3LSUA

Crystal structure of sod2 from saccharomyces cerevisiae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
204
structure length
190
Chain Sequence
b'VTLPDLWDFGALEPYISGQINELHYTHHQTYVNGFNTAVDQFQELSDLLAEPSPANARMIAIQQNIFHGGGFTNHCLFWENLAPESQGGGEPPTGALAAIDEQFGSLDELILTNTLAGVQGSGWAFIVNLSNGGLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNADYFAIWNVVNWEASRRFDAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Crystal Structure of SOD2 from Saccharomyces cerevisiae
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 61
structure length 190
sequence length 204
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3lsuA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3lsuA02
2CDYA 1GN4A 1LUWA 1XUQA 1EN6A 3IC9A 4JZGA 1EN4A 1XDCA 1MSDA 1BS3A 1B06A 1ZLZA 3LSUA 1ZSPA 3AK3A 1Y67A 3BFRA 1QNMA 5AG2A 1AR4A 1JA8A 1MMMA 1EN5A 4JZ2A 2CE4A 1AP5A 2P4KA 4BR6A 1WB8A 3QVNA 4YIOA 2AW9A 1MA1A 4E4EA 1GN2A 2ADPA 1I0HA 4YIPA 5A9GA 1D5NA 1EM1A 1SZXA 1VARA 4GUNA 3EVKA 1VEWA 4JYYA 1IXBA 1PL4A 1ZUQA 4C7UA 1XILA 1GN3A 1N0NA 4X9QA 1JR9A 1PM9A 2ADQB 1WB7A 3KKYA 3TJTA 1KKCA 1MNGA 4FFKA 1IX9A 3AK1A 2QKCA 3DC6A 1N0JA 3MDSA 1I08A 1BSMA 1AR5A 1P7GA 3K9SA 2QKAA 1ZTEA 3DC5A 2RCVA 1IDSA 3OT7A 3CEIA 1GN6A 3AK2A 1AVMA 1LUVA 3RN4A 1AP6A 3C3SA 3C3TA 1BT8A 1XREA 4F6EA 2GDSA
chains in the Genus database with same CATH superfamily
5LYJA 1GO3F 5JH7B 5EBLC 3H1LH 3FAVB 3RFRA 4DYLA 4PDMA 1KUQA 4MTFA 3K59A 4JTDB 3ZN1A 1ZLZA 2L6LA 3KDRA 4RAIA 3OUSA 2PTMA 1Q5OA 5IJ0A 4KFMA 2XAGA 3A2FA 1JQ0A 3JARB 2Q0AA 3I55V 4DR6B 1QU7A 2WLLB 1TVKA 4PA9A 1GKFA 3WG7B 3SDLA 3HKDA 1FOUA 1F7YA 2QJ1A 1XNRO 3UQ8A 1M9NA 1KP2A 5IYBO 3GWKC 3FAVA 3SYPA 1F4MA 3ICXA 1GMGA 1NQTA 2Q67A 3U0ZA 2VWKA 2Y0PA 4JI8B 1MZFA 2WLIA 3SR2C 4B3SO 2UXDB 3H9VA 3EHBB 1YCIA 2WLLA 3MD0A 3E83A 4JI0B 1KYOF 2V7QG 4HNAB 3UO3A 2F23A 2F4VB 4MW3A 4DR6O 3D8CA 2JEXA 1CXZB 1TUEB 5D5PA 2XOKG 4X20A 1RPRA 3SJCC 3STLC 1D5AA 1VQOV 1PP9H 1EN6A 2IM9A 5B3SB 5L3CA 3R66A 1L0LH 1VQ7V 3VQYA 4DW0A 5J2UB 5L3EA 2JJ1G 1XL4A 2DYRB 4X1KB 2ODMA 5IY5B 4LCUC 1IZ3A 4ZHQB 5CA0B 2A0LA 3WB0A 4E2LA 1H2NA 2ZIMA 3ETEA 1E1RG 2AXTZ 4RO2A 1RPOA 2B9ZA 1SKVA 1W2BU 3M7MX 2ATKC 3SJQC 1EZVH 1QBZA 2ZD9A 1FXKB 1EM1A 4NKGB 2CTQA 3OGIB 4L8JA 2JGDA 3ZHQA 1SZXA 5LMNO 1Z2GA 1N8RW 3ZIAG 3EVKA 1H8EG 4NYKA 3OW2U 4JYYA 2A7WA 3CXHF 3SYAA 4BIOA 2P22C 3P3PA 4QIWF 2V4DA 1VF6A 4X1KA 1OCOC 2IJKA 5GW7A 3T4DA 4R8CA 4WFEA 4ASUG 1F23A 2VQEB 4NTWA 1YIJV 4ZHQA 5CA0A 5H9CA 4JI6O 1WN7A 3QO5A 4CC6A 2OIGA 4YY3O 1VQ5V 1K8AW 3R65A 5FLXN 5KHHA 4PA3A 4JI7O 1FAFA 2RJZA 1I94O 1FXKA 1K5QA 1BCCH 2FL4A 3D36C 5B1OA 4DR4B 3JATB 5KHIA 2OYQA 4YJ2B 1PKXA 4LF6O 3OGCC 4RUFA 1OCCB 1VF7A 3RYCB 4N21A 4K8XA 1WP8A 2DMXA 3JCZA 2RN9A 2CTRA 2VQFO 4EKWA 1J5EO 2H3OA 1N34O 1QCEA 1R3IC 2QDOA 4P2ZA 3ZMSA 3A0RA 3O9OA 3HB3B 5DECA 4GX0A 4UCOA 1DF5A 3CXCU 2EINC 4B3TB 2BTOA 2QM8A 1S3JA 1ENVA 4JAUA 3RYIB 1F51A 1XDCA 1OCZC 4XDKA 5CBHA 2GUZB 1XHZA 3E8BA 3JATA 4I0XA 1O9HA 3BFRA 3VOUA 3JD0A 4GKJO 3KCXA 4OPHA 4YJ2A 4NXMO 1CEZA 4R6ZA 2PYJA 3ABMB 4X1IB 2UXCO 3RYCA 1SQXH 3OEEG 4DR2B 2P06A 2HJDA 4BW5A 4FMTA 5KUKA 3ZCCA 3JAKB 5LHGA 2EJ7A 3ABLC 2WPDG 1EBOA 3IFXA 3RYIA 2V1DA 2JS3A 3UT5A 2M7WA 5BZBA 1YTFB 1N33B 2QGNA 1Y76B 3FB5C 1FKAO 4O2BB 4UV9A 1JJ2U 1XNQB 5HFLA 4WF9V 1QVFU 2EILB 3HKEB 2GV9A 3ASOB 5LXTB 4PJ0Z 1ZX3A 4U7NA 2BTQB 3I56V 2LP7A 3OTFA 3HR0A 3TXQA 1UJWB 1G1XB 4X8AA 3BA9A 5C93A 4BWAA 1IBMO 4DV1O 3CC7V 2Q9LA 1YXBA 2E75B 1Q81W 3K79A 5KHKA 4MVQA 1ZL8B 4O4IA 1Y76A 2NNUA 5GONB 4O2BA 1AVMA 4FJCC 1LUVA 5LHHA 5GTHZ 3E89A 4YJ3A 1NVPD 1XEQA 4DRXB 3HKEA 5F2VO 3BHPA 1N33O 1M1KW 3K5NA 2OT5A 5EZYA 2LFSA 1J95A 1IBLB 3CRQA 3SYOA 2EBOA 1HNXB 2ZE6A 1BZKA 1OZ0A 3OD4A 2Y69C 3ZHTA 5IYZB 1KP3A 1AROP 4UB6Z 1IBKB 4GKKB 5JJEB 5GONA 5JCOC 1MOFA 4X65O 4FIPC 2ZE7A 2IU0A 4JI3B 3H1HH 2P90A 2DW4A 1D5NA 4DRXA 4YHHB 1AILA 2YIBA 1IXMA 2D2CB 3U11A 1H2KA 1FJGB 1IXBA 2QEXV 3ZHUA 4FLTA 3MHHC 3CSXA 4AQYB 2UUCB 1Q7YW 1Q6UA 1IJGA 3Q4HB 5IYZA 4I7ZB 3A0HZ 5EYPA 1TUBB 1H2LA 1D2DA 3SPGA 1AI7A 5KUMA 2VWJA 3UO2A 1RFYA 4DUYB 1GM8A 4JF3A 3JD2A 3CCSV 1WA8B 1QLEC 2ZCEA 1HNZO 4ZOLA 1AR5A 2Q7HA 4DV3B 4X62B 2X6CA 5JQGB 