 1NQTA 4LF5B 1ENVA 2ZIMA 3G6EV 3ABLC 2P67A 2X7RB 1NVPD 3DXRA 3ABUA 2ITCC 3LDEA 3WU2Z 5LP6B 1PPJH 5JVDB 1WB7A 3L70H 1JQ0A 1RM1B 1VQ9V 5DN6G 4EFBA 4X62B 2NNUA 4DR5B 4B3MB 2FTKA 5J2TB 1SQFA 4JI7B 3RWRD 1KU9A 4LFBO 1O9GA 4EB6A 3K04A 4CBCA 2VQFO 4FM0A 1VQ5V 1H5WA 4WF9V 1WP8A 4FM1A 5B1AB 4GX2A 3DSQA 2KSDA 2C2AA 1F51A 2IJKA 2JGUA 4JI6O 4YHHB 3F7YC 1WA8B 2QWPB 4KHPO 1NH2B 3F5TA 3E2EA 4CC6A 4FLUA 1SA0B 4NXNO 4MVQA 1AR1B 2JS5A 3K5NA 3D36C 2VRZA 4G27B 3L74H 4JAAA 2XAHA 2HKOA 3LDCA 1FFTB 5JCOA 4LF5O 2BSKA 1H2LA 4PA6A 2PI5A 5B1BC 5L3FA 1JJ2U 1AI7A 4X62O 3ASOC 2YIBD 4DR5O 4B3MO 2Q73A 2EILC 3B77A 2YDEA 3APOA 4K8ZA 3LNNA 4JI7O 4E2LA 2AHZA 3HKCA 4O4HB 1PL4A 4OX9B 3MD0A 3FKSG 3CJHB 5LGNA 2E75B 1QVFU 5H6QA 5A2QN 4L8JA 4K35A 4TQFA 4Q6GA 3G71V 1Y74B 2XAGA 4YHHO 4LC1A 1IJGA 4LWSB 4PDVA 1NTMH 1U96A 2QKAA 1IDSA 2FL4A 3JALB 2R70A 4QJFB 4B3SB 3UKMA 3M8AA 5GTHZ 1X59A 4CC5A 2EIJC 4TV9B 1XNQB 5B1BB 3I55V 3ASOB 3K08A 1I08A 1EN5A 1K7DA 3CCVV 2YIDA 4LF9B 1PNMA 2Y0PA 1B04A 2FMLA 5J2UA 3RW0A 4K3AA 4KP4A 2V4DA 4JZ2A 5IJ9B 4RAIA 2Q7EA 4DR6B 3KCYA 4D6TH 1XDCA 4WFAV 2Y69B 1AI4A 2EINC 1RPRA 1S76D 4GT1A 3ETQA 2Q7GA 1JX9A 3HKBA 4JI2B 2WLJA 5FL7G 4FLTA 3N2KB 1S72V 1I7FA 4JI3B 5IYZA 2WLLA 2ZE7A 4LH7A 2EIJB 4B3SO 1Y67A 4X89A 4UCOA 3SJQC 4DR3B 3CC4V 1XNQO 1VQ4V 4X8AA 2EIMC 4PV1B 4DUZB 4J9ZB 1GM8A 4DW0A 1HNXB 1ZWIC 1FD9A 2CUGA 2L6LA 1QU7A 4JYYA 4MW3A 5CB4A 1VF6C 2EIKC 5ITZB 4DR6O 2P4VA 3JARA 1YZBA 4JGSA 2LW1A 5LGTA 2GSMB 3MAQA 4X1KB 3JD2A 2X6AA 1AB3A 4JI2O 4QGPA 5C8YA 4J42A 3CCMV 3E35A 2Z0AA 1S3JA 4WFFA 4GX1A 4F6EA 4JI3O 2R9IA 2QM4A 3OMNB 3CE2A 1P7GA 3L9DA 1DK1A 1N4CA 2EIMB 1KP3A 4KFMA 2EULA 5JJJB 4A5UB 1MG1A 4PDLA 3SGIA 3UT5B 5IYCO 2YC0A 5CA0B 3CCUV 4HBNA 4DUZO 1PL0A 2PZSA 1D5NA 4X1IB 4RWUA 1OCZB 2ZM6B 4GCZA 2Q69A 2F93B 2B9ZA 3IFXA 2QWQB 4EEQA 2OCCC 1SERA 4UCSA 3IJ4A 2ZE5A 2UXNA 3ZHSA 2X6CA 1M4UA 4IT5A 1JPXA 2GTSA 4JI1O 5KHKA 2F43G 1K3EA 2ODMA 3JAMN 3TXSA 1NR1A 3FYIB 1TUEB 1D5AA 3K5OA 2JGDA 1B06A 4NKGB 2QGNA 3ZRVA 4JI8B 4X1YA 5LOVB 1TA8A 3OUFA 3B09A 5F2VO 1HNWB 1V54C 5LHIA 3FB8C 3RGBA 4DK0A 3K57A 1GO3F 5JCOC 3DXRB 2WA3A 2WLKA 3D3IA 2ZM6O 3J7AU 4E4EA 1SQQH 2AXTZ 2AGAA 1N8RW 2DYSC 4H13B 5LYJA 2ZR3A 4IYHA 4EB6B 1YSCA 3HKDA 2IH1C 5LA6A 1BL8A 4CH3A 1M93A 1GN3A 3K5MA 2LP7A 5L3DA 1IXMA 3QVNA 3ZHTA 1TUBA 3M99B 5KUMA 1HDJA 2JJ1G 3TJTA 5LBQA 4JI8O 1EZVH 3K79A 1KYOF 4PHZA 4DYLA 3FX7A 4YY3B 2PYJA 1XL6A 1Z2GA 2OCHA 1RFYA 1A32A 2XUMA 4FZ0A 3BPZA 1FOUA 3N27A 5B3SB 4H0LB 2P7TC 1UJWB 2BSKB 4IGGA 2NN4A 4J7ZA 4PELA 1K92A 3L71H 3CX5F 2AHYA 3SYQA 1IVSA 1Z5WA 4U7NA 2DYSB 2IBZH 4JAUA 2BOCC 1Q82W 5IJ0A 3SYOA 3CJHA 3HKCB 1OCRC 1IX9A 2UUBB 4NTYA 5D5PA 1TVKB 3AK1A 1Y74A 2LGWA 2YSUB 4XBFA 5KX5A 3CCRV 3OUSA 1Q81W 3CMEV 4YY3O 2EJ7A 5BY1A 1YEWA 2YIBA 1SRYA 4ZOLA 2Q5ZA 3JASA 3RYFA 4DR1B 1VF7A 2KKWA 1I5XA 2EJRA 1JFFA 5B1NA 2Z5UA 1OCCC 1AJPA 1Q8IA 3ZRWB 5J2UB 5IJ9A 2HVJC 2F1MA 5K1XA 3JAKB 1GAXA 3Q4HA 2W0XA 1GTOA 3CCQV 4PD4F 3OW2U 1XOUA 3ZHRA 2UUBO 1BCCH 