3LSUA

Crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
204
structure length
190
Chain Sequence
VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNADYFAIWNVVNWEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Crystal Structure of SOD2 from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 61
structure length 190
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3lsuA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3lsuA02
1IX9A 2ADPA 1MMMA 2CE4A 5AG2A 1IDSA 3CEIA 4FFKA 4BR6A 1IXBA 1AP6A 3AK3A 3OT7A 2AW9A 1XREA 3DC6A 4C7UA 1AP5A 1PM9A 4YIOA 1QNMA 1EN5A 1B06A 1MSDA 1GN4A 1WB7A 1BSMA 1SZXA 1XUQA 2ADQB 3IC9A 3KKYA 2GDSA 3C3TA 1ZLZA 2CDYA 4X9QA 3RN4A 3MDSA 1VEWA 3EVKA 3K9SA 1D5NA 2P4KA 1EM1A 1N0JA 1BS3A 1ZUQA 3TJTA 3DC5A 4YIPA 3BFRA 1LUVA 3AK1A 1I0HA 3LSUA 2RCVA 1KKCA 1VARA 1XDCA 5A9GA 4GUNA 1PL4A 1AR5A 1GN2A 1P7GA 1MA1A 1AVMA 1AR4A 3AK2A 1I08A 1ZSPA 4E4EA 3QVNA 1BT8A 1JA8A 1EN4A 2QKAA 1WB8A 4JZGA 4F6EA 1N0NA 2QKCA 1JR9A 1ZTEA 1XILA 1Y67A 1LUWA 4JYYA 1GN3A 1GN6A 3C3SA 4JZ2A 1MNGA 1EN6A
chains in the Genus database with same CATH superfamily
1IX9A 2QM4A 4PDVA 4I0XA 4DV6O 4G2KA 1JOYA 2K9PA 3JATA 1XEQA 4RAIA 4JV5B 4YXWG 4EEQA 1P84F 4OPAA 1NVPD 4HNAB 3QNEA 5DN6G 4YHHB 3HB3B 1MSWD 4AHCA 1XHXA 2VRZA 3H1HH 2Q9LA 3ZHUA 2VQFO 1FFXA 5B1AB 1ZLZA 3AG2C 1BGYH 3U10A 4DV6B 3RT3C 1TVKB 4X9QA 1S72V 1H38A 1Q5OA 4DR3B 5B1BB 3RWRD 1D5NA 5DEDA 2GV9A 2F66C 3G67A 4WFEA 1KMIZ 2P6JA 3K5OA 4UV8A 1YJ9V 3AG1C 1JFFA 4ZI7B 2YEVB 4WFGA 4DYLA 4TV9A 4OX9O 1EBOA 2DMXA 4GKJO 2V1DA 4BIUA 3DXRA 3N2KB 2QR4A 1P7GA 4Z1VA 3K3WA 5D5PA 4K8ZA 5LP6C 1W2BU 1V55C 1YJWV 2F43G 3N2GA 1O9HA 1M5IA 4I4TB 4MT8A 4KUMA 2YIBA 3TCUA 1ZTEA 1YTFD 4GKJB 4XDLA 4ZHQA 3L70H 5CA1A 2JIZG 5JJNB 5LP6A 2VWJA 4R7CA 5B5EZ 3J7AU 3ZRWA 1NH2D 1OCCC 2A7WA 2DYRC 5H2FZ 4J41A 1EZJA 3K79A 1AJQA 4UCOA 3ZN0A 3T1HO 4JF3A 2P7TC 3BRCA 4B3SO 2BTQA 2JS5A 4FLXA 1GM7A 2UXNA 4X20B 3K9AA 1PP9H 2UUAO 3BHPA 3CRCA 3S3XA 1HR0O 4FM0A 4UB8Z 4I55A 2UUCB 3T1HB 1PNKA 4R50A 3P3PA 1VQ4V 1VEWA 2YC0A 1BZKA 1DLBA 4YJ3A 3OTFA 3IC7A 5IJ9A 4XBFA 5LGNA 4RO2A 5A2QN 2PI4A 1R6TA 1URFA 2HG5C 4WBNB 3K5LA 2BCCH 2YS8A 4PHZA 1TUEB 4OPHA 1SQXH 4EFEA 3BFRA 4ZI7A 4J7KA 2LO1A 2EILB 2PY5A 1N32O 3A2FA 4JI8O 2BSKB 1Y66A 1GN2A 1RPOA 3N2KA 2EIMC 2Q7HA 5B3SB 3CCVV 4JGSA 5LOVA 3JD4A 4MVOA 3H1IH 2YI9A 2DJVA 1QHTA 3LDEA 4JYCA 1NVPB 2RQ6A 1N0NA 3SPIA 3CYOA 3AG3B 5BZBA 1LUWA 2WSSG 5J9PC 2EX3A 2ZXWB 4JI8B 1CEZA 2N04A 4B08A 3UKMA 2CTPA 2LW1A 2M6YA 4MVZA 4FLZA 5GTIZ 2YI8A 3U0ZA 3TXQA 3VOUA 4JI1O 5C8YB 4GX5A 4LFAB 4Q6GA 4U3JB 2UUBB 4NXMB 4ABMA 3A8TA 3BA9A 4X8AA 3EHBB 2ZD9A 4O4HA 4BIZA 4MTXA 4YIOA 1AI7A 1QNMA 1EN5A 1XOUA 5IJ0B 5ITZA 1Q6IA 2A3QA 1PPJH 4GX2A 5LA6B 2ZE8A 4DV4O 3IFXA 2F23A 1G6UA 4LF7B 4JI1B 1W0KG 3B77A 3EVKA 4JAUA 2ZINA 4PD4F 4B3RB 1VQMV 3LDCA 1ZUQA 2DQ0A 1MABG 2RNBA 4X1KB 4PA6A 1E1QG 1NH2B 3DTUB 2ZE7A 4DRXA 3K0GA 2F95B 1VQ5V 1K5SA 3ZS8C 4FLWA 4XDKA 5LMUB 2GSMB 3ZMSA 2XUMA 2DWDC 4LNUA 4XDJA 3ABMB 1F4MA 1NTKH 3E8GA 1OZ0A 4I50B 3CSXA 4PDLA 1EN4A 2LGQA 3FB6C 4LBEC 4WFHA 4CH5A 3DSQA 1P7BA 1F51A 3ETEA 2ZT9B 1VQKV 1K33A 2HR3A 3CRAA 1OJHA 1YJNV 4P9PA 1MZEA 2CE4A 3JASB 1VF6C 5EBWC 3RFRA 3GB7C 4PA4A 1VF5B 2DN9A 2AW9A 4QGPA 4X64O 5C8YA 4JYBA 4NXNO 4UCSA 3JAWB 3ASNC 5FLXN 1K3EA 2XNDG 3ZBHA 3APOA 2YUAA 3JAKA 2HEPA 4MVRA 3SJCC 5B1OA 3GWOA 2CGNA 3ZRXA 1IBMB 4D6TH 2BOBC 1M4UA 3ZHQA 5LA6A 2IU3A 1A32A 5KMGB 4DR6B 4UVCA 3CRRA 1W0JG 4NB5A 4X64B 3SJBC 4NXNB 1M56C 3OEEG 3UQ8A 4DV1O 1EM1A 1N0JA 5LHHA 1XBLA 5KHGA 3ZIAG 4KFMA 1NS1A 3ML0A 1QQCA 3CMAV 3RVZA 3DC5A 1W59A 3I55V 3ASOB 3CXHF 2Y48A 5CBGA 2B5UA 3ICXA 3ABKC 2HVKC 2LFRA 2YDEA 1JJOA 4IGGA 4UCVA 2HFEC 4CS2A 1IBKB 1QR9A 1YVWA 1AR4A 5K1XA 3BCCH 3CCUV 2ILMA 3P30A 1WA8B 5IE9A 3WU2Z 4DV5B 2QA4V 5DM6V 4CS4A 1NR7A 2KG7A 5LHIA 3BA8A 4PELA 3O9OA 1US6A 1S5HC 1Y74A 2KB1A 4GYCB 1O9GA 4TQFA 3HKBB 5JCOC 3ABTA 2N05A 1S3JA 4TT3G 1NTZH 2MK3A 2IW5A 4TOIA 4ZIBA 4RUEA 1KQSU 2OCCB 2RN9A 5L3GA 3CJHA 5J2TB 2ITCC 5D5QA 2CH7B 1RP3B 3CD6V 4NTXA 2ZDIA 1XI1A 4LP8A 3CB2A 3KKYA 2Z0AA 1K34A 1NI8A 3T1CA 1KECA 1LR1A 4D7TA 3OR6C 5L3FA 2DOSA 