4OX9O 1L1FA 3ZS8C 1NH2D 1IVSA 1W59A 3SYCA 4ZBMA 2UUAO 2E76B 3G80A 3Q4HA 1R3KC 4CH3A 2C2AA 1TUBA 4DR1B 1XUQA 3K9AA 3CS5A 2UUCO 5B1NA 2Q5ZA 3FD9A 4NXNB 2ZR3A 1B06A 1Q82W 2PI5A 4CS2A 4JAAA 4X66B 5B1BC 2EZOA 2QWQB 4RQEA 3MAQA 5EIBD 3K04A 1KQSU 1HR0O 4OPAA 4YIOA 1SQVH 3ZX6A 1KC8W 4B7KA 3ZHSA 2KSDA 5A9GA 3G6BA 3HKBB 1M56C 3ZHVA 2PUSA 2QWOB 3TGUH 1OCZB 4LF5B 4TUYB 1M90W 3D36A 4JV5B 1HW7A 3CCJV 4A5UB 4I55B 3AEIA 4JYAO 5CN0A 3J80N 4YXWG 1LR1A 1Q90D 4UCVA 3CCEV 4LP8A 3K5MA 5JJNB 3T1HO 1AJPA 3MHSC 2ZIOA 1PL0A 1WB7A 2YXYA 3ZMVA 1BHBA 1WAZA 2R70A 2YC0A 3H1KH 4MSWC 4QPJA 2GTAA 4I4TB 1SRYA 3ABLB 1QHTA 1FFTB 2XT9A 2QSAA 1T5EA 4HBNA 1NU1H 3K58A 5EBWC 4TUYA 3CRCA 2NLJC 3ML0A 4I55A 5LOVB 4TV9B 3DC5A 2RCVA 3JASB 1YVWA 3RBZA 1S5HC 3LDDA 1GAXA 1ZAUA 2BOCC 1YHQV 3BY6A 1COWG 4X1YA 2DYSC 1H2MA 2CDYA 3B77A 4QE9A 5LMUO 3IC9A 4I4TA 5IJ0B 3N2KB 3QTCA 1BGYH 4FLZA 3CCRV 3RYFA 1MSDA 1BS3A 2RNBA 5CA1B 1XNRB 5A2QN 4G27B 5H6QA 5LBQA 1I7FA 3CHXA 1SETA 4DV0B 5LOVA 4TV9A 4IYHA 4DV7O 3JASA 4H44B 5C8YB 1MA1A 2JVDA 3T1YO 2BE3A 1SF9A 1I0HA 2ZM6B 3ETQA 4B3SB 3BRCA 1G4YB 4K0KO 2M6YA 3N2KA 1YJNV 3AG4C 2WLIB 2Y69B 4WFBV 2UXBO 5CA1A 1TAEA 2CGOA 1XQ8A 3EXAA 4X64O 5JVDA 2LW7A 2ZNJA 1Z5VA 2OTLV 2YICA 2B5UA 5C8YA 1KKCA 1NKDA 5TISZ 4LC1A 2GTSA 1GTOA 3CCQV 4DV0O 4DV2O 1JCHA 3JD4A 4CS4A 4TQFA 4LFCO 1KKDA 4JGSA 1V54C 4X20B 2ZM6O 4LF8O 5BY1A 3KG2A 2XNDG 1K7DA 4XBFA 4KUMA 1VIBA 2PF4E 2RDCA 3TXSA 5LHIA 5IE9A 5K1PA 3C3SA 5JCOA 3CE2A 5B1AB 1FFXB 4D6TH 2X6BA 5L3BA 2UUBO 4O4HA 3STZC 1QLEB 2DN9A 2KKWA 5JWPA 4LFAB 2BCCH 1EN4A 2DWEC 3ABUA 1VQPV 3OUFA 1P7BA 4QNHB 4DXWA 1WPXA 2YUAA 5LMNB 1N36O 1AR4A 3OMAB 3UKMA 3BABA 4CH4A 2N05A 2CE4A 1YTFD 1V55C 3AG3C 3FYIB 2E5LO 4KXRA 2JIZG 2JGDB 4PI2A 2WLMA 3FX7A 3SPIA 2XAFA 5L3GA 1FXVA 5B66Z 3OEHG 4GYCB 1AI4A 1FFXA 4EEQA 1K33A 2A06H 4JI6B 3FB8C 1MSWD 4GUNA 4YY3B 3WU2Z 4JI7B 4UCTA 2ITCC 4O2AB 4C7UA 1I94B 1BE3H 5B1BB 1AJNA 4MVOA 4LFAO 1CP9A 3W7UA 2Q8VA 4J7JA 4DUZO 4LF6B 1XOUA 4CH5A 1G8MA 4FLVA 3P30A 4J11A 3TJTA 2VQFB 4PI0A 1J5EB 1YF2A 1M56B 1N34B 3E2EA 1URFA 3W7XA 5FNVA 1X59A 3VBBA 1Q8IA 4K35A 4UVBA 3K03A 2DJVA 1RM1C 1NJIW 3B4SA 3I5DA 3ZHRA 4BW9A 1A32A 2JJ2G 1WP7A 4UFZA 2QKAA 4O2AA 4H0LB 1YJ9V 2R9RB 3E8FA 4OGQB 4GKJB 1ORQC 2OWOA 3CX5F 4NXMB 1AP6A 4DV4B 2FMLA 2LW1A 1SA0B 4RWUA 2UXCB 1XREA 2UU9O 4TSFG 3HKCB 1AB3A 1NZ6A 4I0XB 4GX5A 2IJIA 3AG7A 1P49A 3A0BZ 1N4CA 2FYUH 4LH7A 1PPJH 5BXZA 4RQFA 5LGTA 1H2SB 4O4JB 3OMNB 4UCRA 1OV9A 3ETDA 3ASNC 2WLKA 3RGBA 2DYSB 3W7SA 3ABTA 2ZXWC 3UT5B 1SA0A 2CH7A 4U3FH 4J42A 4IIJB 4LH6A 2IJHA 4J9ZB 3HKCA 1U96A 3SJBC 4Z2WA 3ETGA 5GTIZ 4DV4O 3U10A 3K5OA 2Y4UA 4DW1A 3CC4V 3K5LA 1JPXA 3LNNA 2JS5A 1XMOO 1IBMB 2Q0OC 4DV1B 2Y48A 2ADQB 4O4JA 1B6QA 2EJRA 4JPRA 4MVRA 4FFKA 4B08A 4J7ZA 3NR7A 4BIZA 3RT3C 4ABMA 4PV1B 1HWYA 4IIJA 1R6NA 2IJJA 3SJAC 1P84F 3AG4B 4O4IB 4DV6O 1FS0G 1FPOA 1YJWV 4YJ3B 3CMEV 1YITV 3B2EE 4GLXA 2ARHA 5EZYB 3QO8A 2X7RB 4F6RA 1OJHA 1XMQO 4QPKA 4GT1A 1M57C 2FTKA 4X65B 2HVJC 1V54B 5ITZA 2EIMC 4DV5O 4J41A 1BHAA 3JSNA 1ZSPA 1Y67A 1E79G 2E3CA 1OCRC 2LO1A 4TV8A 2Q69A 4EB6A 3L70H 1H38A 1AP5A 3LDCA 1Z5WA 4BR6A 2CTWA 4GZRB 1XHXA 5FPOA 2AW9A 4LF4O 5CBGA 2PZSA 3IC7A 2ZT9B 2E74B 3IAYA 3FB6C 2ZQMA 4DR5O 2K1EA 5EK0A 3FYEB 4UCUA 1BQ0A 4HAMA 2Q7GA 5EYPB 1AI5A 1JNBA 1N0NA 2CK3G 1V55B 3WFVA 1R3LC 1HNZB 5DN6G 1L0NH 1K4CC 2WLNA 1JFFB 1GRJA 3P32A 3JAWB 4OX9B 2VRZA 3A8TA 2CGNA 2AZ2A 2OTJV 4GX1A 4OXSA 4FPPA 2UUAB 4ZOLB 2WLJA 3AK1A 3AG2C 2QKCA 3L72H 4Q6GA 3SGIA 1KU9A 2YXLA 3UCSC 1I08A 1Q3EA 1VMGA 3JD1A 2QTSA 2PY5A 2XUMA 4NTYA 1YZBA 4TT3G 2YS8A 3K9SA 2HKOA 2Z0AA 1ZTEA 4UVCA 4FLXA 4LFBB 2NN4A 3RWRD 2QWRB 1GN6A 1KMIZ 4Z1VA 2OCCC 1WPBA 3AK2A 4N23A 1AI6A 2F95B 3C3TA 1JFFA 1SESA 2JRIA 3JAWA 1HR0B 1Q6IA 1Y74A 3KCYA 4BAYA 2IH1C 1RM1B 4PA6A 4WCEV 1N32O 2P7TC 2EIJC 1CPYA 3VQXA 4DO2A 1OCOB 3ZMZA 1M4UA 4FZ1A 3L71H 1SQPH 1V9PA 3B40A 4JYAB 3JALB 3OMIB 3S3XA 1WB8A 4MVSA 1KD1W 1I5XA 3ZJZA 5KA5A 3T1HB 2PGGA 1TGOA 4Q20A 4IYIA 3H01A 3QNEA 4X88A 4LFBO 4B3MO 4PA4A 3E8HA 4MW8A 2HR3A 2QWPB 2YEVB 1KECA 1VEWA 4W4KA 4I50B 4WFGA 3ZRWB 4WFAV 1PL4A 1ZUQA 1Q43A 5IWAO 1GN3A 2IBZH 4X9QA 5LGNA 1Q6HA 3ASNB 4J7KA 3RYHA 3N2GA 