3RN4A 3ZRSA 1ZL8A 4KL1A 4FLXA 2VWJA 4FLVA 4R8CA 4CS2A 2AW9A 3N2GB 2PYLA 3HKBB 2CTQA 5HFLA 2QSAA 5IYZB 5TISZ 2WLLB 1WPBA 3AK3A 2A06H 2UUCB 3WFVA 1WN7A 2HEPA 1VQOV 1SF9A 2YUAA 3ZMVA 4DR1O 5LMNB 1DGSA 1OCCB 5LL6Y 1X4TA 2MW2B 5KA5A 3K03A 1Z5VA 3ZHQA 5JJNB 1T5EA 2R9AA 1K5QA 1KKCA 2QTOA 1NTKH 4FM2A 5CB4B 1JVMA 1MOFA 2YXHA 3JARB 1OZ0A 5CA1A 1VQNV 3FAVA 1PNKA 1G4YB 4X66B 3ZHUA 1VQ6V 4GYCB 2FB5A 2UXDB 3K59A 1SQVH 5C8YB 1GN6A 4GUNA 1Q90D 4JI4B 1QLEC 3FYEB 3QF7A 3T4DA 1MSDA 1XEQA 4CS4A 2Q0AA 4BIZA 5DEDA 4B3TB 3UT5A 2UUCO 2IJHA 3E8GA 3JD3A 1YIJV 2Q9LA 2CTWA 4I7ZB 3WG7B 5IWAB 4I55A 4C7UA 4UB6Z 5LP6C 1GM9A 1ZSPA 1RM1C 3R65A 4MVUA 3GVMA 1SQXH
chains in the Genus database with same CATH topology
1IDSA 3C3TA 1EN6A 3QVNA 1QNMA 1SZXA 1BT8A 1VEWA 3DC6A 1MNGA 3RN4A 1XILA 4F6EA 1JA8A 3TJTA 1IXBA 1AP6A 3CEIA 2GDSA 1ZLZA 3MDSA 1P7GA 2AW9A 1N0NA 1AR5A 1WB7A 1PM9A 1I08A 1EN5A 1D5NA 3AK3A 2CE4A 1JR9A 5AG2A 4JZ2A 3AK2A 4YIOA 1LUWA 1ZTEA 1XDCA 2ADPA 4X9QA 1MA1A 2ADQB 1GN4A 2P4KA 1MMMA 1VARA 1KKCA 1BSMA 4YIPA 1IX9A 4JZGA 3AK1A 4BR6A 1B06A 1EM1A 3LSUA 3C3SA 1Y67A 5A9GA 1AR4A 3EVKA 1XUQA 1I0HA 1LUVA 1GN6A 4GUNA 3KDRA 3IC9A 1MSDA 1XREA 4JYYA 1ZUQA 4E4EA 1PL4A 3K9SA 2RCVA 1AP5A 1AVMA 1GN2A 1EN4A 3KKYA 4FFKA 4C7UA 1WB8A 1BS3A 3OT7A 1ZSPA 1N0JA 3DC5A 2QKCA 2CDYA 1GN3A 3BFRA 2QKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDS A;  3C3T A;  1EN6 A;  3QVN A;  1QNM A;  1SZX A;  1BT8 A;  1VEW A;  3DC6 A;  1MNG A;  3RN4 A;  1XIL A;  4F6E A;  1JA8 A;  3TJT A;  1IXB A;  1AP6 A;  3CEI A;  2GDS A;  1ZLZ A;  3MDS A;  1P7G A;  2AW9 A;  1N0N A;  1AR5 A;  1WB7 A;  1PM9 A;  1I08 A;  1EN5 A;  1D5N A;  3AK3 A;  2CE4 A;  1JR9 A;  5AG2 A;  4JZ2 A;  3AK2 A;  4YIO A;  1LUW A;  1ZTE A;  1XDC A;  2ADP A;  4X9Q A;  1MA1 A;  2ADQ B;  1GN4 A;  2P4K A;  1MMM A;  1VAR A;  1KKC A;  1BSM A;  4YIP A;  1IX9 A;  4JZG A;  3AK1 A;  4BR6 A;  1B06 A;  1EM1 A;  3LSU A;  3C3S A;  1Y67 A;  5A9G A;  1AR4 A;  3EVK A;  1XUQ A;  1I0H A;  1LUV A;  1GN6 A;  4GUN A;  3IC9 A;  1MSD A;  1XRE A;  4JYY A;  1ZUQ A;  4E4E A;  1PL4 A;  3K9S A;  2RCV A;  1AP5 A;  1AVM A;  1GN2 A;  1EN4 A;  3KKY A;  4FFK A;  4C7U A;  1WB8 A;  1BS3 A;  3OT7 A;  1ZSP A;  1N0J A;  3DC5 A;  2QKC A;  2CDY A;  1GN3 A;  3BFR A;  2QKA A; 
#chains in the Genus database with same CATH topology
 4AIL C;  3RYC A;  1K5S A;  1TGO A;  4PDR A;  1EN6 A;  2HJD A;  2VQF B;  1SZX A;  5CBF A;  1ZLZ A;  4DK1 A;  3P3P A;  4X66 O;  2RN9 A;  3BRC A;  5B1A C;  5LXT A;  4ZI7 A;  2ILM A;  2UXD O;  3G6B A;  2JGD B;  5LOV A;  2XHB A;  4JI4 O;  2CGN A;  4B7K A;  4WFH A;  5LMU B;  2CGO A;  4O2B A;  4X1Y B;  2VQE B;  4B3T O;  3FD9 A;  1TAE A;  3H01 A;  2LW7 A;  1BQZ A;  2B5U A;  4NXM B;  2WLI B;  5IWA O;  1YJW V;  3JSL A;  1FXK A;  1QVG U;  1KMI Z;  1MMM A;  1BE3 H;  3S3W A;  1KEC A;  2PY5 A;  1O9H A;  4TUY A;  2HLD G;  4J7J A;  1VQ8 V;  5FPO A;  4CZZ A;  2LO1 A;  1R3J C;  3CCE V;  4O4J A;  5IYD O;  2QE7 G;  