1OCRB 1D5AA 2YICA 1VP7A 4FZ1A 5KMGA 5EIBC 2OIGA 1I7FA 2UU9O 1DGSA 2ZR2A 4TUYA 2IJHA 1RM1C 1I94O 1QLEC 4H33A 2Q6AA 1NT2B 1TUBB 4PI0A 2Q7EA 1N33B 2QWNB 1BHBA 3D3IA 1LNQA 2P67A 4IYIA 3UT5B 3HKCA 5JQGB 5IYZB 5L3BA 4GX0A 1I94B 5LGUA 5LL6Y 1H8HG 3R66A 3NXSA 1WA8A 1IURA 2X0LA 4JZGA 4J10A 5BXZA 1KYOF 3L72H 1R3IC 4O2BB 2QKCA 1JR9A 4R6ZA 2DYSB 2JDIG 3L73H 1FAFA 3TK1A 2D2CB 1Q3EA 5EZYA 1SQPH 4IYHA 2JGDB 4JI4B 3AG2B 1GN6A 1FXKB 3C3SA 1NR1A 4J42A 1GMGA 4O4LB 2IH3C 3HKBA 4H37A 2ADPA 4DW0A 3L9DA 4LF5B 4FFKA 1F7YA 1FOUA 3B8NA 2OWOA 1SETA 3ZEDA 1AROP 4X62O 4ASUG 2IJIA 1WNSA 3RW0A 1F4NA 4DUZB 4DR7O 5IT9N 1JX9A 4FFBB 3HPLC 4LFBB 3C3TA 2HJFC 1NBMG 2R72A 4UCRA 4LFCO 2WWWA 3TGUH 4UB6Z 2W0FC 4O4JB 4Q20A 3MDSA 1V55B 2UXBO 3CC2V 4LH6A 1HWYA 2NNUA 2P4KA 1JCHA 1SZTA 2MW2B 2A79B 4X62B 3CPWU 2Q7GA 3AG4C 1P49A 4DR7B 3WB1A 2X7RB 3JALA 1XHZA 1G1XB 1AILA 5IY5C 1B04A 2Y0IA 1WN7A 4P2ZA 1B3QA 2ZQMA 4L8JA 1K73W 1WP7A 2XOKG 1S0VA 1IBLO 4GUNA 3FB7C 3H9VA 2H3OA 2ODMA 3UT5A 4WCEV 1GM8A 4FJCC 3AK2A 4O2AB 1ZL8A 5JQGA 1QVGU 4WFBV 1FXVA 4DV0O 3D36A 2Y4TA 5BMVA 2QE7G 2VQFB 2G38A 3K5MA 2XHBA 3K06A 5JVDA 3SPCA 3A0HZ 4O2BA 2B9ZA 1GN3A 1IBLB 1R6NA 3QO7A 1SKVA 1YF2A 1Q43A 3OE7G 5GTHZ 2HJDA 2JGDA 3IAYA 4O4IA 1R3LC 1FKAO 4DV0B 1EN6A 1L8DA 1E79G 3JSNA 4JASA 1V54B 3PJSK 2BTOA 4OX9B 2HVJC 3OT7A 5CB4B 4CZZA 2ZE5A 1S76D 5LMNO 1JQ0A 3STLC 3K58A 5LBQA 4TWKA 2QWRB 1M9NA 1CXZB 1XMQO 4JI2O 2WA3A 1UPGA 2CGOA 3G71V 1THZA 1H2LA 2Y4UA 3KCXA 5K1PA 5LMNB 3M8AA 1YEWA 4UFZA 3ZRVA 2QKSA 1N4CA 1T5EA 4HNAA 4PI2A 1AI5A 4JI2B 2Q8VA 3CRQA 2PYLA 1G4YB 4ZBMA 1ROPA 2QM8A 3FAVB 4HBNA 4B3SB 2UXCO 1TVKA 4LF4O 1KP2A 2JJ2G 4ZOLB 5CA0B 2OIEA 3L74H 2JRIA 3FYIB 1VF7A 2UUAB 1GRJA 2ZM6O 1HR0B 4CS3A 2AHYA 3SPHA 1Y76B 1UFIA 5BY1A 1VMGA 4F6EA 3G6EV 2YEVA 3H1LH 4RUFA 3RYFB 2R9IA 2E5LO 4DV7O 3F5WC 3JSLA 4N21A 1VQ8V 2LJ2A 2QSAA 4LF4B 2E3CA 1DK1A 3LDDA 5J2UB 2F4VO 2ITDC 2FYUH 2EZOA 1MNGA 4X1YB 3HR0A 4QIWF 1QLNA 3CCRV 1J95A 3OD4A 4I4TA 4UUJC 3CCJV 3B40A 1QBZA 1R73A 2E5LB 3DC6A 4DV7B 1YZBA 4JTAB 1N32B 5CB4A 2KSDA 2EIKC 3LSSA 1S77D 2XAQA 1KU9A 1WPXA 2F4VB 1BSMA 5H9CA 4DV3O 3E22B 5KX5B 3FFQA 1V9PA 5CA3A 1QVFU 4I7ZB 1YDXA 1FFTB 1Y6XA 2L6LA 1AI4A 4I9QA 4U7OA 1DTOA 2ARHA 3OR7C 4LF9O 2EIJB 5KHHA 4X20A 4NYKA 2JJ1G 3OMIB 1BS3A 5EBLC 1XQ8A 3I56V 4EFBA 2IJJA 2YIDA 4X66O 3FB5C 2M7WA 4DV3B 3STZC 2W6JG 2DQ3A 4JI0O 1OHHG 4DXWA 5IYCO 4K8XA 2FTKA 5KHKA 2HP8A 2Q4PA 3CXCU 1PL4A 4J9YB 3QF7A 4LF9B 1BQ0A 4ZOLA 1YTFB 4DR4O 4J7ZA 1XNRO 4LWSB 4H44B 5CN0A 2XAFA 1H2KA 3SYOA 3CCEV 2OTLV 5L3EA 5B3SC 4DV4B 1S5LZ 4WBNA 3ZN1A 4F4LA 3ZHRA 4JYYA 4G27B 5L3CA 3CHXA 3RYFA 1VQ7V 4KL1A 1FXHA 3SGIA 1FS0G 1HP8A 3FD9A 2BSKA 3AG3C 4J11A 3TXSA 2KKWA 2ZXWC 3OGIB 5J2UA 4X1YA 1NU1H 2E76B 1YXBA 2RMKB 4EKWA 2PI5A 3T4DA 5LHGA 1WJZA 4H0LB 2BE3A 5H5NA 1Q6UA 5GONB 1PKXA 3K57A 1B06A 4WFAV 1JVMA 3ABKB 4J80A 3C90A 2LW7A 2GDSA 1XNQO 1KB9F 2PGGA 3CS5A 5KX5A 2FKXA 4U3FH 4X88A 3RN4A 2ATKC 4L87A 4CC6A 1KKDA 1OCOB 1S5JA 4DK0A 3ZHTA 3JD1A 1X4TA 3BVOA 3JCZA 3KG2A 4U3JA 5IJ0A 2FL4A 3OTOO 3OGCC 2EINB 3I5DA 4IT5A 2ZKOA 1RFYA 4GKKO 1FJGO 3QG5A 1F23A 4MVMA 4IL6Z 4B7KA 1JJ2U 3OMNB 2GHYA 1OCZC 1M93A 2L35A 4FLUA 2PYJA 4MSWC 3ETDA 3ABLC 5GW7A 3ABMC 2OCHA 1HNZO 3OTOB 3CWBH 1K4DC 3JCUZ 3T1YO 1MOFA 3RGBA 4UVAA 4X1KA 4DUYO 4RQEA 4U7NA 2YIBD 4X89A 1IXMA 4TSFG 1QU7A 4DV1B 4IIJB 4FZ0A 2QTOA 2YXLA 1NQTA 4NTYA 1N36O 5B66Z 5AG2A 2WLIB 2HLDG 1GM9A 4I50A 1HNZB 4FMTA 1PL0A 4QJFB 3L71H 1AP5A 1CP9A 2P22C 4JI5O 1JNBA 1PM9A 2IJKA 1KUQA 5GONA 1SERA 2N74A 4ZKIA 3D8CA 5KA6A 4G28B 1SF9A 3WFVA 3IC9A 3OW2U 1AB3A 4IHJB 2ZDIC 3IJ4A 3SJAC 1BL8A 1PV0A 1Z2GA 2WLHA 4QPKA 1SQFA 1XL4A 1Q8IA 4OXSA 3JASA 1JMKC 3QTCA 1YI2V 3W7WA 4PA7A 3K9SA 4PV1B 4JI5B 5IYBO 3JAWA 4P9OA 2IBZH 2AHZA 2F93B 3TETA 4FLVA 3LUTB 4YIPA 4HZ3A 1ZX3A 2Q0OC 1Q7YW 1FYJA 3W7UA 2DWEC 1NTMH 1VARA 1XDCA 3M99B 4JPRA 1GH6A 3BY6A 1MA1A 1AVMA 1Q86W 3ABUA 4LR3A 1NZ6A 3ETGA 2R9AA 4I0XB 2JK5C 3RYCB 4JTCB 3X2QB 5KAIZ 5DECA 5EC2C 2DW4A 1XILA 1TA8A 4AI8A 4DW1A 4JYAO 3M7MX 4NTWA 2XAGA 2UU9B 2NN4A 3K59A 1FFXB 2WA4A 2E74B 4IIJA 3E35A 5KUMA 4LF6O 2VWKA 5KLVH 2QTSA 1U96A 1JPXA 1MG1A 2UXXA 