2DYRC 2EINB 3BA8A 3JALA 4LF7B 2Q6AA 4TWKA 5HFMA 2ZXWB 4TQDA 2UXNA 3G71V 3GB7C 1MNGA 2QM7A 4ZIBA 1GK9A 2GSMB 2YI8A 3DTUB 3G6EV 4FM0A 2WA3A 3CRMA 2BOBC 2EX3A 3FKSG 2YDEA 2P5OA 5LMUB 2Y0IA 2F1MA 1GM9A 2YEVA 3BEHA 4R7CA 3ZRWA 2Q73A 4I50A 1KBHA 2YIAA 4B3RO 4X1YB 1JX9A 4LWSB 1K3EA 3OT7A 3CEIA 3M99B 2ZKOA 2CAZC 3WB2A 1H2GA 1NVPB 1W0KG 3RN4A 2ZDIC 1PNMA 5LP6C 3RYFB 5E79Z 4DV7B 3IJ4A 3K06A 2XAQA 3JYCA 2WA4A 3T1YB 2AZ0A 1UPGA 3B09A 4LF7O 3K3WA 3LSUA 4DR3O 1K4DC 1NTMH 4GCZA 1S5JA 4JI4O 3H1IH 3E35A 3JD3A 4K0KB 1YSCA 4MTGA 4FLWA 1EN5A 2CUGA 2D3OW 2ZR2A 1NTZH 2YXHA 3IGAC 1HNWO 3E8GA 1H5WA 3W7WA 1PV0A 4LWSA 4MVUA 2UXBB 1OCCC 2HJFC 2ZE5A 1DGSA 4X64B 2OCHA 5IYCO 4CS3A 1RSOB 3PN1A 3THOA 3QG5A 4MTXA 2HHHO 2EIMB 2MW2B 1ZWIC 1GM7A 4FK5C 4DK0A 4P30A 4PDLA 3F5TA 4U3JB 4JI2B 4WBNB 5JVDB 5IJ9B 1OCRB 3RVZA 5LL6Y 4DK1A 4DV2B 2YSUB 4LFCB 5BR8B 1X4TA 4H37A 3KZIZ 3OFNG 3X2QC 4LF8B 1FXHA 4JI1O 1IURA 2DE0X 4JI5B 1BL8A 2H94A 5L3DA 3SPJA 3CMAV 3T2MA 1RSOA 5KLVH 3BCCH 2LFRA 2UUBB 2KG7B 2UXXA 2QKSA 2ZINA 1R6TA 3CC2V 5CMUA 2JEUA 4QGPA 4U3JA 3J81N 4I9WA 4WBNA 2LJ2A 2XASA 3QO7A 5IJ9A 1Y6XA 2ILMA 4K8ZA 1M93A 3D3QA 1NH2B 4O4HB 5J2TB 2WLHA 4QE7A 5FL7G 1N36B 2XAJA 4JI2O 1JVMA 2JK5C 4H13B 4DR7O 4MS2A 4F6EA 2AGAA 2GDSA 3AG2B 2E5LB 2Q4PA 5E1AC 2EILC 2IU3A 5BR8O 3ASOC 4GX2A 2WWWA 4PHZA 4X89A 3ZMUA 3OTOO 4KHPO 2KG7A 5JH7A 1NTKH 1QNMA 5AG2A 3K57A 4PDVA 4JI5O 2XAHA 4I5SA 1I5YA 2OCCB 4IHJB 2ETNA 3QVNA 2QWNB 2CTPA 2HLDG 3F7YC 4RUEA 5J2TA 4D7SA 2NR5A 2FKXA 3HPLC 4E4EA 4DUZB 2N74A 4YIPA 3W7TA 4JYCA 2EIJB 3JARA 5H5NA 2G38A 1NS1A 1SZTA 3OR6C 1AR1B 1KB9F 4CZZA 2HEPA 2IW5A 1L8DA 1Q86W 2JGUA 1XI1A 3LSSA 3CYOA 4P9PA 2R9IA 1QLNA 2KB1A 3FB7C 1JR9A 5FNVB 1K34A 2K9PA 1JMKC 4IHJA 1QR8A 3E86A 2EULA 4CH6A 4F4LA 3CRRA 4WFFA 2VS0A 2UU9B 3GVMA 1QR9A 1PNLA 1VQ8V 3CJHB 3OM3B 4EFBA 3L74H 3D3IA 1XBLA 2LGWA 4JI8O 2DQ3A 4AI8A 2UXDO 4HNAA 5KHJA 3TK1A 2W6IG 1HP8A 2HVKC 2P4VA 2XTAA 5B5EZ 4IT5A 1YDXA 4JI0O 2KQXA 2ZNIA 1GN4A 2YIBD 2P67A 2F4VO 2A3QA 5LGUA 2ZE8A 1FD9A 4NVPA 1MZEA 4FLUA 3ZRXA 4R50A 1VQ6V 2F93B 1VQ9V 3BAAA 3G67A 2A9HA 2QE7G 3AK3A 3TETA 1SC5B 2L35A 3CJHA 3JCUZ 4KL1A 2CH7B 5J2UA 1E1QG 1PNKA 5EC2C 4IL6Z 5IDJA 5LP6B 1XMOB 5D5QA 1BQZA 3J7AU 2F66C 3ZN0A 2XHBA 4AILC 1R73A 1EZJA 3ZRSA 1K73W 2EZPA 2WAMA 2X0LA 4DV6B 2DQ0A 3CCVV 4G2KA 3LUTB 1PM9A 2N04A 3SYQA 4NTXA 3E22B 3KKYA 2EIKC 2ZDIA 1Y4MA 5LP6A 4H33A 5CB4B 2RQ6A 2AHZA 3RVYA 4AHCA 3AG1C 3MDSA 1THZA 1XMQB 2OIEA 4IGGA 1BSMA 2VQEO 3ABKC 4DV5B 3CCUV 4LF9B 4F6RB 4U7OA 3X2QB 1MABG 2W0XA 3PJSK 1XL6A 4PELA 3RW0A 1K5SA 4G28B 1EFRG 3B8MA 4PA7A 5ITZB 5KHGA 1H8HG 4UVAA 4LNUB 3O65A 3E22A 4DR4O 3VQVA 1LUWA 1F4NA 4LR3A 4LF4B 2GBOA 4NR1A 4MT8A 5CB4A 4PDRA 3CCLV 2QA4V 5H2FZ 3NXSA 4TV8B 1K92A 4EB6B 1WJZA 4ICGA 4DR5B 1MMMA 4JZ2A 1U97A 3OAAG 1VQMV 2A79B 1US6A 2GUZA 3OE7G 5CBFA 2W6JG 2PI4A 4B3TO 4ZI7B 1B04A 4XDLA 2ADPA 4X1IA 3L73H 1M5IA 1SQBH 4PD4F 4LF9O 4LNUA 4XDJA 3BPZA 2YIDA 3JAMN 4L87A 1YI2V 3ZBHA 3K0DA 1JJOA 3N27A 5CA3A 3JAKA 2F43G 5K1XA 3T4ZA 1VQ4V 4DR2O 1TA8A 1QVGU 3K08A 4UUJC 3ZEDA 1RP3B 1AJQA 2LGQA 4ZI7A 1IX9A 3BVOA 2RMKB 1GH6A 2JDIG 1R1BA 4EFEA 5J9PC 1N0JA 5KA6A 5LXTA 2BTQA 1N32B 1XNQO 3AG3B 2P6JA 3GWOA 1WNSA 5KMGB 1FYJA 2DOSA 1S0VA 1IDSA 1Y74B 1VQLV 1VQKV 5KX5B 4UXNA 2R72A 3CP1A 2Z3YA 5KAIZ 2AHYA 4TOIA 1R3JC 4J80A 4ZKIA 1ZL8A 4HYOA 2GHYA 1BMFG 3WG7C 2YI9A 2HP8A 1SQFA 4JTAB 1S5LZ 4QJFB 3VQWA 2QM4A 1UFIA 4Z1MG 4B3MB 1S72V 1K9MW 2QR4A 1JA8A 5EIBC 3ZRVA 5DM6V 4JTCB 5KMGA 4J9YB 5IWAB 1NT2B 3CRAA 4BIUA 4NB5A 3SPHA 4JASA 2BSKB 5KX5A 5KAFZ 3TCUA 4B7EA 3DXRB 1IBLO 1OHHG 1VF5B 1HNXO 3M8AA 1VARA 3CD6V 5B1AC 1VQNV 5JJJB 3RYHB 3N2GB 1P4RA 3CB2A 1Y66A 2B1IA 2LQTA 1YEWA 1NR1A 1S77D 1ROPA 4WFHA 4FM1A 3G4SV 1IBKO 4GKKO 1NI8A 2Q7EA 3L75H 4UCSA 4JI3O 2FB5A 2H8PC 1K97A 4B3RB 3F7VC 4YHHO 1PD3A 2BSKA 2QTOA 4FLYA 1FJGO 2IH3C 4KP4A 3DXRA 1SQGA 5EBMC 4I9QA 4JYBA 3LNMB 4MVMA 4UV8A 5B3SC 3OR7C 4O4LB 5H6RA 4AQYO 3APOA 3WB1A 1W0JG 4MTOA 1VF6C 1WA8A 4FM2A 2Z5UA 5EC1C 5IY5C 4DR3B 2MK3A 4JI4B 2EIKB 2DWDC 5IYDO 4DUYO 1VP7A 3B8NA 1SQQH 1DK1A 5JQGA 1HNWB 4FVMA 3P3NA 5FPRA 3AG1B 4JZGA 4K3AA 1FXKC 1R6KA 1HDJA 1LNQA 4DV3O 4X62O 1WLEA 5L3FA 3C90A 2HHHB 3ABKB 3LDEA 3LSQA 3T1CA 4O4LA 2WSSG 1SERA 4W4LA 1NR7A 4D7TA 1QQCA 1DLBA 2P4KA 5DEDA 5LA6B 4DR1O 5BMVB 1O9GA 1MG1A 1DF4A 2Y4TA 1SS3A 2Q68A 1GN2A 3F5WC 2HG5C 4NXNO 2X6AA 4JI1B 3CCMV 3JSLA 3CWBH 4FFBB 4X66O 3UM7A 4MVZA 4HZ3A 5IT9N 3HKBA 1DTOA 3S3WA 1XILA 2W0FC 3APQA 2PYLA 4CBCA 3DGEA 1B3QA 1M57B 4FZ0A 4UB8Z 5LA6A 5LYJB 5BMVA 3L9DA 1G6UA 4LBEC 4LF5O 2B1GA 1NBMG 3H1JH 4JV5O 4P9OA 4DR7B 2ITDC 3CPWU 3DC6A 2R9AA 4J10A 4FFBA 2O57A 1P7GA 3FFQA 4CC5A 3OTOB 4KHPB 3EFFK 3ABMC 3QF7A 1TVKB 3SPCA 3DSQA 3ZMTA 4JAVA 1BT8A 2HFEC 1JOYA 3K0GA 3HKDB 1S76D