5LYJ B;  1K9M W;  3OMI B;  3HKD B;  3ZMZ A;  5LA6 B;  3BAB A;  4O2A A;  2KB1 A;  1FFX A;  1R6T A;  4LNU A;  1TUB B;  1P7B A;  1GKF A;  2WLM A;  2Q7H A;  3ZCC A;  4EKW A;  5LMU O;  4ABM A;  1GH6 A;  2B1I A;  2PF4 E;  2VQE O;  2CAZ C;  1Y76 B;  1QQC A;  1NVP B;  2DN9 A;  3T4Z A;  3CXH F;  3CPW U;  3BHP A;  4NXM O;  2N05 A;  1HP8 A;  4DV2 B;  3K5L A;  3M7M X;  3AEI A;  1VMG A;  2IM9 A;  4LCU C;  3VBB A;  2RMK B;  1KUQ A;  2ZXW B;  2DQ0 A;  2JK5 C;  2A0L A;  5LHG A;  5FNV A;  5IJ0 B;  1TVK A;  4XDL A;  3STZ C;  2Y69 C;  2JJ2 G;  4HNA A;  2ZE6 A;  2QR4 A;  5KX5 B;  1JR9 A;  4MSW C;  1DTO A;  4PA3 A;  1L0L H;  2CTP A;  4DR7 O;  4TWK A;  4H37 A;  1ZTE A;  4P30 A;  3AG4 B;  1WPX A;  2OT5 A;  4G28 B;  4BIO A;  2ETN A;  1RP3 B;  4DV2 O;  3CRC A;  1VAR A;  4ZOL B;  4PI2 A;  2P5O A;  4BIU A;  3JAS B;  3RYF B;  1K4C C;  3ZRW A;  2ZNJ A;  3JAK A;  4R6Z A;  1JFF B;  4J7K A;  4RO2 A;  1US6 A;  1GK9 A;  2QDO A;  3Q4H B;  4BAY A;  3ABM B;  3P3N A;  3QNE A;  3RYI A;  4QPJ A;  4YJ3 A;  2L35 A;  2DMX A;  5B5E Z;  3ICX A;  3IC9 A;  3I56 V;  1RSO A;  3RVY A;  3N2G A;  1ZL8 B;  1NT2 B;  1V9P A;  3MHH C;  3GWO A;  3E22 A;  5H9C A;  4I9W A;  1NR7 A;  4Z2W A;  5JQG A;  1ZUQ A;  2UXC B;  5H5N A;  4JPR A;  4WFE A;  5HFM A;  2WLH A;  3CWB H;  3BFR A;  2HVK C;  3X2Q C;  3C3T A;  1NI8 A;  4MVM A;  4JAV A;  4LF7 B;  2Q4P A;  2ZNI A;  1OCZ C;  3VQY A;  4AHC A;  4XDK A;  2DE0 X;  2Y0I A;  4J41 A;  1N32 B;  2D3O W;  1M5I A;  4JI1 B;  2KG7 A;  1NKD A;  5CA1 B;  3OGC C;  3FAV B;  2JVD A;  2XOK G;  1N36 B;  1N34 B;  1SES A;  1LNQ A;  1EBO A;  1KBH A;  3ZED A;  4PDM A;  2O57 A;  1WLE A;  1YTF D;  2UXC O;  3CXC U;  2HP8 A;  3ZBH A;  1SS3 A;  1GN4 A;  2ARH A;  4JYA B;  1JJO A;  3JAW B;  1CP9 A;  1SQB H;  2OTL V;  3SPH A;  3FB7 C;  4UV9 A;  3X2Q B;  2VS0 A;  2OTJ V;  1BHA A;  1V55 C;  2BTO A;  4I50 A;  1XMQ B;  1NZ6 A;  2IJJ A;  3L75 H;  1IBK O;  1GRJ A;  3K58 A;  4ZHQ A;  3W7T A;  2QM8 A;  1WAZ A;  3W7S A;  3H9V A;  2ZD9 A;  4I55 B;  4LF7 O;  2XT9 A;  3EXA A;  3JD0 A;  5FLX N;  1W2B U;  4FZ1 A;  3OD4 A;  2PGG A;  4DR2 B;  1I0H A;  4CH6 A;  3THO A;  4HYO A;  4FLW A;  1AIL A;  2GV9 A;  3RYC B;  2RJZ A;  3PJS K;  3G80 A;  1N32 O;  3E8H A;  2LFS A;  1F4N A;  4GLX A;  1YJ9 V;  5KMG A;  2CH7 A;  4MVR A;  2DWE C;  3B40 A;  4F6R A;  1N36 O;  1YTF B;  1N34 O;  2FKX A;  3PN1 A;  5LXT B;  4ZI7 B;  1E1Q G;  4DO2 A;  2RCV A;  4X20 B;  3W7X A;  3LSS A;  1N33 B;  2QM7 A;  3F7V C;  3KKY A;  4EFE A;  1YJN V;  3SJC C;  3BCC H;  3OT7 A;  4O2B B;  4JYA O;  4N23 A;  2CDY A;  1V55 B;  3UQ8 A;  2VWK A;  4LFA B;  3ZN0 A;  2WLI A;  1XL4 A;  3UO2 A;  1XMQ O;  5B3S C;  4AI8 A;  3U11 A;  2YI8 A;  2F66 C;  4Q20 A;  4NTX A;  3OGI B;  3B2E E;  4JTA B;  1FXK B;  2GDS A;  1PM9 A;  4DR2 O;  4MVO A;  5IYB O;  4TUY B;  1FPO A;  2E76 B;  4O4J B;  2WLN A;  4RQF A;  4ZBM A;  2GHY A;  5KUK A;  4MVS A;  4O2A B;  3APQ A;  3MHS C;  4YIO A;  4ICG A;  5EC1 C;  