4JI7O 1SESA 3CEIA 5KA5A 4I5SA 3CCSV 3BABA 2WLJA 5JJEB 4GZRB 4JYAB 4KHPO 1QR8A 3OFNG 5IY5B 2Z5UA 3G80A 2JEXA 4PA3A 5LXTB 1SS3A 1M57C 4DO2A 1JFFB 2OCCC 3Q4HB 1GN4A 2Y69C 4JI3O 1N8RW 1R3JC 4LF6B 4QE7A 1ORQC 3ZMUA 4JI7B 3EXAA 4IHJA 5EK0A 5H6RA 1GO3F 3K03A 4MTGA 4KHPB 3FB8C 3AG1B 2QWOB 3ZMTA 3N2GB 3GVMA 5J2TA 3BAAA 5EYPB 1HNWO 1VQLV 3F5TA 2CH7A 4PJ0Z 4WF9V 4YY3O 4X65O 2ZIMA 3RYIB 1RSOB 4B7EA 3UO2A 3LSUA 4JV5O 4FLYA 5CA1B 5LP6B 1YHQV 1I5YA 2VS0A 1K8AW 4QNHB 4YJ2B 5A9GA 3ETQA 1AR5A 5HFMA 1TGOA 5LGTA 4YHHO 3J80N 1RPRA 3E89A 1H2SB 4JAAA 2W6IG 1HNWB 1SA0B 3VQVA 4LCUC 3QVNA 2QGNA 4YY3B 2GTAA 3CC4V 4X65B 1N34O 3D36C 1TUBA 4GX1A 3RYCA 2BTQB 4R8CA 4LFCB 2AZ2A 1OV9A 4DR3O 3J81N 1Y67A 4PDMA 1OCCB 2UXBB 2DYRB 1ZWIC 3BEHA 1D2DA 4FM2A 3WB0A 2ZCEA 1QCEA 3T4ZA 5KHJA 2DYSC 2XAJA 5IYZA 2P4VA 4I55B 3MHHC 1FD9A 1Q82W 1N34B 1FXKC 4BR6A 5F2VO 1AP6A 2LFSA 3W7SA 1WPBA 4YJ3B 2LQTA 2QEXV 2KQXA 2YXHA 5IJ9B 3OM3B 1BE3H 2XASA 1SQGA 3JARB 1BQZA 3W7TA 1BMFG 2A0LA 5LXTA 4DV2O 1XUQA 2A9HA 1PNMA 3Q4HA 4E2LA 1FXKA 4GLXA 3SR2C 3WG7C 3FX7A 4K35A 1WLEA 4O4LA 3MAQA 1M1KW 2YIAA 2GBOA 2Q69A 1AJNA 1G8MA 3QO8A 4UVBA 5KHIA 3EFFK 2CTQA 5LOVB 5KUKA 1KP3A 2JS3A 1L0LH 2AXTZ 2PUSA 2WLKA 4MVQA 5EYPA 3TJTA 4DV2B 4MVUA 4BIOA 3JYCA 4PA9A 5JJJB 1IVSA 3OMAB 4FFBA 5FPRA 3SYAA 2EIMB 2Q67A 3RYIA 1RSOA 1UJWB 4Z1MG 1KKCA 1KC8W 1H2NA 5B1AC 4EB6B 4H13B 4O4JA 2JGUA 4YJ2A 2WPDG 1I08A 3ZMZA 5B1BC 3A0RA 1JA8A 1SA0A 1VQNV 1BCCH 2IH1C 2UUCO 2QKAA 1XMQB 2EIKB 5JH7B 3VQYA 4X1IB 1M90W 3K08A 4O4HB 1U97A 2V4DA 4KXRA 4NVPA 4RWUA 5ITZB 1DF5A 1H5WA 4BW5A 5IWAO 2A06H 4QE9A 4BAYA 3VQXA 3AEIA 2X6AA 5C93A 2P90A 4O2AA 4NR1A 3S3WA 1GKFA 1IXBA 2R70A 3SYQA 5EBMC 1YSCA 2Q68A 3KZIZ 3LNMB 3R65A 4C7UA 2UXCB 1V54C 2ZR3A 2GUZB 2HKOA 3E8BA 4LC1A 5IWAB 1WB7A 3JARA 4K0KO 1SZXA 2EZPA 2ZM6B 3K5NA 2QWQB 1SQBH 4DRXB 2WLMA 2CDYA 5B1NA 2EBOA 2OTJV 2CUGA 4B3MO 1HW7A 4LNUB 3P3NA 3L75H 2EULA 3E8FA 1SC5B 3ZMVA 1XMOO 3PN1A 1K92A 4FVMA 1NJIW 4K0KB 2ETNA 2CTRA 3K0DA 4CH4A 3CMEV 1I0HA 5H6QA 3H1KH 3OUSA 5FPOA 4LFAO 2UUBO 3K04A 4BW9A 3D3QA 2AGAA 4NXMO 4B3MB 3B4SA 2P5OA 5EIBD 4EB6A 5CBHA 3H01A 2V7QG 1GK9A 3SPGA 1XMOB 5FL7G 1XL6A 2O57A 4MS2A 2B1GA 3H1JH 3THOA 2FB5A 2RDCA 4HYOA 4D7SA 4MTFA 4JTDB 3APQA 4LF7O 4DR5O 4UCUA 2NLJC 2YXYA 3HKDB 5JH7A 1PD3A 3RYHB 4X1IA 1COWG 3FAVA 3JAKB 3W7XA 4B3RO 2QM7A 2H8PC 2EILC 2P06A 3FYEB 5CA0A 4LF8O 2IM9A 4X66B 3SYCA 1IDSA 4JI0B 2CK3G 3ASNB 2Y0PA 5E1AC 3UM7A 3OAAG 1Y76A 4DR5B 2IU0A 1SQQH 2GTSA 1XREA 5IDJA 1SRYA 5LMUO 3GWKC 2WLLB 4JAVA 2C2AA 3B8MA 1X59A 2ZIOA 2H94A 1J5EO 2GUZA 2XTAA 4PDRA 4DR4B 1YCIA 1XNRB 1HNXO 4LF8B 1YITV 4MW8A 2LP7A 1M56B 3N27A 1FPOA 2R9RB 2E75B 3ZCCA 1OCZB 4N23A 3JAMN 3KDRA 1R6KA 3ABLB 1K97A 1J5EB 3B09A 3JD0A 4HAMA 5L3DA 4DR1O 3A0BZ 1HNXB 1IZ3A 2EIJC 2KG7B 4NKGB 3VQWA 3E22A 1Q6HA 2RCVA 1L1FA 3RBZA 4MW3A 1Y74B 1P4RA 3SDLA 1GTOA 5EC1C 5BR8O 1Q81W 1K9MW 4UV9A 4FIPC 5HFLA 1Y4MA 1IBMO 5LYJB 1BT8A 3SPJA 4DR1B 1Z5VA 1BHAA 1B6QA 1XNQB 1WB8A 2ZNIA 3CCQV 4DR6O 3CE2A 2W0XA 3BPZA 3CJHB 3RVYA 3OEHG 5FNVB 3DGEA 3G4SV 1Z5WA 4FPPA 3LNNA 1EFRG 3KCYA 3HKDA 2Q73A 4DR2O 5BR8B 3RYHA 4P30A 1VF6A 2ZNJA 2CAZC 1EZVH 1WP8A 1VQPV 4J7JA 4LWSA 3WB2A 3CC7V 1H2GA 3SYPA 1GAXA 1IBKO 3HKEB 3ZJZA 4TUYB 1FJGB 4GKKB 3JD2A 1AI6A 1HDJA 2DE0X 4CBCA 4DR2B 3IGAC 2WLLA 4UXNA 2QJ1A 4GCZA 1MSDA 1SQVH 1VQ9V 2B1IA 3E8HA 4RQFA 4DV5O 2XAHA 2QWPB 1NKDA 4CH3A 2FMLA 3T1YB 1RM1B 1QLEB 3HKCB 4DUYB 2VQEO 3CCLV 3UCSC 3E86A 3LSQA 1VIBA 2ZE6A 2X6CA 1PNLA 1OCOC 3MD0A 2PF4E 5CMUA 1AR1B 1KD1W 2RJZA 3P32A 1N36B 3CCMV 1LUVA 3AK1A 2LGWA 4F6RB 5EZYB 5E79Z 2EJ7A 2VQEB 1VQ6V 4TV8B 2K1EA 2EINC 1K5QA 1I5XA 4JI6O 3NR7A 4E4EA 3AG7A 3UO3A 5LYJA 3FKSG 1M57B 2HHHO 2Q5ZA 2Y69B 4ICGA 3ZX6A 1E1RG 1AJPA 3ASOC 4LH7A 5FNVA 1CPYA 1TAEA 2NR5A 5JCOA 3OUFA 3SJQC 2F1MA 4CH6A 5JWPA 3ZHVA 1K4CC 4I9WA 4JZ2A 2PZSA 4KP4A 2BOCC 4JI6B 1N33O 2XT9A 1MMMA 3MHSC 3ZHSA 3JATB 2UXDO 1K7DA 2HHHB 3AK3A 4OGQB 4FLTA 1H2MA 4Z2WA 3G6BA 5IYDO 3HKEA 4GT1A 3JALB 1ENVA 3E2EA 2CTWA 3JD3A 2OYQA 2EJRA 1MZFA 1IJGA 5CBFA 2ADQB 4FM1A 2X6BA 2UXDB 2JVDA 3CX5F 2D3OW 2WLIA 4AQYO 3AG4B 3B2EE 4DK1A 1H8EG 5KAFZ 1ZL8B 4JI4O 5TISZ 2Z3YA 2AZ0A 5BMVB 4QPJA 1VQOV 1ZAUA 2JEUA 4K3AA 4TV9B 1L0NH 3CRMA 4B3TO 4W4KA 5JVDB 4LF5O 3ZRSA 4BWAA 3DXRB 3E83A 4WFFA 4AQYB 4F6RA 4J9ZB 4O4IB 4DUZO 3F7YC 4A5UB 2YSUB 4TV8A 2WAMA 1OCRC 4AILC 1ZSPA 2Q0AA 3QO5A 4JI3B 4MVSA 4LFBO 2WLNA 4CC5A 4B3TB 4MTOA 1KBHA 4UCTA 1Q90D 3VBBA 1YIJV 4W4LA 3CP1A 1WAZA 4ZHQB 2PTMA 2QDOA 3X2QC 3ZRWB 3U11A 3F7VC 3WG7B 3O65A 4FK5C 1R1BA 1R3KC 3T2MA 1DF4A 2OT5A 4TQDA