chains in the Genus database with same CATH topology
2CDYA 1GN4A 1LUWA 1XUQA 1EN6A 3IC9A 4JZGA 1EN4A 1XDCA 1MSDA 1BS3A 1B06A 1ZLZA 3LSUA 3KDRA 1ZSPA 3AK3A 1Y67A 3BFRA 1QNMA 5AG2A 1AR4A 1JA8A 1MMMA 1EN5A 4JZ2A 2CE4A 1AP5A 2P4KA 4BR6A 1WB8A 3QVNA 4YIOA 2AW9A 1MA1A 4E4EA 1GN2A 2ADPA 1I0HA 4YIPA 5A9GA 1D5NA 1EM1A 1SZXA 1VARA 4GUNA 3EVKA 1VEWA 4JYYA 1IXBA 1PL4A 1ZUQA 4C7UA 1XILA 1GN3A 1N0NA 4X9QA 1JR9A 1PM9A 2ADQB 1WB7A 3KKYA 3TJTA 1KKCA 1MNGA 4FFKA 1IX9A 3AK1A 2QKCA 3DC6A 1N0JA 3MDSA 1I08A 1BSMA 1AR5A 1P7GA 3K9SA 2QKAA 1ZTEA 3DC5A 2RCVA 1IDSA 3OT7A 3CEIA 1GN6A 3AK2A 1AVMA 1LUVA 3RN4A 1AP6A 3C3SA 3C3TA 1BT8A 1XREA 4F6EA 2GDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CDY A;  1GN4 A;  1LUW A;  1XUQ A;  1EN6 A;  3IC9 A;  4JZG A;  1EN4 A;  1XDC A;  1MSD A;  1BS3 A;  1B06 A;  1ZLZ A;  3LSU A;  1ZSP A;  3AK3 A;  1Y67 A;  3BFR A;  1QNM A;  5AG2 A;  1AR4 A;  1JA8 A;  1MMM A;  1EN5 A;  4JZ2 A;  2CE4 A;  1AP5 A;  2P4K A;  4BR6 A;  1WB8 A;  3QVN A;  4YIO A;  2AW9 A;  1MA1 A;  4E4E A;  1GN2 A;  2ADP A;  1I0H A;  4YIP A;  5A9G A;  1D5N A;  1EM1 A;  1SZX A;  1VAR A;  4GUN A;  3EVK A;  1VEW A;  4JYY A;  1IXB A;  1PL4 A;  1ZUQ A;  4C7U A;  1XIL A;  1GN3 A;  1N0N A;  4X9Q A;  1JR9 A;  1PM9 A;  2ADQ B;  1WB7 A;  3KKY A;  3TJT A;  1KKC A;  1MNG A;  4FFK A;  1IX9 A;  3AK1 A;  2QKC A;  3DC6 A;  1N0J A;  3MDS A;  1I08 A;  1BSM A;  1AR5 A;  1P7G A;  3K9S A;  2QKA A;  1ZTE A;  3DC5 A;  2RCV A;  1IDS A;  3OT7 A;  3CEI A;  1GN6 A;  3AK2 A;  1AVM A;  1LUV A;  3RN4 A;  1AP6 A;  3C3S A;  3C3T A;  1BT8 A;  1XRE A;  4F6E A;  2GDS A; 
#chains in the Genus database with same CATH topology
 5LYJ A;  1GO3 F;  5JH7 B;  5EBL C;  3H1L H;  3FAV B;  3RFR A;  4DYL A;  4PDM A;  1KUQ A;  4MTF A;  3K59 A;  4JTD B;  3ZN1 A;  1ZLZ A;  2L6L A;  3KDR A;  4RAI A;  3OUS A;  2PTM A;  1Q5O A;  5IJ0 A;  4KFM A;  2XAG A;  3A2F A;  1JQ0 A;  3JAR B;  2Q0A A;  3I55 V;  4DR6 B;  1QU7 A;  2WLL B;  1TVK A;  4PA9 A;  1GKF A;  3WG7 B;  3SDL A;  3HKD A;  1FOU A;  1F7Y A;  2QJ1 A;  1XNR O;  3UQ8 A;  1M9N A;  1KP2 A;  5IYB O;  3GWK C;  3FAV A;  3SYP A;  1F4M A;  3ICX A;  1GMG A;  1NQT A;  2Q67 A;  3U0Z A;  2VWK A;  2Y0P A;  4JI8 B;  1MZF A;  2WLI A;  3SR2 C;  4B3S O;  2UXD B;  3H9V A;  3EHB B;  1YCI A;  2WLL A;  3MD0 A;  3E83 A;  4JI0 B;  1KYO F;  2V7Q G;  4HNA B;  3UO3 A;  2F23 A;  2F4V B;  4MW3 A;  4DR6 O;  3D8C A;  2JEX A;  1CXZ B;  1TUE B;  5D5P A;  2XOK G;  4X20 A;  1RPR A;  3SJC C;  3STL C;  1D5A A;  1VQO V;  1PP9 H;  1EN6 A;  2IM9 A;  5B3S B;  5L3C A;  3R66 A;  1L0L H;  1VQ7 V;  3VQY A;  4DW0 A;  5J2U B;  5L3E A;  2JJ1 G;  1XL4 A;  2DYR B;  4X1K B;  2ODM A;  5IY5 B;  4LCU C;  1IZ3 A;  4ZHQ B;  5CA0 B;  2A0L A;  3WB0 A;  4E2L A;  1H2N A;  2ZIM A;  3ETE A;  1E1R G;  2AXT Z;  4RO2 A;  1RPO A;  2B9Z A;  1SKV A;  1W2B U;  3M7M X;  2ATK C;  3SJQ C;  1EZV H;  1QBZ A;  2ZD9 A;  1FXK B;  1EM1 A;  4NKG B;  2CTQ A;  3OGI B;  4L8J A;  2JGD A;  3ZHQ A;  1SZX A;  5LMN O;  1Z2G A;  1N8R W;  3ZIA G;  3EVK A;  1H8E G;  4NYK A;  3OW2 U;  4JYY A;  2A7W A;  3CXH F;  3SYA A;  4BIO A;  2P22 C;  3P3P A;  4QIW F;  2V4D A;  1VF6 A;  4X1K A;  1OCO C;  2IJK A;  5GW7 A;  3T4D A;  4R8C A;  4WFE A;  4ASU G;  1F23 A;  2VQE B;  4NTW A;  1YIJ V;  4ZHQ A;  5CA0 A;  5H9C A;  4JI6 O;  1WN7 A;  3QO5 A;  4CC6 A;  2OIG A;  4YY3 O;  1VQ5 V;  1K8A W;  3R65 A;  5FLX N;  5KHH A;  4PA3 A;  4JI7 O;  1FAF A;  2RJZ A;  1I94 O;  1FXK A;  1K5Q A;  1BCC H;  2FL4 A;  3D36 C;  5B1O A;  4DR4 B;  3JAT B;  5KHI A;  2OYQ A;  4YJ2 