1LUW A;  3VOU A;  1FFX B;  4LNU B;  4X65 B;  3ASN B;  3J81 N;  5KAI Z;  4H44 B;  1QHT A;  3AG3 B;  2ZDI A;  1U97 A;  4J10 A;  1DF5 A;  2ADQ B;  1N33 O;  1Y76 A;  2HG5 C;  2Q67 A;  2EBO A;  2JIZ G;  4MTX A;  1YHQ V;  2G38 A;  2K9P A;  1JMK C;  1K8A W;  4LFA O;  1RPO A;  4BR6 A;  3NXS A;  4U3F H;  2R72 A;  4U7O A;  2ZIO A;  4FFB A;  3OE7 G;  5B1O A;  5A9G A;  3QO8 A;  3E89 A;  3OMA B;  1HWY A;  5EIB C;  1S5J A;  1K4D C;  5LGU A;  5EZY A;  5L3G A;  1XHZ A;  4G2K A;  2YEV A;  1VIB A;  1K33 A;  4OXS A;  1DLB A;  3DGE A;  4JYB A;  5FNV B;  1NS1 A;  1D2D A;  5BZB A;  4OPA A;  1I5Y A;  1OHH G;  3BA8 A;  4NR1 A;  4BW5 A;  4WFG A;  3JYC A;  4X65 O;  4HNA B;  1SKV A;  5EBL C;  1KC8 W;  2HR3 A;  1VQK V;  2QKC A;  4FMT A;  2OYQ A;  2H94 A;  4I5S A;  3W7W A;  4P2Z A;  3TET A;  1QNM A;  1MZF A;  1GM7 A;  1XNR B;  1AI6 A;  1MAB G;  3DC6 A;  3R66 A;  3HKE A;  5B66 Z;  5DM6 V;  5BMV B;  4K8X A;  1AP6 A;  3D36 A;  2W6I G;  1IZ3 A;  3T1H B;  4TSF G;  1P4R A;  1SQG A;  3EHB B;  4DR4 B;  4UUJ C;  3A0R A;  5L3E A;  4FLY A;  1Q6U A;  4TV8 A;  2F4V B;  3AG2 B;  4UFZ A;  4J80 A;  3OTF A;  4LP8 A;  1E1R G;  5EK0 A;  4F4L A;  3SDL A;  2KQX A;  4WCE V;  1Q5O A;  3RYI B;  2IU3 A;  5EYP A;  3AK2 A;  3A0H Z;  1H2N A;  4YJ3 B;  1W59 A;  3K3W A;  4X9Q A;  3VQX A;  1F7Y A;  1BGY H;  1RSO B;  2P4K A;  3E22 B;  4NVP A;  2QJ1 A;  5JQG B;  1MSW D;  3SYA A;  4H33 A;  1G8M A;  1H2S B;  4O4I A;  2E74 B;  1CPY A;  5E79 Z;  1EM1 A;  5KA6 A;  1XNR O;  1M57 B;  2BOB C;  1XUQ A;  3T1Y B;  5IY5 B;  1Q6I A;  1PD3 A;  3U0Z A;  3WG7 C;  3T1H O;  4HAM A;  4DR4 O;  1XRE A;  2XTA A;  1VQP V;  5LHH A;  2F4V O;  1YXB A;  3BAA A;  3ETE A;  3ZS8 C;  3D3Q A;  3ZHV A;  2DYR B;  1Y66 A;  2PUS A;  1AP5 A;  1YIT V;  2KG7 B;  3SYP A;  1GN2 A;  4FFK A;  3LNM B;  1WB8 A;  4FIP C;  5CN0 A;  1BS3 A;  1ROP A;  1WJZ A;  2M7W A;  5CBG A;  3SPJ A;  3STL C;  1W0J G;  4MVZ A;  2QWO B;  3ABK B;  4FLZ A;  1K73 W;  1HNZ B;  4X88 A;  1H38 A;  3JAW A;  2OIE A;  4AQY B;  1VP7 A;  2Z3Y A;  2XAF A;  2MK3 A;  3KCX A;  3S3X A;  4LH6 A;  3MDS A;  1QLN A;  1N0N A;  4QNH B;  4I50 B;  3T1Y O;  1AI5 A;  4ZHQ B;  4DV7 B;  2B1G A;  1JOY A;  1WP7 A;  1SZT A;  4ZIB A;  5KLV H;  4IHJ B;  1XHX A;  2PTM A;  4FVM A;  5JH7 A;  4NYK A;  5KHG A;  1VF6 A;  5D5Q A;  5KMG B;  2CH7 B;  1K34 A;  2ZCE A;  3EFF K;  2ITD C;  2YS8 A;  1EZJ A;  4X20 A;  3TK1 A;  1BSM A;  4FJC C;  2RQ6 A;  3ZMT A;  4F6R B;  4XDJ A;  4JZG A;  3JCZ A;  1HNZ O;  3LSU A;  3BVO A;  4AQY O;  3TGU H;  4DUY B;  3C3S A;  3JD1 A;  5GW7 A;  3EVK A;  4UB8 Z;  4WBN A;  2A7W A;  2AZ0 A;  4JTC B;  2X6B A;  4BW9 A;  5KHI A;  3RFR A;  1FKA O;  2IJI A;  3OR6 C;  2BCC H;  4DV7 O;  3QG5 A;  2UU9 B;  1B3Q A;  2CTR A;  1LR1 A;  1NH2 D;  3FFQ A;  2ZQM A;  1IUR A;  2ZXW C;  1L0N H;  3SPC A;  4IIJ A;  4JI5 B;  1IBL B;  3T2M A;  1E79 G;  4JTD B;  5BR8 B;  1Y6X A;  4UCV A;  2IU0 A;  3SPG A;  2BE3 A;  4KXR A;  3VQW A;  1M9N