chains in the Genus database with same CATH topology
1IX9A 2ADPA 1MMMA 2CE4A 5AG2A 1IDSA 3CEIA 4FFKA 4BR6A 1IXBA 1AP6A 3AK3A 3OT7A 2AW9A 1XREA 3DC6A 4C7UA 1AP5A 1PM9A 4YIOA 1QNMA 1EN5A 1B06A 1MSDA 1GN4A 1WB7A 1BSMA 1SZXA 1XUQA 2ADQB 3IC9A 3KKYA 2GDSA 3C3TA 1ZLZA 2CDYA 4X9QA 3RN4A 3MDSA 1VEWA 3EVKA 3K9SA 3KDRA 1D5NA 2P4KA 1EM1A 1N0JA 1BS3A 1ZUQA 3TJTA 3DC5A 4YIPA 3BFRA 1LUVA 3AK1A 1I0HA 3LSUA 2RCVA 1KKCA 1VARA 1XDCA 5A9GA 4GUNA 1PL4A 1AR5A 1GN2A 1P7GA 1MA1A 1AVMA 1AR4A 3AK2A 1I08A 1ZSPA 4E4EA 3QVNA 1BT8A 1JA8A 1EN4A 2QKAA 1WB8A 4JZGA 4F6EA 1N0NA 2QKCA 1JR9A 1ZTEA 1XILA 1Y67A 1LUWA 4JYYA 1GN3A 1GN6A 3C3SA 4JZ2A 1MNGA 1EN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IX9 A;  2ADP A;  1MMM A;  2CE4 A;  5AG2 A;  1IDS A;  3CEI A;  4FFK A;  4BR6 A;  1IXB A;  1AP6 A;  3AK3 A;  3OT7 A;  2AW9 A;  1XRE A;  3DC6 A;  4C7U A;  1AP5 A;  1PM9 A;  4YIO A;  1QNM A;  1EN5 A;  1B06 A;  1MSD A;  1GN4 A;  1WB7 A;  1BSM A;  1SZX A;  1XUQ A;  2ADQ B;  3IC9 A;  3KKY A;  2GDS A;  3C3T A;  1ZLZ A;  2CDY A;  4X9Q A;  3RN4 A;  3MDS A;  1VEW A;  3EVK A;  3K9S A;  1D5N A;  2P4K A;  1EM1 A;  1N0J A;  1BS3 A;  1ZUQ A;  3TJT A;  3DC5 A;  4YIP A;  3BFR A;  1LUV A;  3AK1 A;  1I0H A;  3LSU A;  2RCV A;  1KKC A;  1VAR A;  1XDC A;  5A9G A;  4GUN A;  1PL4 A;  1AR5 A;  1GN2 A;  1P7G A;  1MA1 A;  1AVM A;  1AR4 A;  3AK2 A;  1I08 A;  1ZSP A;  4E4E A;  3QVN A;  1BT8 A;  1JA8 A;  1EN4 A;  2QKA A;  1WB8 A;  4JZG A;  4F6E A;  1N0N A;  2QKC A;  1JR9 A;  1ZTE A;  1XIL A;  1Y67 A;  1LUW A;  4JYY A;  1GN3 A;  1GN6 A;  3C3S A;  4JZ2 A;  1MNG A;  1EN6 A; 
#chains in the Genus database with same CATH topology
 1IX9 A;  2QM4 A;  4PDV A;  4I0X A;  4DV6 O;  4G2K A;  1JOY A;  2K9P A;  3JAT A;  1XEQ A;  4RAI A;  4JV5 B;  4YXW G;  4EEQ A;  1P84 F;  4OPA A;  1NVP D;  4HNA B;  3QNE A;  5DN6 G;  4YHH B;  3HB3 B;  1MSW D;  4AHC A;  1XHX A;  2VRZ A;  3H1H H;  2Q9L A;  3ZHU A;  2VQF O;  1FFX A;  5B1A B;  1ZLZ A;  3AG2 C;  1BGY H;  3U10 A;  4DV6 B;  3RT3 C;  1TVK B;  4X9Q A;  1S72 V;  1H38 A;  1Q5O A;  4DR3 B;  5B1B B;  3RWR D;  1D5N A;  5DED A;  2GV9 A;  2F66 C;  3G67 A;  4WFE A;  1KMI Z;  2P6J A;  3K5O A;  4UV8 A;  1YJ9 V;  3AG1 C;  1JFF A;  4ZI7 B;  2YEV B;  4WFG A;  4DYL A;  4TV9 A;  4OX9 O;  1EBO A;  2DMX A;  4GKJ O;  2V1D A;  4BIU A;  3DXR A;  3N2K B;  2QR4 A;  1P7G A;  4Z1V A;  3K3W A;  5D5P A;  4K8Z A;  5LP6 C;  1W2B U;  1V55 C;  1YJW V;  2F43 G;  3N2G A;  1O9H A;  1M5I A;  4I4T B;  4MT8 A;  4KUM A;  2YIB A;  3TCU A;  1ZTE A;  1YTF D;  4GKJ B;  4XDL A;  4ZHQ A;  3L70 H;  5CA1 A;  2JIZ G;  5JJN B;  5LP6 A;  2VWJ A;  4R7C A;  5B5E Z;  3J7A U;  3ZRW A;  1NH2 D;  1OCC C;  2A7W A;  2DYR C;  5H2F Z;  4J41 A;  1EZJ A;  3K79 A;  1AJQ A;  4UCO A;  3ZN0 A;  3T1H O;  4JF3 A;  2P7T C;  3BRC A;  4B3S O;  2BTQ A;  2JS5 A;  4FLX A;  1GM7 A;  2UXN A;  4X20 B;  3K9A A;  1PP9 H;  2UUA O;  3BHP A;  3CRC A;  3S3X A;  1HR0 O;  4FM0 A;  4UB8 Z;  4I55 A;  2UUC B;  3T1H B;  1PNK A;  4R50 A;  3P3P A;  1VQ4 V;  1VEW A;  2YC0 A;  1BZK A;  1DLB A;  4YJ3 A;  3OTF A;  3IC7 A;  5IJ9 A;  4XBF A;  5LGN A;  4RO2 A;  5A2Q N;  2PI4 A;  1R6T A;  1URF A;  2HG5 C;  4WBN B;  3K5L A;  2BCC H;  2YS8 A;  4PHZ A;  1TUE B;  4OPH A;  1SQX H;  4EFE A;  3BFR A;  4ZI7 A;  4J7K A;  2LO1 A;  2EIL B;  2PY5 A;  1N32 O;  3A2F A;  4JI8 O;  2BSK B;  1Y66 A;  1GN2 A;  1RPO A;  3N2K A;  2EIM C;  2Q7H A;  5B3S B;  3CCV V;  4JGS A;  5LOV A;  3JD4 A;  4MVO A;  3H1I H;  2YI9 A;  2DJV A;  1QHT A;  3LDE A;  4JYC A;  1NVP B;  2RQ6 A;  1N0N A;  3SPI A;  3CYO A;  3AG3 B;  5BZB A;  1LUW A;  2WSS G;  5J9P C;  2EX3 A;  2ZXW B;  4JI8 B;  1CEZ A;  2N04 A;  4B08 A;  