B;  1PKX A;  4LF6 O;  3OGC C;  4RUF A;  1OCC B;  1VF7 A;  3RYC B;  4N21 A;  4K8X A;  1WP8 A;  2DMX A;  3JCZ A;  2RN9 A;  2CTR A;  2VQF O;  4EKW A;  1J5E O;  2H3O A;  1N34 O;  1QCE A;  1R3I C;  2QDO A;  4P2Z A;  3ZMS A;  3A0R A;  3O9O A;  3HB3 B;  5DEC A;  4GX0 A;  4UCO A;  1DF5 A;  3CXC U;  2EIN C;  4B3T B;  2BTO A;  2QM8 A;  1S3J A;  1ENV A;  4JAU A;  3RYI B;  1F51 A;  1XDC A;  1OCZ C;  4XDK A;  5CBH A;  2GUZ B;  1XHZ A;  3E8B A;  3JAT A;  4I0X A;  1O9H A;  3BFR A;  3VOU A;  3JD0 A;  4GKJ O;  3KCX A;  4OPH A;  4YJ2 A;  4NXM O;  1CEZ A;  4R6Z A;  2PYJ A;  3ABM B;  4X1I B;  2UXC O;  3RYC A;  1SQX H;  3OEE G;  4DR2 B;  2P06 A;  2HJD A;  4BW5 A;  4FMT A;  5KUK A;  3ZCC A;  3JAK B;  5LHG A;  2EJ7 A;  3ABL C;  2WPD G;  1EBO A;  3IFX A;  3RYI A;  2V1D A;  2JS3 A;  3UT5 A;  2M7W A;  5BZB A;  1YTF B;  1N33 B;  2QGN A;  1Y76 B;  3FB5 C;  1FKA O;  4O2B B;  4UV9 A;  1JJ2 U;  1XNQ B;  5HFL A;  4WF9 V;  1QVF U;  2EIL B;  3HKE B;  2GV9 A;  3ASO B;  5LXT B;  4PJ0 Z;  1ZX3 A;  4U7N A;  2BTQ B;  3I56 V;  2LP7 A;  3OTF A;  3HR0 A;  3TXQ A;  1UJW B;  1G1X B;  4X8A A;  3BA9 A;  5C93 A;  4BWA A;  1IBM O;  4DV1 O;  3CC7 V;  2Q9L A;  1YXB A;  2E75 B;  1Q81 W;  3K79 A;  5KHK A;  4MVQ A;  1ZL8 B;  4O4I A;  1Y76 A;  2NNU A;  5GON B;  4O2B A;  1AVM A;  4FJC C;  1LUV A;  5LHH A;  5GTH Z;  3E89 A;  4YJ3 A;  1NVP D;  1XEQ A;  4DRX B;  3HKE A;  5F2V O;  3BHP A;  1N33 O;  1M1K W;  3K5N A;  2OT5 A;  5EZY A;  2LFS A;  1J95 A;  1IBL B;  3CRQ A;  3SYO A;  2EBO A;  1HNX B;  2ZE6 A;  1BZK A;  1OZ0 A;  3OD4 A;  2Y69 C;  3ZHT A;  5IYZ B;  1KP3 A;  1ARO P;  4UB6 Z;  1IBK B;  4GKK B;  5JJE B;  5GON A;  5JCO C;  1MOF A;  4X65 O;  4FIP C;  2ZE7 A;  2IU0 A;  4JI3 B;  3H1H H;  2P90 A;  2DW4 A;  1D5N A;  4DRX A;  4YHH B;  1AIL A;  2YIB A;  1IXM A;  2D2C B;  3U11 A;  1H2K A;  1FJG B;  1IXB A;  2QEX V;  3ZHU A;  4FLT A;  3MHH C;  3CSX A;  4AQY B;  2UUC B;  1Q7Y W;  1Q6U A;  1IJG A;  3Q4H B;  5IYZ A;  4I7Z B;  3A0H Z;  5EYP A;  1TUB B;  1H2L A;  1D2D A;  3SPG A;  1AI7 A;  5KUM A;  2VWJ A;  3UO2 A;  1RFY A;  4DUY B;  1GM8 A;  4JF3 A;  3JD2 A;  3CCS V;  1WA8 B;  1QLE C;  2ZCE A;  1HNZ O;  4ZOL A;  1AR5 A;  2Q7H A;  4DV3 B;  4X62 B;  2X6C A;  5JQG B;  4OX9 O;  1L1F A;  3ZS8 C;  1NH2 D;  1IVS A;  1W59 A;  3SYC A;  4ZBM A;  2UUA O;  2E76 B;  3G80 A;  3Q4H A;  1R3K C;  4CH3 A;  2C2A A;  1TUB A;  4DR1 B;  1XUQ A;  3K9A A;  3CS5 A;  2UUC O;  5B1N A;  2Q5Z A;  3FD9 A;  4NXN B;  2ZR3 A;  1B06 A;  1Q82 W;  2PI5 A;  4CS2 A;  4JAA A;  4X66 B;  5B1B C;  2EZO A;  2QWQ B;  4RQE A;  3MAQ A;  5EIB D;  3K04 A;  1KQS U;  1HR0 O;  4OPA A;  4YIO A;  1SQV H;  3ZX6 A;  1KC8 W;  4B7K A;  3ZHS A;  2KSD A;  5A9G A;  3G6B A;  3HKB B;  1M56 C;  3ZHV A;  2PUS A;  2QWO B;  3TGU H;  1OCZ B;  4LF5 B;  4TUY B;  1M90 W;  3D36 A;  4JV5 B;  1HW7 A;  3CCJ V;  4A5U B;  4I55 B;  3AEI A;  4JYA O;  5CN0 A;  3J80 N;  4YXW G;  1LR1 A;  1Q90 D;  4UCV A;  3CCE V;  4LP8 A;  3K5M A;  5JJN B;  3T1H O;  1AJP A;  3MHS C;  2ZIO A;  1PL0 A;  1WB7 A;  2YXY A;  3ZMV A;  1BHB A;  1WAZ A;  2R70 A;  2YC0 A;  3H1K H;  4MSW C;  4QPJ A;  2GTA A;  4I4T B;  1SRY A;  3ABL B;  1QHT A;  1FFT B;  2XT9 A;  2QSA A;  1T5E A;  4HBN A;  1NU1 H;  3K58 A;  5EBW C;  4TUY A;  3CRC A;  2NLJ C;  3ML0 A;  4I55 A;  5LOV B;  4TV9 B;  3DC5 A;  2RCV A;  3JAS B;  1YVW A;  3RBZ A;  1S5H C;  3LDD A;  1GAX A;  1ZAU A;  2BOC C;  1YHQ V;  3BY6 A;  1COW G;  4X1Y A;  2DYS C;  1H2M A;  2CDY A;  3B77 A;  4QE9 A;  5LMU O;  3IC9 A;  4I4T A;  5IJ0 B;  3N2K B;  3QTC A;  1BGY H;  4FLZ A;  3CCR V;  3RYF A;  1MSD A;  1BS3 A;  2RNB A;  5CA1 B;  1XNR B;  5A2Q N;  4G27 B;  5H6Q A;  5LBQ A;  1I7F A;  3CHX A;  1SET A;  4DV0 B;  5LOV A;  4TV9 A;  4IYH A;  4DV7 O;  3JAS A;  4H44 B;  5C8Y B;  1MA1 A;  2JVD A;  3T1Y O;  2BE3 A;  1SF9 A;  1I0H A;  2ZM6 B;  3ETQ A;  4B3S B;  3BRC A;  1G4Y B;  4K0K O;  2M6Y A;  3N2K A;  1YJN V;  3AG4 C;  2WLI B;  2Y69 B;  4WFB V;  2UXB O;  5CA1 A;  1TAE A;  2CGO A;  1XQ8 A;  3EXA A;  4X64 O;  5JVD A;  2LW7 A;  2ZNJ A;  1Z5V A;  2OTL V;  2YIC A;  2B5U A;  5C8Y A;  1KKC A;  1NKD A;  5TIS Z;  4LC1 