A;  4ASU G;  3RVZ A;  1NJI W;  4LR3 A;  1WNS A;  1H2G A;  1H2K A;  2K1E A;  2FYU H;  2X0L A;  2XND G;  4DR7 B;  2QA4 V;  2GUZ A;  4W4K A;  1SQP H;  1IBM B;  1IXB A;  4DUY O;  3L72 H;  2XAQ A;  1HW7 A;  1R1B A;  4LBE C;  3AG4 C;  2CK3 G;  4DV4 B;  3HB3 B;  5GON A;  2LQT A;  5IE9 A;  2Y4T A;  5JJE B;  4Z1M G;  2QWR B;  4FFB B;  2CE4 A;  3RYH A;  2W6J G;  3HPL C;  2UU9 O;  3ABL B;  4R7C A;  5AG2 A;  1NU1 H;  1Q43 A;  3LSQ A;  4UVB A;  3C90 A;  5EZY B;  2ADP A;  4QPK A;  3W7U A;  4P9P A;  1IBL O;  4JI5 O;  3WB1 A;  2YEV B;  3ABM C;  5BR8 O;  4I4T A;  1BHB A;  3J80 N;  3B8M A;  3WB2 A;  4RUF A;  4YXW G;  2ZR2 A;  1NTZ H;  4JYC A;  5H6R A;  2N74 A;  1I94 B;  5EC2 C;  4CH5 A;  5DEC A;  2WWW A;  2Q6A A;  2QTS A;  3CCL V;  1FJG B;  1IBM O;  3SYC A;  1H2M A;  1SET A;  5H2F Z;  4YJ2 A;  1J5E B;  5BXZ A;  5BMV A;  1QCE A;  3K06 A;  4DV4 O;  3KDR A;  2ZIN A;  3KZI Z;  2HJF C;  3HKE B;  1KD1 W;  1THZ A;  3JCU Z;  4D7T A;  5JWP A;  2JDI G;  3E83 A;  3GWK C;  4MS2 A;  3CHX A;  1KP2 A;  2P6J A;  1QR8 A;  4TV8 B;  1URF A;  4GX0 A;  1Q6H A;  3A8T A;  3T1C A;  2EIL B;  4O4L A;  3OR7 C;  2W0F C;  5IT9 N;  5EYP B;  2UXB B;  4B08 A;  2RNB A;  3BA9 A;  2NLJ C;  1JCH A;  4IL6 Z;  1I94 O;  4NTW A;  1P84 F;  4W4L A;  3CCS V;  3OAA G;  4OX9 O;  1JA8 A;  4B7E A;  1PKX A;  1SC5 B;  2EZO A;  1FJG O;  4KUM A;  3ZJZ A;  3ETG A;  1J5E O;  1UPG A;  4O4I B;  4DV0 B;  4UVA A;  2M6Y A;  3K9A A;  5E1A C;  3SPI A;  1H8H G;  1IBK B;  3JSN A;  4Z1V A;  2EZP A;  2P90 A;  4FPP A;  2OIG A;  1MA1 A;  2DOS A;  1M56 C;  3BY6 A;  3IC7 A;  1CXZ B;  5EBW C;  3FB5 C;  4GKK B;  4LF9 O;  4GZR B;  3CRR A;  2UXB O;  1VQ7 V;  1G6U A;  1FYJ A;  3A2F A;  2D2C B;  2EIN B;  4U3J A;  3H1I H;  3H1K H;  4JF3 A;  2LJ2 A;  4PA7 A;  2ATK C;  4DV0 O;  4DRX A;  2YIC A;  1PNL A;  2GTA A;  1XI1 A;  4GX5 A;  1KKD A;  2QKS A;  3LUT B;  4PJ0 Z;  4UCT A;  1AVM A;  1M56 B;  1FXK C;  4IHJ A;  1EN4 A;  4DR3 O;  2R9R B;  2E5L B;  1VF5 B;  4GKK O;  3BEH A;  5L3B A;  5JH7 B;  2F95 B;  1HNX O;  1CEZ A;  4MW8 A;  3JAT A;  1ORQ C;  1Q86 W;  1XIL A;  2EIK B;  1OV9 A;  3QTC A;  4LF4 B;  1S5L Z;  4LF8 B;  1UFI A;  4I9Q A;  4UCU A;  4K0K B;  1AR5 A;  3ASN C;  1XQ8 A;  3CYO A;  3CC7 V;  1VQM V;  2Q8V A;  3AG3 C;  1GMG A;  1YCI A;  4CS3 A;  3E8F A;  4I0X A;  3NR7 A;  4DXW A;  1BZK A;  3SJB C;  4UCR A;  4WBN B;  4UXN A;  4DV3 B;  3CRM A;  1AJN A;  3SR2 C;  4CH4 A;  4TQD A;  2BTQ B;  4OGQ B;  4TOI A;  1L1F A;  3CMA V;  2Y48 A;  4RQE A;  1F4M A;  1S5H C;  4HZ3 A;  2N04 A;  2E5L O;  5LP6 A;  4X64 B;  5JVD A;  4IIJ B;  3E86 A;  1VQL V;  3UCS C;  2RDC A;  1R3K C;  3K0D A;  5J2T A;  4MTO A;  2V1D A;  2OCC B;  3CRQ A;  4LF6 B;  4QIW F;  4LF4 O;  1AR4 A;  1Y4M A;  2DW4 A;  4LF8 O;  2JEU A;  4B3R B;  4GKJ B;  4WFB V;  4K0K O;  4D7S A;  2JS3 A;  1MZE A;  4MTG A;  2YXY A;  1Q3E A;  2GUZ B;  1PV0 A;  4JI0 B;  1WA8 A;  3QO5 A;  3IAY A;  2V7Q G;  1OCO C;  5KHH A;  1J95 A;  3U10 