3UKM A;  2CTP A;  2LW1 A;  2M6Y A;  4MVZ A;  4FLZ A;  5GTI Z;  2YI8 A;  3U0Z A;  3TXQ A;  3VOU A;  4JI1 O;  5C8Y B;  4GX5 A;  4LFA B;  4Q6G A;  4U3J B;  2UUB B;  4NXM B;  4ABM A;  3A8T A;  3BA9 A;  4X8A A;  3EHB B;  2ZD9 A;  4O4H A;  4BIZ A;  4MTX A;  4YIO A;  1AI7 A;  1QNM A;  1EN5 A;  1XOU A;  5IJ0 B;  5ITZ A;  1Q6I A;  2A3Q A;  1PPJ H;  4GX2 A;  5LA6 B;  2ZE8 A;  4DV4 O;  3IFX A;  2F23 A;  1G6U A;  4LF7 B;  4JI1 B;  1W0K G;  3B77 A;  3EVK A;  4JAU A;  2ZIN A;  4PD4 F;  4B3R B;  1VQM V;  3LDC A;  1ZUQ A;  2DQ0 A;  1MAB G;  2RNB A;  4X1K B;  4PA6 A;  1E1Q G;  1NH2 B;  3DTU B;  2ZE7 A;  4DRX A;  3K0G A;  2F95 B;  1VQ5 V;  1K5S A;  3ZS8 C;  4FLW A;  4XDK A;  5LMU B;  2GSM B;  3ZMS A;  2XUM A;  2DWD C;  4LNU A;  4XDJ A;  3ABM B;  1F4M A;  1NTK H;  3E8G A;  1OZ0 A;  4I50 B;  3CSX A;  4PDL A;  1EN4 A;  2LGQ A;  3FB6 C;  4LBE C;  4WFH A;  4CH5 A;  3DSQ A;  1P7B A;  1F51 A;  3ETE A;  2ZT9 B;  1VQK V;  1K33 A;  2HR3 A;  3CRA A;  1OJH A;  1YJN V;  4P9P A;  1MZE A;  2CE4 A;  3JAS B;  1VF6 C;  5EBW C;  3RFR A;  3GB7 C;  4PA4 A;  1VF5 B;  2DN9 A;  2AW9 A;  4QGP A;  4X64 O;  5C8Y A;  4JYB A;  4NXN O;  4UCS A;  3JAW B;  3ASN C;  5FLX N;  1K3E A;  2XND G;  3ZBH A;  3APO A;  2YUA A;  3JAK A;  2HEP A;  4MVR A;  3SJC C;  5B1O A;  3GWO A;  2CGN A;  3ZRX A;  1IBM B;  4D6T H;  2BOB C;  1M4U A;  3ZHQ A;  5LA6 A;  2IU3 A;  1A32 A;  5KMG B;  4DR6 B;  4UVC A;  3CRR A;  1W0J G;  4NB5 A;  4X64 B;  3SJB C;  4NXN B;  1M56 C;  3OEE G;  3UQ8 A;  4DV1 O;  1EM1 A;  1N0J A;  5LHH A;  1XBL A;  5KHG A;  3ZIA G;  4KFM A;  1NS1 A;  3ML0 A;  1QQC A;  3CMA V;  3RVZ A;  3DC5 A;  1W59 A;  3I55 V;  3ASO B;  3CXH F;  2Y48 A;  5CBG A;  2B5U A;  3ICX A;  3ABK C;  2HVK C;  2LFR A;  2YDE A;  1JJO A;  4IGG A;  4UCV A;  2HFE C;  4CS2 A;  1IBK B;  1QR9 A;  1YVW A;  1AR4 A;  5K1X A;  3BCC H;  3CCU V;  2ILM A;  3P30 A;  1WA8 B;  5IE9 A;  3WU2 Z;  4DV5 B;  2QA4 V;  5DM6 V;  4CS4 A;  1NR7 A;  2KG7 A;  5LHI A;  3BA8 A;  4PEL A;  3O9O A;  1US6 A;  1S5H C;  1Y74 A;  2KB1 A;  4GYC B;  1O9G A;  4TQF A;  3HKB B;  5JCO C;  3ABT A;  2N05 A;  1S3J A;  4TT3 G;  1NTZ H;  2MK3 A;  2IW5 A;  4TOI A;  4ZIB A;  4RUE A;  1KQS U;  2OCC B;  2RN9 A;  5L3G A;  3CJH A;  5J2T B;  2ITC C;  5D5Q A;  2CH7 B;  1RP3 B;  3CD6 V;  4NTX A;  2ZDI A;  1XI1 A;  4LP8 A;  3CB2 A;  3KKY A;  2Z0A A;  1K34 A;  1NI8 A;  3T1C A;  1KEC A;  1LR1 A;  4D7T A;  3OR6 C;  5L3F A;  2DOS A;  1OCR B;  1D5A A;  2YIC A;  1VP7 A;  4FZ1 A;  5KMG A;  5EIB C;  2OIG A;  1I7F A;  2UU9 O;  1DGS A;  2ZR2 A;  4TUY A;  2IJH A;  1RM1 C;  1I94 O;  1QLE C;  4H33 A;  2Q6A A;  1NT2 B;  1TUB B;  4PI0 A;  2Q7E A;  1N33 B;  2QWN B;  1BHB A;  3D3I A;  1LNQ A;  2P67 A;  4IYI A;  3UT5 B;  3HKC A;  5JQG B;  5IYZ B;  5L3B A;  4GX0 A;  1I94 B;  5LGU A;  5LL6 Y;  1H8H G;  3R66 A;  3NXS A;  1WA8 A;  1IUR A;  2X0L A;  4JZG A;  4J10 A;  5BXZ A;  1KYO F;  3L72 H;  1R3I C;  4O2B B;  2QKC A;  1JR9 A;  4R6Z A;  2DYS B;  2JDI G;  3L73 H;  1FAF A;  3TK1 A;  2D2C B;  1Q3E A;  5EZY A;  1SQP H;  4IYH A;  2JGD B;  4JI4 B;  3AG2 B;  1GN6 A;  1FXK B;  3C3S A;  1NR1 A;  4J42 A;  1GMG A;  4O4L B;  2IH3 C;  3HKB A;  4H37 A;  2ADP A;  4DW0 A;  3L9D A;  4LF5 B;  4FFK A;  1F7Y A;  1FOU A;  3B8N A;  2OWO A;  1SET A;  3ZED A;  1ARO P;  4X62 O;  4ASU G;  2IJI A;  1WNS A;  3RW0 A;  1F4N A;  4DUZ B;  4DR7 O;  5IT9 N;  1JX9 A;  4FFB B;  3HPL C;  4LFB B;  3C3T A;  2HJF C;  1NBM G;  2R72 A;  4UCR A;  4LFC O;  2WWW A;  3TGU H;  4UB6 Z;  2W0F C;  4O4J B;  4Q20 A;  3MDS A;  1V55 B;  2UXB O;  3CC2 V;  4LH6 A;  1HWY A;  2NNU A;  2P4K A;  1JCH A;  1SZT A;  2MW2 B;  2A79 B;  4X62 B;  3CPW U;  2Q7G A;  3AG4 C;  1P49 A;  4DR7 B;  3WB1 A;  2X7R B;  3JAL A;  1XHZ A;  1G1X B;  1AIL A;  5IY5 C;  1B04 A;  2Y0I A;  1WN7 A;  4P2Z A;  1B3Q A;  2ZQM A;  4L8J A;  1K73 W;  1WP7 A;  2XOK G;  1S0V A;  1IBL O;  4GUN A;  3FB7 C;  3H9V A;  2H3O A;  2ODM A;  3UT5 A;  4WCE V;  1GM8 A;  4FJC C;  3AK2 A;  4O2A B;  1ZL8 A;  5JQG A;  1QVG U;  4WFB V;  1FXV A;  4DV0 O;  3D36 A;  2Y4T A;  5BMV A;  2QE7 G;  2VQF B;  2G38 A;  3K5M