A;  2GTS A;  1GTO A;  3CCQ V;  4DV0 O;  4DV2 O;  1JCH A;  3JD4 A;  4CS4 A;  4TQF A;  4LFC O;  1KKD A;  4JGS A;  1V54 C;  4X20 B;  2ZM6 O;  4LF8 O;  5BY1 A;  3KG2 A;  2XND G;  1K7D A;  4XBF A;  4KUM A;  1VIB A;  2PF4 E;  2RDC A;  3TXS A;  5LHI A;  5IE9 A;  5K1P A;  3C3S A;  5JCO A;  3CE2 A;  5B1A B;  1FFX B;  4D6T H;  2X6B A;  5L3B A;  2UUB O;  4O4H A;  3STZ C;  1QLE B;  2DN9 A;  2KKW A;  5JWP A;  4LFA B;  2BCC H;  1EN4 A;  2DWE C;  3ABU A;  1VQP V;  3OUF A;  1P7B A;  4QNH B;  4DXW A;  1WPX A;  2YUA A;  5LMN B;  1N36 O;  1AR4 A;  3OMA B;  3UKM A;  3BAB A;  4CH4 A;  2N05 A;  2CE4 A;  1YTF D;  1V55 C;  3AG3 C;  3FYI B;  2E5L O;  4KXR A;  2JIZ G;  2JGD B;  4PI2 A;  2WLM A;  3FX7 A;  3SPI A;  2XAF A;  5L3G A;  1FXV A;  5B66 Z;  3OEH G;  4GYC B;  1AI4 A;  1FFX A;  4EEQ A;  1K33 A;  2A06 H;  4JI6 B;  3FB8 C;  1MSW D;  4GUN A;  4YY3 B;  3WU2 Z;  4JI7 B;  4UCT A;  2ITC C;  4O2A B;  4C7U A;  1I94 B;  1BE3 H;  5B1B B;  1AJN A;  4MVO A;  4LFA O;  1CP9 A;  3W7U A;  2Q8V A;  4J7J A;  4DUZ O;  4LF6 B;  1XOU A;  4CH5 A;  1G8M A;  4FLV A;  3P30 A;  4J11 A;  3TJT A;  2VQF B;  4PI0 A;  1J5E B;  1YF2 A;  1M56 B;  1N34 B;  3E2E A;  1URF A;  3W7X A;  5FNV A;  1X59 A;  3VBB A;  1Q8I A;  4K35 A;  4UVB A;  3K03 A;  2DJV A;  1RM1 C;  1NJI W;  3B4S A;  3I5D A;  3ZHR A;  4BW9 A;  1A32 A;  2JJ2 G;  1WP7 A;  4UFZ A;  2QKA A;  4O2A A;  4H0L B;  1YJ9 V;  2R9R B;  3E8F A;  4OGQ B;  4GKJ B;  1ORQ C;  2OWO A;  3CX5 F;  4NXM B;  1AP6 A;  4DV4 B;  2FML A;  2LW1 A;  1SA0 B;  4RWU A;  2UXC B;  1XRE A;  2UU9 O;  4TSF G;  3HKC B;  1AB3 A;  1NZ6 A;  4I0X B;  4GX5 A;  2IJI A;  3AG7 A;  1P49 A;  3A0B Z;  1N4C A;  2FYU H;  4LH7 A;  1PPJ H;  5BXZ A;  4RQF A;  5LGT A;  1H2S B;  4O4J B;  3OMN B;  4UCR A;  1OV9 A;  3ETD A;  3ASN C;  2WLK A;  3RGB A;  2DYS B;  3W7S A;  3ABT A;  2ZXW C;  3UT5 B;  1SA0 A;  2CH7 A;  4U3F H;  4J42 A;  4IIJ B;  4LH6 A;  2IJH A;  4J9Z B;  3HKC A;  1U96 A;  3SJB C;  4Z2W A;  3ETG A;  5GTI Z;  4DV4 O;  3U10 A;  3K5O A;  2Y4U A;  4DW1 A;  3CC4 V;  3K5L A;  1JPX A;  3LNN A;  2JS5 A;  1XMO O;  1IBM B;  2Q0O C;  4DV1 B;  2Y48 A;  2ADQ B;  4O4J A;  1B6Q A;  2EJR A;  4JPR A;  4MVR A;  4FFK A;  4B08 A;  4J7Z A;  3NR7 A;  4BIZ A;  3RT3 C;  4ABM A;  4PV1 B;  1HWY A;  4IIJ A;  1R6N A;  2IJJ A;  3SJA C;  1P84 F;  3AG4 B;  4O4I B;  4DV6 O;  1FS0 G;  1FPO A;  1YJW V;  4YJ3 B;  3CME V;  1YIT V;  3B2E E;  4GLX A;  2ARH A;  5EZY B;  3QO8 A;  2X7R B;  4F6R A;  1OJH A;  1XMQ O;  4QPK A;  4GT1 A;  1M57 C;  2FTK A;  4X65 B;  2HVJ C;  1V54 B;  5ITZ A;  2EIM C;  4DV5 O;  4J41 A;  1BHA A;  3JSN A;  1ZSP A;  1Y67 A;  1E79 G;  2E3C A;  1OCR C;  2LO1 A;  4TV8 A;  2Q69 A;  4EB6 A;  3L70 H;  1H38 A;  1AP5 A;  3LDC A;  1Z5W A;  4BR6 A;  2CTW A;  4GZR B;  1XHX A;  5FPO A;  2AW9 A;  4LF4 O;  5CBG A;  2PZS A;  3IC7 A;  2ZT9 B;  2E74 B;  3IAY A;  3FB6 C;  2ZQM A;  4DR5 O;  2K1E A;  5EK0 A;  3FYE B;  4UCU A;  1BQ0 A;  4HAM A;  2Q7G A;  5EYP B;  1AI5 A;  1JNB A;  1N0N A;  2CK3 G;  1V55 B;  3WFV A;  1R3L C;  1HNZ B;  5DN6 G;  1L0N H;  1K4C C;  2WLN A;  1JFF B;  1GRJ A;  3P32 A;  3JAW B;  4OX9 B;  2VRZ A;  3A8T A;  2CGN A;  2AZ2 A;  2OTJ V;  4GX1 A;  4OXS A;  4FPP A;  2UUA B;  4ZOL B;  2WLJ A;  3AK1 A;  3AG2 C;  2QKC A;  3L72 H;  4Q6G A;  3SGI A;  1KU9 A;  2YXL A;  3UCS C;  1I08 A;  1Q3E A;  1VMG A;  3JD1 A;  2QTS A;  2PY5 A;  2XUM A;  4NTY A;  1YZB A;  4TT3 G;  2YS8 A;  3K9S A;  2HKO A;  2Z0A A;  1ZTE A;  4UVC A;  4FLX A;  4LFB B;  2NN4 A;  3RWR D;  2QWR B;  1GN6 A;  1KMI Z;  4Z1V A;  2OCC C;  1WPB A;  3AK2 A;  4N23 A;  1AI6 A;  2F95 B;  3C3T A;  1JFF A;  1SES A;  2JRI A;  3JAW A;  1HR0 B;  1Q6I A;  1Y74 A;  3KCY A;  4BAY A;  2IH1 C;  1RM1 B;  4PA6 A;  4WCE V;  1N32 O;  2P7T C;  2EIJ C;  1CPY A;  3VQX A;  4DO2 A;  1OCO B;  3ZMZ A;  1M4U A;  4FZ1 A;  3L71 H;  1SQP H;  1V9P A;  3B40 A;  4JYA B;  3JAL B;  3OMI B;  3S3X A;  1WB8 A;  4MVS A;  1KD1 W;  1I5X A;  3ZJZ A;  5KA5 A;  3T1H B;  2PGG A;  1TGO A;  4Q20 A;  4IYI A;  3H01 A;  3QNE A;  4X88 A;  4LFB O;  4B3M O;  4PA4 A;  3E8H A;  4MW8 A;  2HR3 A;  2QWP B;  2YEV B;  1KEC A;  