A;  4DV3 O;  5GON B;  1SA0 A;  3K9S A;  4P9O A;  3QO7 A;  3AG1 C;  3B8N A;  3RYH B;  1R6N A;  1V54 B;  1HNW O;  4DV5 B;  3DC5 A;  3P30 A;  4X64 O;  2EX3 A;  4DW1 A;  3CS5 A;  3JD4 A;  3AG2 C;  1ARO P;  1MNG A;  2E3C A;  3OFN G;  3CP1 A;  3H1L H;  3OTO B;  2AZ2 A;  2JRI A;  4NB5 A;  4I4T B;  2WPD G;  4LF6 O;  3CEI A;  3CD6 V;  5GTI Z;  2H8P C;  5EIB D;  5IDJ A;  2P06 A;  3CC2 V;  4O4H A;  4B3R O;  4GKJ O;  1M1K W;  3AG7 A;  2A3Q A;  1DF4 A;  5CMU A;  1BQ0 A;  1OJH A;  1H8E G;  3K0G A;  4LFC B;  3E8B A;  1FAF A;  1F23 A;  2WA4 A;  1OCO B;  4LWS A;  4JI0 O;  3UO3 A;  4YJ2 B;  3ML0 A;  3OEE G;  4MTF A;  3UM7 A;  5J9P C;  3JAL A;  4PI0 A;  1M57 C;  3AG1 B;  5KAF Z;  4DV1 B;  2UUA B;  2YIA A;  5EBM C;  5C93 A;  5IY5 C;  4TV9 A;  2DQ3 A;  2LFR A;  2YI9 A;  4DV5 O;  4YIP A;  4BWA A;  3ETD A;  1S77 D;  1ZAU A;  2XAS A;  5CBH A;  2OWO A;  1K97 A;  3WB0 A;  5FPR A;  3ZX6 A;  3OTO O;  2QEX V;  2DYR C;  4O4L B;  2Q0O C;  1KQS U;  1BMF G;  1LUV A;  2HHH B;  1OCR B;  1PP9 H;  2UXX A;  2ZT9 B;  1FXH A;  4PA9 A;  1QR9 A;  1R3L C;  3A0B Z;  4MT8 A;  4TT3 G;  1JNB A;  3ABK C;  4LFC O;  1G1X B;  3N2K A;  1R73 A;  1W0K G;  1M90 W;  4J11 A;  3ZMU A;  1R6K A;  4DV1 O;  2UUA O;  2JEX A;  2DJV A;  4QE7 A;  3OM3 B;  3ZMS A;  3I5D A;  5KHJ A;  1B6Q A;  3FB6 C;  1XMO B;  1N0J A;  2HFE C;  3CCJ V;  2A79 B;  2P22 C;  4FK5 C;  1YDX A;  2ZE8 A;  3O9O A;  3G67 A;  3GB7 C;  1BT8 A;  1VEW A;  1YVW A;  1YI2 V;  3IGA C;  3TXQ A;  4ZKI A;  3B4S A;  4IYI A;  5CA3 A;  3LDD A;  1FS0 G;  1YF2 A;  3ZRX A;  3RBZ A;  1P49 A;  3CRA A;  2DWD C;  4UV8 A;  3H1J H;  4QE9 A;  4J9Y B;  4JV5 B;  1KB9 F;  5ITZ A;  2HHH O;  2XAJ A;  4U3J B;  4X1K A;  3O65 A;  1QBZ A;  3ZIA G;  2PI4 A;  3L73 H;  4DRX B;  4OPH A;  2A9H A;  2NR5 A;  4UVC A;  4R50 A;  4DV6 B;  3KG2 A;  3SJA C;  3CSX A;  3DTU B;  1S0V A;  3CB2 A;  1XMO O;  1HR0 B;  2WSS G;  2F23 A;  3F5W C;  3RT3 C;  3G4S V;  3ZN1 A;  5CA0 A;  1ZX3 A;  4X1I A;  3OEH G;  4PA4 A;  1COW G;  1L8D A;  2ZKO A;  3VQV A;  5LMN O;  2IW5 A;  3H1H H;  2H3O A;  3P32 A;  2GBO A;  1R3I C;  3HR0 A;  3D8C A;  3JAT B;  4RUE A;  4JV5 O;  4LFB B;  1XBL A;  4L87 A;  4N21 A;  2IH3 C;  2LGQ A;  2Y4U A;  5L3C A;  2WAM A;  2ZDI C;  1NBM G;  1Q7Y W;  2QWN B;  4JI6 B;  5K1P A;  4I0X B;  1QLE B;  2Q68 A;  1EFR G;  4KHP B;  4JAS A;  4DV6 O;  2BTQ A;  1AJQ A;  2YXL A;  3TCU A;  1FXV A;  1HR0 O;  4NXN B;  3ABT A;  1NQT A;  4LF5 B;  1ENV A;  2ZIM A;  3G6E V;  3ABL C;  2P67 A;  2X7R B;  1NVP D;  3DXR A;  3ABU A;  2ITC C;  3LDE A;  3WU2 Z;  5LP6 B;  1PPJ H;  5JVD B;  1WB7 A;  3L70 H;  1JQ0 A;  1RM1 B;  1VQ9 V;  5DN6 G;  4EFB A;  4X62 B;  2NNU A;  4DR5 B;  4B3M B;  2FTK A;  5J2T B;  1SQF A;  4JI7 B;  3RWR D;  1KU9 A;  4LFB O;  1O9G A;  4EB6 A;  3K04 A;  4CBC A;  2VQF O;  4FM0 A;  1VQ5 V;  1H5W A;  4WF9 V;  1WP8 A;  4FM1 A;  5B1A B;  4GX2 A;  3DSQ A;  2KSD A;  2C2A A;  1F51 A;  2IJK A;  2JGU A;  4JI6 O;  4YHH B;  3F7Y