A;  2XHB A;  3K06 A;  5JVD A;  3SPC A;  3A0H Z;  4O2B A;  2B9Z A;  1GN3 A;  1IBL B;  1R6N A;  3QO7 A;  1SKV A;  1YF2 A;  1Q43 A;  3OE7 G;  5GTH Z;  2HJD A;  2JGD A;  3IAY A;  4O4I A;  1R3L C;  1FKA O;  4DV0 B;  1EN6 A;  1L8D A;  1E79 G;  3JSN A;  4JAS A;  1V54 B;  3PJS K;  2BTO A;  4OX9 B;  2HVJ C;  3OT7 A;  5CB4 B;  4CZZ A;  2ZE5 A;  1S76 D;  5LMN O;  1JQ0 A;  3STL C;  3K58 A;  5LBQ A;  4TWK A;  2QWR B;  1M9N A;  1CXZ B;  1XMQ O;  4JI2 O;  2WA3 A;  1UPG A;  2CGO A;  3G71 V;  1THZ A;  1H2L A;  2Y4U A;  3KCX A;  5K1P A;  5LMN B;  3M8A A;  1YEW A;  4UFZ A;  3ZRV A;  2QKS A;  1N4C A;  1T5E A;  4HNA A;  4PI2 A;  1AI5 A;  4JI2 B;  2Q8V A;  3CRQ A;  2PYL A;  1G4Y B;  4ZBM A;  1ROP A;  2QM8 A;  3FAV B;  4HBN A;  4B3S B;  2UXC O;  1TVK A;  4LF4 O;  1KP2 A;  2JJ2 G;  4ZOL B;  5CA0 B;  2OIE A;  3L74 H;  2JRI A;  3FYI B;  1VF7 A;  2UUA B;  1GRJ A;  2ZM6 O;  1HR0 B;  4CS3 A;  2AHY A;  3SPH A;  1Y76 B;  1UFI A;  5BY1 A;  1VMG A;  4F6E A;  3G6E V;  2YEV A;  3H1L H;  4RUF A;  3RYF B;  2R9I A;  2E5L O;  4DV7 O;  3F5W C;  3JSL A;  4N21 A;  1VQ8 V;  2LJ2 A;  2QSA A;  4LF4 B;  2E3C A;  1DK1 A;  3LDD A;  5J2U B;  2F4V O;  2ITD C;  2FYU H;  2EZO A;  1MNG A;  4X1Y B;  3HR0 A;  4QIW F;  1QLN A;  3CCR V;  1J95 A;  3OD4 A;  4I4T A;  4UUJ C;  3CCJ V;  3B40 A;  1QBZ A;  1R73 A;  2E5L B;  3DC6 A;  4DV7 B;  1YZB A;  4JTA B;  1N32 B;  5CB4 A;  2KSD A;  2EIK C;  3LSS A;  1S77 D;  2XAQ A;  1KU9 A;  1WPX A;  2F4V B;  1BSM A;  5H9C A;  4DV3 O;  3E22 B;  5KX5 B;  3FFQ A;  1V9P A;  5CA3 A;  1QVF U;  4I7Z B;  1YDX A;  1FFT B;  1Y6X A;  2L6L A;  1AI4 A;  4I9Q A;  4U7O A;  1DTO A;  2ARH A;  3OR7 C;  4LF9 O;  2EIJ B;  5KHH A;  4X20 A;  4NYK A;  2JJ1 G;  3OMI B;  1BS3 A;  5EBL C;  1XQ8 A;  3I56 V;  4EFB A;  2IJJ A;  2YID A;  4X66 O;  3FB5 C;  2M7W A;  4DV3 B;  3STZ C;  2W6J G;  2DQ3 A;  4JI0 O;  1OHH G;  4DXW A;  5IYC O;  4K8X A;  2FTK A;  5KHK A;  2HP8 A;  2Q4P A;  3CXC U;  1PL4 A;  4J9Y B;  3QF7 A;  4LF9 B;  1BQ0 A;  4ZOL A;  1YTF B;  4DR4 O;  4J7Z A;  1XNR O;  4LWS B;  4H44 B;  5CN0 A;  2XAF A;  1H2K A;  3SYO A;  3CCE V;  2OTL V;  5L3E A;  5B3S C;  4DV4 B;  1S5L Z;  4WBN A;  3ZN1 A;  4F4L A;  3ZHR A;  4JYY A;  4G27 B;  5L3C A;  3CHX A;  3RYF A;  1VQ7 V;  4KL1 A;  1FXH A;  3SGI A;  1FS0 G;  1HP8 A;  3FD9 A;  2BSK A;  3AG3 C;  4J11 A;  3TXS A;  2KKW A;  2ZXW C;  3OGI B;  5J2U A;  4X1Y A;  1NU1 H;  2E76 B;  1YXB A;  2RMK B;  4EKW A;  2PI5 A;  3T4D A;  5LHG A;  1WJZ A;  4H0L B;  2BE3 A;  5H5N A;  1Q6U A;  5GON B;  1PKX A;  3K57 A;  1B06 A;  4WFA V;  1JVM A;  3ABK B;  4J80 A;  3C90 A;  2LW7 A;  2GDS A;  1XNQ O;  1KB9 F;  2PGG A;  3CS5 A;  5KX5 A;  2FKX A;  4U3F H;  4X88 A;  3RN4 A;  2ATK C;  4L87 A;  4CC6 A;  1KKD A;  1OCO B;  1S5J A;  4DK0 A;  3ZHT A;  3JD1 A;  1X4T A;  3BVO A;  3JCZ A;  3KG2 A;  4U3J A;  5IJ0 A;  2FL4 A;  3OTO O;  3OGC C;  2EIN B;  3I5D A;  4IT5 A;  2ZKO A;  1RFY A;  4GKK O;  1FJG O;  3QG5 A;  1F23 A;  4MVM A;  4IL6 Z;  4B7K A;  1JJ2 U;  3OMN B;  2GHY A;  1OCZ C;  1M93 A;  2L35 A;  4FLU A;  2PYJ A;  4MSW C;  3ETD A;  3ABL C;  5GW7 A;  3ABM C;  2OCH A;  1HNZ O;  3OTO B;  3CWB H;  1K4D C;  3JCU Z;  3T1Y O;  1MOF A;  3RGB A;  4UVA A;  4X1K A;  4DUY O;  4RQE A;  4U7N A;  2YIB D;  4X89 A;  1IXM A;  4TSF G;  1QU7 A;  4DV1 B;  4IIJ B;  4FZ0 A;  2QTO A;  2YXL A;  1NQT A;  4NTY A;  1N36 O;  5B66 Z;  5AG2 A;  2WLI B;  2HLD G;  1GM9 A;  4I50 A;  1HNZ B;  4FMT A;  1PL0 A;  4QJF B;  3L71 H;  1AP5 A;  1CP9 A;  2P22 C;  4JI5 O;  1JNB A;  1PM9 A;  2IJK A;  1KUQ A;  5GON A;  1SER A;  2N74 A;  4ZKI A;  3D8C A;  5KA6 A;  4G28 B;  1SF9 A;  3WFV A;  3IC9 A;  3OW2 U;  1AB3 A;  4IHJ B;  2ZDI C;  3IJ4 A;  3SJA C;  1BL8 A;  1PV0 A;  1Z2G A;  2WLH A;  4QPK A;  1SQF A;  1XL4 A;  1Q8I A;  4OXS A;  3JAS A;  1JMK C;  3QTC A;  1YI2 V;  3W7W A;  4PA7 A;  3K9S A;  4PV1 B;  4JI5 B;  5IYB O;  3JAW A;  4P9O A;  2IBZ H;  2AHZ A;  2F93 B;  3TET A;  4FLV A;  3LUT B;  4YIP A;  4HZ3 A;  1ZX3 A;  2Q0O C;  1Q7Y W;  1FYJ A;  3W7U A;  2DWE C;  1NTM H;  1VAR A;  1XDC A;  3M99 B;  4JPR A;  1GH6 A;  3BY6 A;  1MA1 A;  1AVM A;  1Q86 W;  3ABU A;  4LR3 A;  1NZ6 A;  3ETG A;  2R9A A;  4I0X B;  2JK5 C;  3RYC B;  4JTC B;  3X2Q B;  5KAI Z;  5DEC A;  5EC2 C;  2DW4 A;  1XIL A;  1TA8 A;  4AI8 A;  4DW1 A;  4JYA O;  3M7M X;  4NTW A;  2XAG A;  2UU9 B;  2NN4 A;  3K59 A;  1FFX B;  2WA4 A;  2E74 B;  4IIJ A;  3E35 A;  5KUM A;  4LF6 O;  2VWK A;  5KLV H;  2QTS A;  1U96 A;  1JPX A;  1MG1 A;  2UXX A;  4JI7 O;  1SES A;  3CEI A;  5KA5 A;  4I5S A;  3CCS V;  3BAB A;  2WLJ A;  5JJE B;  4GZR B;  4JYA B;  4KHP O;  1QR8 A;  3OFN G;  5IY5 B;  2Z5U A;  3G80 A;  2JEX A;  4PA3 A;  5LXT B;  1SS3 A;  1M57 C;  4DO2 A;  1JFF B;  2OCC C;  3Q4H B;  1GN4 A;  2Y69 C;  4JI3 O;  1N8R W;  1R3J C;  4LF6 B;  4QE7 A;  1ORQ C;  3ZMU A;  4JI7 B;  3EXA A;  4IHJ A;  5EK0 A;  5H6R A;  1GO3 F;  3K03 A;  4MTG A;  4KHP B;  3FB8 C;  3AG1 B;  2QWO B;  3ZMT A;  3N2G B;  3GVM A;  5J2T A;  3BAA A;  5EYP B;  1HNW O;  1VQL V;  3F5T A;  2CH7 A;  4PJ0 Z;  4WF9 V;  4YY3 O;  4X65 O;  2ZIM A;  3RYI B;  1RSO B;  4B7E A;  3UO2 A;  3LSU A;  4JV5 O;  4FLY A;  5CA1 B;  5LP6 B;  1YHQ V;  1I5Y A;  2VS0 A;  1K8A W;  4QNH B;  4YJ2 B;  5A9G A;  3ETQ A;  1AR5 A;  5HFM A;  1TGO A;  5LGT A;  4YHH O;  3J80 N;  1RPR A;  3E89 A;  1H2S B;  4JAA A;  2W6I G;  1HNW B;  1SA0 B;  3VQV A;  4LCU C;  3QVN A;  2QGN A;  4YY3 B;  2GTA A;  3CC4 V;  4X65 B;  1N34 O;  3D36 C;  1TUB A;  4GX1 A;  3RYC A;  2BTQ B;  4R8C A;  4LFC B;  2AZ2 A;  1OV9 A;  4DR3 O;  3J81 N;  1Y67 A;  4PDM A;  1OCC B;  2UXB B;  2DYR B;  1ZWI C;  3BEH A;  1D2D A;  4FM2 A;  3WB0 A;  2ZCE A;  1QCE A;  3T4Z A;  5KHJ A;  2DYS C;  2XAJ A;  5IYZ A;  2P4V A;  4I55 B;  3MHH C;  1FD9 A;  1Q82 W;  1N34 B;  1FXK C;  4BR6 A;  5F2V O;  1AP6 A;  2LFS A;  3W7S A;  1WPB A;  4YJ3 B;  2LQT A;  2QEX V;  2KQX A;  2YXH A;  5IJ9 B;  3OM3 B;  1BE3 H;  2XAS A;  1SQG A;  3JAR B;  1BQZ A;  3W7T A;  1BMF G;  2A0L A;  5LXT A;  4DV2 O;  1XUQ A;  2A9H A;  1PNM A;  3Q4H A;  4E2L A;  1FXK A;  4GLX A;  3SR2 C;  3WG7 C;  3FX7 A;  4K35 A;  1WLE A;  4O4L A;  3MAQ A;  1M1K W;  2YIA A;  2GBO A;  2Q69 A;  1AJN A;  1G8M A;  3QO8 A;  4UVB A;  5KHI A;  3EFF K;  2CTQ A;  5LOV B;  5KUK A;  1KP3 A;  2JS3 A;  1L0L H;  2AXT Z;  2PUS A;  2WLK A;  4MVQ A;  5EYP A;  3TJT A;  4DV2 B;  4MVU A;  4BIO A;  3JYC A;  4PA9 A;  5JJJ B;  1IVS A;  3OMA B;  4FFB A;  5FPR A;  3SYA A;  2EIM B;  2Q67 A;  3RYI A;  1RSO A;  1UJW B;  4Z1M G;  1KKC A;  1KC8 W;  1H2N A;  5B1A C;  4EB6 B;  4H13 B;  4O4J A;  2JGU A;  4YJ2 A;  2WPD G;  1I08 A;  3ZMZ A;  5B1B C;  3A0R A;  1JA8 A;  1SA0 A;  1VQN V;  1BCC H;  2IH1 C;  2UUC O;  2QKA A;  1XMQ B;  2EIK B;  5JH7 B;  3VQY A;  4X1I B;  1M90 W;  3K08 A;  4O4H B;  1U97 A;  2V4D A;  4KXR A;  4NVP A;  4RWU A;  5ITZ B;  1DF5 A;  1H5W A;  4BW5 A;  5IWA O;  2A06 H;  4QE9 A;  4BAY A;  3VQX A;  3AEI A;  2X6A A;  5C93 A;  2P90 A;  4O2A A;  4NR1 A;  3S3W A;  1GKF A;  1IXB A;  2R70 A;  3SYQ A;  5EBM C;  1YSC A;  2Q68 A;  3KZI Z;  3LNM B;  3R65 A;  4C7U A;  2UXC B;  1V54 C;  2ZR3 A;  2GUZ B;  2HKO A;  3E8B A;  4LC1 A;  5IWA B;  1WB7 A;  3JAR A;  4K0K O;  1SZX A;  2EZP A;  2ZM6 B;  3K5N A;  2QWQ B;  1SQB H;  4DRX B;  2WLM A;  2CDY A;  5B1N A;  2EBO A;  2OTJ V;  2CUG A;  4B3M O;  1HW7 A;  4LNU B;  3P3N A;  3L75 H;  2EUL A;  3E8F A;  1SC5 B;  3ZMV A;  1XMO O;  3PN1 A;  1K92 A;  4FVM A;  1NJI W;  4K0K B;  2ETN A;  2CTR A;  3K0D A;  4CH4 A;  3CME V;  1I0H A;  5H6Q A;  3H1K H;  3OUS A;  5FPO A;  4LFA O;  2UUB O;  3K04 A;  4BW9 A;  3D3Q A;  2AGA A;  4NXM O;  4B3M B;  3B4S A;  2P5O A;  5EIB D;  4EB6 A;  5CBH A;  3H01 A;  2V7Q G;  1GK9 A;  3SPG A;  1XMO B;  5FL7 G;  1XL6 A;  2O57 A;  4MS2 A;  2B1G A;  3H1J H;  3THO A;  2FB5 A;  2RDC A;  4HYO A;  4D7S A;  4MTF A;  4JTD B;  3APQ A;  4LF7 O;  4DR5 O;  4UCU A;  2NLJ C;  2YXY A;  3HKD B;  5JH7 A;  1PD3 A;  3RYH B;  4X1I A;  1COW G;  3FAV A;  3JAK B;  3W7X A;  4B3R O;  2QM7 A;  2H8P C;  2EIL C;  2P06 A;  3FYE B;  5CA0 A;  4LF8 O;  2IM9 A;  4X66 B;  3SYC A;  1IDS A;  4JI0 B;  2CK3 G;  3ASN B;  2Y0P A;  5E1A C;  3UM7 A;  3OAA G;  1Y76 A;  4DR5 B;  2IU0 A;  1SQQ H;  2GTS A;  