1VEW A;  4W4K A;  4I50 B;  4WFG A;  3ZRW B;  4WFA V;  1PL4 A;  1ZUQ A;  1Q43 A;  5IWA O;  1GN3 A;  2IBZ H;  4X9Q A;  5LGN A;  1Q6H A;  3ASN B;  4J7K A;  3RYH A;  3N2G A;  2DYR C;  2EIN B;  3BA8 A;  3JAL A;  4LF7 B;  2Q6A A;  4TWK A;  5HFM A;  2ZXW B;  4TQD A;  2UXN A;  3G71 V;  3GB7 C;  1MNG A;  2QM7 A;  4ZIB A;  1GK9 A;  2GSM B;  2YI8 A;  3DTU B;  3G6E V;  4FM0 A;  2WA3 A;  3CRM A;  2BOB C;  2EX3 A;  3FKS G;  2YDE A;  2P5O A;  5LMU B;  2Y0I A;  2F1M A;  1GM9 A;  2YEV A;  3BEH A;  4R7C A;  3ZRW A;  2Q73 A;  4I50 A;  1KBH A;  2YIA A;  4B3R O;  4X1Y B;  1JX9 A;  4LWS B;  1K3E A;  3OT7 A;  3CEI A;  3M99 B;  2ZKO A;  2CAZ C;  3WB2 A;  1H2G A;  1NVP B;  1W0K G;  3RN4 A;  2ZDI C;  1PNM A;  5LP6 C;  3RYF B;  5E79 Z;  4DV7 B;  3IJ4 A;  3K06 A;  2XAQ A;  3JYC A;  2WA4 A;  3T1Y B;  2AZ0 A;  1UPG A;  3B09 A;  4LF7 O;  3K3W A;  3LSU A;  4DR3 O;  1K4D C;  1NTM H;  4GCZ A;  1S5J A;  4JI4 O;  3H1I H;  3E35 A;  3JD3 A;  4K0K B;  1YSC A;  4MTG A;  4FLW A;  1EN5 A;  2CUG A;  2D3O W;  2ZR2 A;  1NTZ H;  2YXH A;  3IGA C;  1HNW O;  3E8G A;  1H5W A;  3W7W A;  1PV0 A;  4LWS A;  4MVU A;  2UXB B;  1OCC C;  2HJF C;  2ZE5 A;  1DGS A;  4X64 B;  2OCH A;  5IYC O;  4CS3 A;  1RSO B;  3PN1 A;  3THO A;  3QG5 A;  4MTX A;  2HHH O;  2EIM B;  2MW2 B;  1ZWI C;  1GM7 A;  4FK5 C;  4DK0 A;  4P30 A;  4PDL A;  3F5T A;  4U3J B;  4JI2 B;  4WBN B;  5JVD B;  5IJ9 B;  1OCR B;  3RVZ A;  5LL6 Y;  4DK1 A;  4DV2 B;  2YSU B;  4LFC B;  5BR8 B;  1X4T A;  4H37 A;  3KZI Z;  3OFN G;  3X2Q C;  4LF8 B;  1FXH A;  4JI1 O;  1IUR A;  2DE0 X;  4JI5 B;  1BL8 A;  2H94 A;  5L3D A;  3SPJ A;  3CMA V;  3T2M A;  1RSO A;  5KLV H;  3BCC H;  2LFR A;  2UUB B;  2KG7 B;  2UXX A;  2QKS A;  2ZIN A;  1R6T A;  3CC2 V;  5CMU A;  2JEU A;  4QGP A;  4U3J A;  3J81 N;  4I9W A;  4WBN A;  2LJ2 A;  2XAS A;  3QO7 A;  5IJ9 A;  1Y6X A;  2ILM A;  4K8Z A;  1M93 A;  3D3Q A;  1NH2 B;  4O4H B;  5J2T B;  2WLH A;  4QE7 A;  5FL7 G;  1N36 B;  2XAJ A;  4JI2 O;  1JVM A;  2JK5 C;  4H13 B;  4DR7 O;  4MS2 A;  4F6E A;  2AGA A;  2GDS A;  3AG2 B;  2E5L B;  2Q4P A;  5E1A C;  2EIL C;  2IU3 A;  5BR8 O;  3ASO C;  4GX2 A;  2WWW A;  4PHZ A;  4X89 A;  3ZMU A;  3OTO O;  4KHP O;  2KG7 A;  5JH7 A;  1NTK H;  1QNM A;  5AG2 A;  3K57 A;  4PDV A;  4JI5 O;  2XAH A;  4I5S A;  1I5Y A;  2OCC B;  4IHJ B;  2ETN A;  3QVN A;  2QWN B;  2CTP A;  2HLD G;  3F7Y C;  4RUE A;  5J2T A;  4D7S A;  2NR5 A;  2FKX A;  3HPL C;  4E4E A;  4DUZ B;  2N74 A;  4YIP A;  3W7T A;  4JYC A;  2EIJ B;  3JAR A;  5H5N A;  2G38 A;  1NS1 A;  1SZT A;  3OR6 C;  1AR1 B;  1KB9 F;  4CZZ A;  2HEP A;  2IW5 A;  1L8D A;  1Q86 W;  2JGU A;  1XI1 A;  3LSS A;  3CYO A;  4P9P A;  2R9I A;  1QLN A;  2KB1 A;  3FB7 C;  1JR9 A;  5FNV B;  1K34 A;  2K9P A;  1JMK C;  4IHJ A;  1QR8 A;  3E86 A;  2EUL A;  4CH6 A;  4F4L A;  3CRR A;  4WFF A;  2VS0 A;  2UU9 B;  3GVM A;  1QR9 A;  1PNL A;  1VQ8 V;  3CJH B;  3OM3 B;  4EFB A;  3L74 H;  3D3I A;  1XBL A;  2LGW A;  4JI8 O;  2DQ3 A;  4AI8 A;  2UXD O;  4HNA A;  5KHJ A;  3TK1 A;  2W6I G;  1HP8 A;  2HVK C;  2P4V A;  2XTA A;  5B5E Z;  4IT5 A;  1YDX A;  4JI0 O;  2KQX A;  2ZNI A;  1GN4 A;  2YIB D;  2P67 A;  2F4V O;  2A3Q A;  5LGU A;  2ZE8 A;  1FD9 A;  4NVP A;  1MZE A;  4FLU A;  3ZRX A;  4R50 A;  1VQ6 V;  2F93 B;  1VQ9 V;  3BAA A;  3G67 A;  2A9H A;  2QE7 G;  3AK3 A;  3TET A;  1SC5 B;  2L35 A;  3CJH A;  3JCU Z;  4KL1 A;  2CH7 B;  5J2U A;  1E1Q G;  1PNK A;  5EC2 C;  4IL6 Z;  5IDJ A;  5LP6 B;  1XMO B;  5D5Q A;  1BQZ A;  3J7A U;  2F66 C;  3ZN0 A;  2XHB A;  4AIL C;  1R73 A;  1EZJ A;  3ZRS A;  1K73 W;  2EZP A;  2WAM A;  2X0L A;  4DV6 B;  2DQ0 A;  3CCV V;  4G2K A;  3LUT B;  1PM9 A;  2N04 A;  3SYQ A;  4NTX A;  3E22 B;  3KKY A;  2EIK C;  2ZDI A;  1Y4M A;  5LP6 A;  4H33 A;  5CB4 B;  2RQ6 A;  2AHZ A;  3RVY A;  4AHC A;  3AG1 C;  3MDS A;  1THZ A;  1XMQ B;  2OIE A;  4IGG A;  1BSM A;  2VQE O;  3ABK C;  4DV5 B;  3CCU V;  4LF9 B;  4F6R B;  4U7O A;  3X2Q B;  1MAB G;  2W0X A;  3PJS K;  1XL6 A;  4PEL A;  3RW0 A;  1K5S A;  4G28 B;  1EFR G;  3B8M A;  4PA7 A;  5ITZ B;  5KHG A;  1H8H G;  4UVA A;  4LNU B;  3O65 A;  3E22 A;  4DR4 O;  3VQV A;  1LUW A;  