C;  1WA8 B;  2QWP B;  4KHP O;  1NH2 B;  3F5T A;  3E2E A;  4CC6 A;  4FLU A;  1SA0 B;  4NXN O;  4MVQ A;  1AR1 B;  2JS5 A;  3K5N A;  3D36 C;  2VRZ A;  4G27 B;  3L74 H;  4JAA A;  2XAH A;  2HKO A;  3LDC A;  1FFT B;  5JCO A;  4LF5 O;  2BSK A;  1H2L A;  4PA6 A;  2PI5 A;  5B1B C;  5L3F A;  1JJ2 U;  1AI7 A;  4X62 O;  3ASO C;  2YIB D;  4DR5 O;  4B3M O;  2Q73 A;  2EIL C;  3B77 A;  2YDE A;  3APO A;  4K8Z A;  3LNN A;  4JI7 O;  4E2L A;  2AHZ A;  3HKC A;  4O4H B;  1PL4 A;  4OX9 B;  3MD0 A;  3FKS G;  3CJH B;  5LGN A;  2E75 B;  1QVF U;  5H6Q A;  5A2Q N;  4L8J A;  4K35 A;  4TQF A;  4Q6G A;  3G71 V;  1Y74 B;  2XAG A;  4YHH O;  4LC1 A;  1IJG A;  4LWS B;  4PDV A;  1NTM H;  1U96 A;  2QKA A;  1IDS A;  2FL4 A;  3JAL B;  2R70 A;  4QJF B;  4B3S B;  3UKM A;  3M8A A;  5GTH Z;  1X59 A;  4CC5 A;  2EIJ C;  4TV9 B;  1XNQ B;  5B1B B;  3I55 V;  3ASO B;  3K08 A;  1I08 A;  1EN5 A;  1K7D A;  3CCV V;  2YID A;  4LF9 B;  1PNM A;  2Y0P A;  1B04 A;  2FML A;  5J2U A;  3RW0 A;  4K3A A;  4KP4 A;  2V4D A;  4JZ2 A;  5IJ9 B;  4RAI A;  2Q7E A;  4DR6 B;  3KCY A;  4D6T H;  1XDC A;  4WFA V;  2Y69 B;  1AI4 A;  2EIN C;  1RPR A;  1S76 D;  4GT1 A;  3ETQ A;  2Q7G A;  1JX9 A;  3HKB A;  4JI2 B;  2WLJ A;  5FL7 G;  4FLT A;  3N2K B;  1S72 V;  1I7F A;  4JI3 B;  5IYZ A;  2WLL A;  2ZE7 A;  4LH7 A;  2EIJ B;  4B3S O;  1Y67 A;  4X89 A;  4UCO A;  3SJQ C;  4DR3 B;  3CC4 V;  1XNQ O;  1VQ4 V;  4X8A A;  2EIM C;  4PV1 B;  4DUZ B;  4J9Z B;  1GM8 A;  4DW0 A;  1HNX B;  1ZWI C;  1FD9 A;  2CUG A;  2L6L A;  1QU7 A;  4JYY A;  4MW3 A;  5CB4 A;  1VF6 C;  2EIK C;  5ITZ B;  4DR6 O;  2P4V A;  3JAR A;  1YZB A;  4JGS A;  2LW1 A;  5LGT A;  2GSM B;  3MAQ A;  4X1K B;  3JD2 A;  2X6A A;  1AB3 A;  4JI2 O;  4QGP A;  5C8Y A;  4J42 A;  3CCM V;  3E35 A;  2Z0A A;  1S3J A;  4WFF A;  4GX1 A;  4F6E A;  4JI3 O;  2R9I A;  2QM4 A;  3OMN B;  3CE2 A;  1P7G A;  3L9D A;  1DK1 A;  1N4C A;  2EIM B;  1KP3 A;  4KFM A;  2EUL A;  5JJJ B;  4A5U B;  1MG1 A;  4PDL A;  3SGI A;  3UT5 B;  5IYC O;  2YC0 A;  5CA0 B;  3CCU V;  4HBN A;  4DUZ O;  1PL0 A;  2PZS A;  1D5N A;  4X1I B;  4RWU A;  1OCZ B;  2ZM6 B;  4GCZ A;  2Q69 A;  2F93 B;  2B9Z A;  3IFX A;  2QWQ B;  4EEQ A;  2OCC C;  1SER A;  4UCS A;  3IJ4 A;  2ZE5 A;  2UXN A;  3ZHS A;  2X6C A;  1M4U A;  4IT5 A;  1JPX A;  2GTS A;  4JI1 O;  5KHK A;  2F43 G;  1K3E A;  2ODM A;  3JAM N;  3TXS A;  1NR1 A;  3FYI B;  1TUE B;  1D5A A;  3K5O A;  2JGD A;  1B06 A;  4NKG B;  2QGN A;  3ZRV A;  4JI8 B;  4X1Y A;  5LOV B;  1TA8 A;  3OUF A;  3B09 A;  5F2V O;  1HNW B;  1V54 C;  5LHI A;  3FB8 C;  3RGB A;  4DK0 A;  3K57 A;  1GO3 F;  5JCO C;  3DXR B;  2WA3 A;  2WLK A;  3D3I A;  2ZM6 O;  3J7A U;  4E4E A;  1SQQ H;  2AXT Z;  2AGA A;  1N8R W;  2DYS C;  4H13 B;  5LYJ A;  2ZR3 A;  4IYH A;  4EB6 B;  1YSC A;  3HKD A;  2IH1 C;  5LA6 A;  1BL8 A;  4CH3 A;  1M93 A;  1GN3 A;  3K5M A;  2LP7 A;  5L3D A;  1IXM A;  3QVN A;  3ZHT A;  1TUB A;  3M99 B;  5KUM A;  1HDJ A;  2JJ1 G;  3TJT A;  5LBQ A;  4JI8 O;  1EZV H;  3K79 A;  1KYO F;  4PHZ A;  4DYL A;  3FX7 A;  4YY3 B;  2PYJ A;  1XL6 A;  1Z2G A;  2OCH A;  1RFY A;  1A32 A;  2XUM A;  4FZ0 A;  3BPZ A;  1FOU A;  3N27 A;  5B3S B;  4H0L B;  2P7T C;  1UJW B;  2BSK B;  4IGG A;  2NN4 A;  4J7Z A;  4PEL A;  1K92 A;  3L71 H;  3CX5 F;  2AHY A;  3SYQ A;  1IVS A;  1Z5W A;  4U7N A;  2DYS B;  2IBZ H;  4JAU A;  2BOC C;  1Q82 W;  5IJ0 A;  3SYO A;  3CJH A;  3HKC B;  1OCR C;  1IX9 A;  2UUB B;  4NTY A;  5D5P A;  1TVK B;  3AK1 A;  1Y74 A;  2LGW A;  2YSU B;  4XBF A;  5KX5 A;  3CCR V;  3OUS A;  1Q81 W;  3CME V;  4YY3 O;  2EJ7 A;  5BY1 A;  1YEW A;  2YIB A;  1SRY A;  4ZOL A;  2Q5Z A;  3JAS A;  3RYF A;  4DR1 B;  1VF7 A;  2KKW A;  1I5X A;  2EJR A;  1JFF A;  5B1N A;  2Z5U A;  1OCC C;  1AJP A;  1Q8I A;  3ZRW B;  5J2U B;  5IJ9 A;  2HVJ C;  2F1M A;  5K1X A;  3JAK B;  1GAX A;  3Q4H A;  2W0X A;  1GTO A;  3CCQ V;  4PD4 F;  3OW2 U;  1XOU A;  3ZHR A;  2UUB O;  1BCC H;  3RN4 A;  3ZRS A;  1ZL8 A;  4KL1 A;  4FLX A;  2VWJ A;  4FLV A;  4R8C A;  4CS2 A;  2AW9 A;  3N2G B;  2PYL A;  3HKB B;  2CTQ A;  5HFL A;  2QSA A;  5IYZ B;  5TIS Z;  2WLL B;  1WPB A;  3AK3 A;  2A06 H;  2UUC B;  3WFV A;  1WN7 A;  2HEP A;  1VQO V;  1SF9 A;  2YUA A;  3ZMV A;  4DR1 O;  5LMN B;  1DGS A;  1OCC B;  5LL6 Y;  1X4T A;  2MW2 B;  5KA5 A;  3K03 A;  1Z5V A;  3ZHQ A;  5JJN B;  1T5E A;  2R9A A;  1K5Q A;  1KKC A;  2QTO A;  1NTK H;  4FM2 A;  5CB4 B;  1JVM A;  1MOF A;  2YXH A;  3JAR B;  1OZ0 A;  5CA1 A;  1VQN V;  3FAV A;  1PNK A;  1G4Y B;  4X66 B;  3ZHU A;  1VQ6 V;  4GYC B;  2FB5 A;  2UXD B;  3K59 A;  1SQV H;  5C8Y B;  1GN6 A;  4GUN A;  1Q90 D;  4JI4 B;  1QLE C;  3FYE B;  3QF7 A;  3T4D A;  1MSD A;  1XEQ A;  4CS4 A;  2Q0A A;  4BIZ A;  5DED A;  4B3T B;  3UT5 A;  2UUC O;  2IJH A;  3E8G A;  3JD3 A;  1YIJ V;  2Q9L A;  2CTW A;  4I7Z B;  3WG7 B;  5IWA B;  4I55 A;  4C7U A;  4UB6 Z;  5LP6 C;  1GM9 A;  1ZSP A;  1RM1 C;  3R65 A;  4MVU A;  3GVM A;  1SQX H; 
#chains in the Genus database with same CATH homology
 1IDS A;  3C3T A;  1EN6 A;  3QVN A;  1QNM A;  1SZX A;  1BT8 A;  1VEW A;  3DC6 A;  1MNG A;  3RN4 A;  1XIL A;  4F6E A;  1JA8 A;  3TJT A;  1IXB A;  1AP6 A;  3CEI A;  2GDS A;  1ZLZ A;  3MDS A;  1P7G A;  2AW9 A;  1N0N A;  1AR5 A;  1WB7 A;  1PM9 A;  1I08 A;  1EN5 A;  1D5N A;  3AK3 A;  2CE4 A;  1JR9 A;  5AG2 A;  4JZ2 A;  3AK2 A;  4YIO A;  1LUW A;  1ZTE A;  1XDC A;  2ADP A;  4X9Q A;  1MA1 A;  2ADQ B;  1GN4 A;  2P4K A;  1MMM A;  1VAR A;  1KKC A;  1BSM A;  4YIP A;  1IX9 A;  4JZG A;  3AK1 A;  4BR6 A;  1B06 A;  1EM1 A;  3LSU A;  3C3S A;  1Y67 A;  5A9G A;  1AR4 A;  3EVK A;  1XUQ A;  1I0H A;  1LUV A;  1GN6 A;  4GUN A;  3KDR A;  3IC9 A;  1MSD A;  1XRE A;  4JYY A;  1ZUQ A;  4E4E A;  1PL4 A;  3K9S A;  2RCV A;  1AP5 A;  1AVM A;  1GN2 A;  1EN4 A;  3KKY A;  4FFK A;  4C7U A;  1WB8 A;  1BS3 A;  3OT7 A;  1ZSP A;  1N0J A;  3DC5 A;  2QKC A;  2CDY A;  1GN3 A;  3BFR A;  2QKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...