1XRE A;  5IDJ A;  1SRY A;  5LMU O;  3GWK C;  2WLL B;  4JAV A;  2C2A A;  3B8M A;  1X59 A;  2ZIO A;  2H94 A;  1J5E O;  2GUZ A;  2XTA A;  4PDR A;  4DR4 B;  1YCI A;  1XNR B;  1HNX O;  4LF8 B;  1YIT V;  4MW8 A;  2LP7 A;  1M56 B;  3N27 A;  1FPO A;  2R9R B;  2E75 B;  3ZCC A;  1OCZ B;  4N23 A;  3JAM N;  3KDR A;  1R6K A;  3ABL B;  1K97 A;  1J5E B;  3B09 A;  3JD0 A;  4HAM A;  5L3D A;  4DR1 O;  3A0B Z;  1HNX B;  1IZ3 A;  2EIJ C;  2KG7 B;  4NKG B;  3VQW A;  3E22 A;  1Q6H A;  2RCV A;  1L1F A;  3RBZ A;  4MW3 A;  1Y74 B;  1P4R A;  3SDL A;  1GTO A;  5EC1 C;  5BR8 O;  1Q81 W;  1K9M W;  4UV9 A;  4FIP C;  5HFL A;  1Y4M A;  1IBM O;  5LYJ B;  1BT8 A;  3SPJ A;  4DR1 B;  1Z5V A;  1BHA A;  1B6Q A;  1XNQ B;  1WB8 A;  2ZNI A;  3CCQ V;  4DR6 O;  3CE2 A;  2W0X A;  3BPZ A;  3CJH B;  3RVY A;  3OEH G;  5FNV B;  3DGE A;  3G4S V;  1Z5W A;  4FPP A;  3LNN A;  1EFR G;  3KCY A;  3HKD A;  2Q73 A;  4DR2 O;  5BR8 B;  3RYH A;  4P30 A;  1VF6 A;  2ZNJ A;  2CAZ C;  1EZV H;  1WP8 A;  1VQP V;  4J7J A;  4LWS A;  3WB2 A;  3CC7 V;  1H2G A;  3SYP A;  1GAX A;  1IBK O;  3HKE B;  3ZJZ A;  4TUY B;  1FJG B;  4GKK B;  3JD2 A;  1AI6 A;  1HDJ A;  2DE0 X;  4CBC A;  4DR2 B;  3IGA C;  2WLL A;  4UXN A;  2QJ1 A;  4GCZ A;  1MSD A;  1SQV H;  1VQ9 V;  2B1I A;  3E8H A;  4RQF A;  4DV5 O;  2XAH A;  2QWP B;  1NKD A;  4CH3 A;  2FML A;  3T1Y B;  1RM1 B;  1QLE B;  3HKC B;  4DUY B;  2VQE O;  3CCL V;  3UCS C;  3E86 A;  3LSQ A;  1VIB A;  2ZE6 A;  2X6C A;  1PNL A;  1OCO C;  3MD0 A;  2PF4 E;  5CMU A;  1AR1 B;  1KD1 W;  2RJZ A;  3P32 A;  1N36 B;  3CCM V;  1LUV A;  3AK1 A;  2LGW A;  4F6R B;  5EZY B;  5E79 Z;  2EJ7 A;  2VQE B;  1VQ6 V;  4TV8 B;  2K1E A;  2EIN C;  1K5Q A;  1I5X A;  4JI6 O;  3NR7 A;  4E4E A;  3AG7 A;  3UO3 A;  5LYJ A;  3FKS G;  1M57 B;  2HHH O;  2Q5Z A;  2Y69 B;  4ICG A;  3ZX6 A;  1E1R G;  1AJP A;  3ASO C;  4LH7 A;  5FNV A;  1CPY A;  1TAE A;  2NR5 A;  5JCO A;  3OUF A;  3SJQ C;  2F1M A;  4CH6 A;  5JWP A;  3ZHV A;  1K4C C;  4I9W A;  4JZ2 A;  2PZS A;  4KP4 A;  2BOC C;  4JI6 B;  1N33 O;  2XT9 A;  1MMM A;  3MHS C;  3ZHS A;  3JAT B;  2UXD O;  1K7D A;  2HHH B;  3AK3 A;  4OGQ B;  4FLT A;  1H2M A;  4Z2W A;  3G6B A;  5IYD O;  3HKE A;  4GT1 A;  3JAL B;  1ENV A;  3E2E A;  2CTW A;  3JD3 A;  2OYQ A;  2EJR A;  1MZF A;  1IJG A;  5CBF A;  2ADQ B;  4FM1 A;  2X6B A;  2UXD B;  2JVD A;  3CX5 F;  2D3O W;  2WLI A;  4AQY O;  3AG4 B;  3B2E E;  4DK1 A;  1H8E G;  5KAF Z;  1ZL8 B;  4JI4 O;  5TIS Z;  2Z3Y A;  2AZ0 A;  5BMV B;  4QPJ A;  1VQO V;  1ZAU A;  2JEU A;  4K3A A;  4TV9 B;  1L0N H;  3CRM A;  4B3T O;  4W4K A;  5JVD B;  4LF5 O;  3ZRS A;  4BWA A;  3DXR B;  3E83 A;  4WFF A;  4AQY B;  4F6R A;  4J9Z B;  4O4I B;  4DUZ O;  3F7Y C;  4A5U B;  2YSU B;  4TV8 A;  2WAM A;  1OCR C;  4AIL C;  1ZSP A;  2Q0A A;  3QO5 A;  4JI3 B;  4MVS A;  4LFB O;  2WLN A;  4CC5 A;  4B3T B;  4MTO A;  1KBH A;  4UCT A;  1Q90 D;  3VBB A;  1YIJ V;  4W4L A;  3CP1 A;  1WAZ A;  4ZHQ B;  2PTM A;  2QDO A;  3X2Q C;  3ZRW B;  3U11 A;  3F7V C;  3WG7 B;  3O65 A;  4FK5 C;  1R1B A;  1R3K C;  3T2M A;  1DF4 A;  2OT5 A;  4TQD A; 
#chains in the Genus database with same CATH homology
 1IX9 A;  2ADP A;  1MMM A;  2CE4 A;  5AG2 A;  1IDS A;  3CEI A;  4FFK A;  4BR6 A;  1IXB A;  1AP6 A;  3AK3 A;  3OT7 A;  2AW9 A;  1XRE A;  3DC6 A;  4C7U A;  1AP5 A;  1PM9 A;  4YIO A;  1QNM A;  1EN5 A;  1B06 A;  1MSD A;  1GN4 A;  1WB7 A;  1BSM A;  1SZX A;  1XUQ A;  2ADQ B;  3IC9 A;  3KKY A;  2GDS A;  3C3T A;  1ZLZ A;  2CDY A;  4X9Q A;  3RN4 A;  3MDS A;  1VEW A;  3EVK A;  3K9S A;  3KDR A;  1D5N A;  2P4K A;  1EM1 A;  1N0J A;  1BS3 A;  1ZUQ A;  3TJT A;  3DC5 A;  4YIP A;  3BFR A;  1LUV A;  3AK1 A;  1I0H A;  3LSU A;  2RCV A;  1KKC A;  1VAR A;  1XDC A;  5A9G A;  4GUN A;  1PL4 A;  1AR5 A;  1GN2 A;  1P7G A;  1MA1 A;  1AVM A;  1AR4 A;  3AK2 A;  1I08 A;  1ZSP A;  4E4E A;  3QVN A;  1BT8 A;  1JA8 A;  1EN4 A;  2QKA A;  1WB8 A;  4JZG A;  4F6E A;  1N0N A;  2QKC A;  1JR9 A;  1ZTE A;  1XIL A;  1Y67 A;  1LUW A;  4JYY A;  1GN3 A;  1GN6 A;  3C3S A;  4JZ2 A;  1MNG A;  1EN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...