1F4N A;  4LR3 A;  4LF4 B;  2GBO A;  4NR1 A;  4MT8 A;  5CB4 A;  4PDR A;  3CCL V;  2QA4 V;  5H2F Z;  3NXS A;  4TV8 B;  1K92 A;  4EB6 B;  1WJZ A;  4ICG A;  4DR5 B;  1MMM A;  4JZ2 A;  1U97 A;  3OAA G;  1VQM V;  2A79 B;  1US6 A;  2GUZ A;  3OE7 G;  5CBF A;  2W6J G;  2PI4 A;  4B3T O;  4ZI7 B;  1B04 A;  4XDL A;  2ADP A;  4X1I A;  3L73 H;  1M5I A;  1SQB H;  4PD4 F;  4LF9 O;  4LNU A;  4XDJ A;  3BPZ A;  2YID A;  3JAM N;  4L87 A;  1YI2 V;  3ZBH A;  3K0D A;  1JJO A;  3N27 A;  5CA3 A;  3JAK A;  2F43 G;  5K1X A;  3T4Z A;  1VQ4 V;  4DR2 O;  1TA8 A;  1QVG U;  3K08 A;  4UUJ C;  3ZED A;  1RP3 B;  1AJQ A;  2LGQ A;  4ZI7 A;  1IX9 A;  3BVO A;  2RMK B;  1GH6 A;  2JDI G;  1R1B A;  4EFE A;  5J9P C;  1N0J A;  5KA6 A;  5LXT A;  2BTQ A;  1N32 B;  1XNQ O;  3AG3 B;  2P6J A;  3GWO A;  1WNS A;  5KMG B;  1FYJ A;  2DOS A;  1S0V A;  1IDS A;  1Y74 B;  1VQL V;  1VQK V;  5KX5 B;  4UXN A;  2R72 A;  3CP1 A;  2Z3Y A;  5KAI Z;  2AHY A;  4TOI A;  1R3J C;  4J80 A;  4ZKI A;  1ZL8 A;  4HYO A;  2GHY A;  1BMF G;  3WG7 C;  2YI9 A;  2HP8 A;  1SQF A;  4JTA B;  1S5L Z;  4QJF B;  3VQW A;  2QM4 A;  1UFI A;  4Z1M G;  4B3M B;  1S72 V;  1K9M W;  2QR4 A;  1JA8 A;  5EIB C;  3ZRV A;  5DM6 V;  4JTC B;  5KMG A;  4J9Y B;  5IWA B;  1NT2 B;  3CRA A;  4BIU A;  4NB5 A;  3SPH A;  4JAS A;  2BSK B;  5KX5 A;  5KAF Z;  3TCU A;  4B7E A;  3DXR B;  1IBL O;  1OHH G;  1VF5 B;  1HNX O;  3M8A A;  1VAR A;  3CD6 V;  5B1A C;  1VQN V;  5JJJ B;  3RYH B;  3N2G B;  1P4R A;  3CB2 A;  1Y66 A;  2B1I A;  2LQT A;  1YEW A;  1NR1 A;  1S77 D;  1ROP A;  4WFH A;  4FM1 A;  3G4S V;  1IBK O;  4GKK O;  1NI8 A;  2Q7E A;  3L75 H;  4UCS A;  4JI3 O;  2FB5 A;  2H8P C;  1K97 A;  4B3R B;  3F7V C;  4YHH O;  1PD3 A;  2BSK A;  2QTO A;  4FLY A;  1FJG O;  2IH3 C;  4KP4 A;  3DXR A;  1SQG A;  5EBM C;  4I9Q A;  4JYB A;  3LNM B;  4MVM A;  4UV8 A;  5B3S C;  3OR7 C;  4O4L B;  5H6R A;  4AQY O;  3APO A;  3WB1 A;  1W0J G;  4MTO A;  1VF6 C;  1WA8 A;  4FM2 A;  2Z5U A;  5EC1 C;  5IY5 C;  4DR3 B;  2MK3 A;  4JI4 B;  2EIK B;  2DWD C;  5IYD O;  4DUY O;  1VP7 A;  3B8N A;  1SQQ H;  1DK1 A;  5JQG A;  1HNW B;  4FVM A;  3P3N A;  5FPR A;  3AG1 B;  4JZG A;  4K3A A;  1FXK C;  1R6K A;  1HDJ A;  1LNQ A;  4DV3 O;  4X62 O;  1WLE A;  5L3F A;  3C90 A;  2HHH B;  3ABK B;  3LDE A;  3LSQ A;  3T1C A;  4O4L A;  2WSS G;  1SER A;  4W4L A;  1NR7 A;  4D7T A;  1QQC A;  1DLB A;  2P4K A;  5DED A;  5LA6 B;  4DR1 O;  5BMV B;  1O9G A;  1MG1 A;  1DF4 A;  2Y4T A;  1SS3 A;  2Q68 A;  1GN2 A;  3F5W C;  2HG5 C;  4NXN O;  2X6A A;  4JI1 B;  3CCM V;  3JSL A;  3CWB H;  4FFB B;  4X66 O;  3UM7 A;  4MVZ A;  4HZ3 A;  5IT9 N;  3HKB A;  1DTO A;  3S3W A;  1XIL A;  2W0F C;  3APQ A;  2PYL A;  4CBC A;  3DGE A;  1B3Q A;  1M57 B;  4FZ0 A;  4UB8 Z;  5LA6 A;  5LYJ B;  5BMV A;  3L9D A;  1G6U A;  4LBE C;  4LF5 O;  2B1G A;  1NBM G;  3H1J H;  4JV5 O;  4P9O A;  4DR7 B;  2ITD C;  3CPW U;  3DC6 A;  2R9A A;  4J10 A;  4FFB A;  2O57 A;  1P7G A;  3FFQ A;  4CC5 A;  3OTO B;  4KHP B;  3EFF K;  3ABM C;  3QF7 A;  1TVK B;  3SPC A;  3DSQ A;  3ZMT A;  4JAV A;  1BT8 A;  2HFE C;  1JOY A;  3K0G A;  3HKD B;  1S76 D; 
#chains in the Genus database with same CATH homology
 2CDY A;  1GN4 A;  1LUW A;  1XUQ A;  1EN6 A;  3IC9 A;  4JZG A;  1EN4 A;  1XDC A;  1MSD A;  1BS3 A;  1B06 A;  1ZLZ A;  3LSU A;  3KDR A;  1ZSP A;  3AK3 A;  1Y67 A;  3BFR A;  1QNM A;  5AG2 A;  1AR4 A;  1JA8 A;  1MMM A;  1EN5 A;  4JZ2 A;  2CE4 A;  1AP5 A;  2P4K A;  4BR6 A;  1WB8 A;  3QVN A;  4YIO A;  2AW9 A;  1MA1 A;  4E4E A;  1GN2 A;  2ADP A;  1I0H A;  4YIP A;  5A9G A;  1D5N A;  1EM1 A;  1SZX A;  1VAR A;  4GUN A;  3EVK A;  1VEW A;  4JYY A;  1IXB A;  1PL4 A;  1ZUQ A;  4C7U A;  1XIL A;  1GN3 A;  1N0N A;  4X9Q A;  1JR9 A;  1PM9 A;  2ADQ B;  1WB7 A;  3KKY A;  3TJT A;  1KKC A;  1MNG A;  4FFK A;  1IX9 A;  3AK1 A;  2QKC A;  3DC6 A;  1N0J A;  3MDS A;  1I08 A;  1BSM A;  1AR5 A;  1P7G A;  3K9S A;  2QKA A;  1ZTE A;  3DC5 A;  2RCV A;  1IDS A;  3OT7 A;  3CEI A;  1GN6 A;  3AK2 A;  1AVM A;  1LUV A;  3RN4 A;  1AP6 A;  3C3S A;  3C3T A;  1BT8 A;  1XRE A;  4F6E A;  2GDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...