1VEWA

Manganese superoxide dismutase from escherichia coli
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Escherichia coli manganese superoxide dismutase at 2.1-angstrom resolution.
pubmed rcsb
total genus 75
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1vewA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1vewA02
1IXBA 1BT8A 1N0NA 1P7GA 3AK1A 1AP5A 1XILA 1AR4A 3C3TA 1B06A 4BR6A 1EN5A 1WB7A 1IX9A 2RCVA 3IC9A 1EM1A 4X9QA 3DC6A 1N0JA 4E4EA 4JZGA 1GN2A 1QNMA 1VARA 1LUWA 1XREA 4GUNA 1I0HA 1MNGA 1AP6A 1XUQA 1I08A 1LUVA 1BSMA 1Y67A 1XDCA 1EN4A 1BS3A 4JYYA 1SZXA 1ZUQA 4F6EA 3KKYA 3CEIA 3AK2A 1GN4A 1MMMA 1IDSA 1MSDA 2ADPA 1ZSPA 2ADQB 3AK3A 3OT7A 2AW9A 2P4KA 5A9GA 1WB8A 1VEWA 1AR5A 3LSUA 1JR9A 2CE4A 2QKAA 5AG2A 1GN6A 1EN6A 1ZTEA 2QKCA 2GDSA 4C7UA 2CDYA 3QVNA 4FFKA 3RN4A 1ZLZA 1PL4A 1AVMA 3MDSA 3DC5A 1KKCA 1PM9A 4YIOA 4YIPA 3TJTA 4JZ2A 1D5NA 1MA1A 1JA8A 3BFRA 3C3SA 1GN3A 3EVKA 3K9SA
chains in the Genus database with same CATH superfamily
1TAEA 3LSSA 1VQLV 3RYIA 2JS5A 2EJRA 2H94A 4TV9A 4TSFG 2ZQMA 3C3TA 3JD4A 1RM1B 3E86A 1LR1A 4MTXA 2MW2B 4X1YB 2X0LA 4FLUA 4KP4A 1Y76A 4YJ3B 2A0LA 1K73W 3CXCU 2D2CB 1OCZC 3K3WA 1SA0A 3G71V 1WNSA 1VARA 1IXMA 1AJNA 1Q6IA 5CMUA 2AZ0A 3HKCB 1Z5WA 3RYCA 1QHTA 1OCZB 5TISZ 2WA3A 3H9VA 4FLTA 5EZYB 2N05A 1N34O 4JI2B 3SJCC 2ZM6O 4KHPB 1D2DA 4PHZA 4LF9B 4B3TO 3ASOC 1QLNA 3AK2A 3ZN1A 4HNAB 3JAKB 4UB6Z 3CC2V 4MSWC 4LC1A 5LL6Y 1WA8B 4K3AA 3KZIZ 2W6IG 4FMTA 2ILMA 3CCRV 5LMUB 4O4LB 2DYSC 2K1EA 2HHHO 3ETGA 4PA7A 4JI4O 4QE9A 4LFCB 3O65A 4MTGA 3RGBA 3K04A 2F4VO 1GN6A 2IU3A 4UFZA 4YY3B 4FLWA 4P9PA 2YC0A 2QGNA 2QWOB 3TXSA 1NZ6A 3OGCC 2DN9A 3JD3A 2DYSB 5B1AB 3J7AU 4PA6A 2FB5A 5J9PC 4X65B 4EFEA 4G28B 4RQEA 1PM9A 4YIPA 4P9OA 3ABTA 1Q3EA 3FKSG 2LO1A 4HBNA 4LF6O 1R73A 2OCCC 4KFMA 2V7QG 1N32B 4I55A 5H2FZ 2Y69C 1SQFA 2JJ1G 3CPWU 5JCOC 4PV1B 2WLIB 1JJOA 5ITZA 4UVAA 1B06A 2PYLA 1S5JA 2OCCB 4IHJB 5EYPB 1WB7A 2WLJA 3IC9A 1VQ8V 3DXRB 3N2KA 1JPXA 2AHZA 1N0JA 2Y69B 3BPZA 5L3FA 2AXTZ 4O4HB 2BSKA 1Y66A 2IM9A 2H8PC 5IT9N 5KA5A 4GZRB 2R70A 4JI0B 2VWKA 2ZR3A 4LR3A 4JI6B 2Q9LA 4X89A 5FLXN 3BY6A 1XQ8A 3E8GA 4OGQB 1BS3A 5LYJA 2WLKA 2OT5A 1QCEA 3HPLC 3E8HA 3JASA 3IGAC 1PL0A 3W7XA 1PP9H 1EZJA 4JYAB 4UB8Z 2ZE6A 5H6QA 2ADQB 1AJPA 1KB9F 2BOCC 2XASA 3LSUA 2ZDIA 1EN6A 5EIBC 2V4DA 3JSLA 4JV5O 1YI2V 4B7EA 2ZCEA 3OMNB 2IW5A 1S76D 4ABMA 4A5UB 5BR8B 4O4IA 3E22A 4GKJB 4CC6A 1Z2GA 2FTKA 1IZ3A 3DSQA 2JGDA 3CC4V 1JA8A 3KG2A 2LW1A 3BRCA 1JFFA 4FM0A 4HZ3A 4B08A 1S0VA 2DJVA 2Q8VA 3CD6V 3JAWB 4RUEA 1AP5A 5A2QN 4PA9A 2QWRB 3OMIB 5CA0A 3UKMA 1QVFU 4CS3A 3WFVA 5GTIZ 3FAVA 1W0KG 1IBMO 1FJGO 4IGGA 4Q20A 1OCCB 1Q7YW 4G27B 1TUBB 1R3KC 3QO7A 3IAYA 1GN2A 1OCOB 4DR2B 3SPHA 5K1PA 4PA3A 2IJHA 1SF9A 1XMOB 1BCCH 2QR4A 1N36B 4O2AB 3STLC 1VF5B 5CBGA 4LFAO 3AG2B 3K5LA 1YEWA 3HKDB 2HFEC 3ETEA 1P4RA 1H2LA 1BSMA 5IJ0B 4I7ZB 1H38A 1FKAO 1K4CC 4TOIA 5B1BC 3OAAG 2DQ3A 1YF2A 3AG1B 3VOUA 1R6KA 4QJFB 1R3IC 4DV0B 1WP7A 1MMMA 1H5WA 2G38A 1TUEB 3ZHUA 1FFTB 4W4KA 2PI4A 1R6NA 2Q69A 5B1BB 3SPJA 1VF6C 1B6QA 2HLDG 1RFYA 3RVYA 4I0XA 5CA1B 4CS2A 1RSOA 1VQMV 2E5LB 3K58A 3DTUB 4FK5C 4JI1B 4W4LA 2LGWA 1K97A 3ZX6A 1NH2D 1K9MW 1VP7A 3W7SA 1RPOA 3ABMB 4TV8A 1IBKB 5DN6G 4WFAV 5LMNB 4TWKA 2UU9B 1SQXH 4ZKIA 1BMFG 4EB6A 2GTAA 4WFHA 3CX5F 4GT1A 5LHGA 1IXBA 3L72H 5LXTA 2PTMA 3APQA 3AG4B 1Y6XA 4DV2B 3WU2Z 5KX5B 4DRXB 4DK0A 2GTSA 3RYIB 1XILA 3LSQA 2W0FC 3ICXA 4DO2A 4TV9B 4P2ZA 2Q0OC 4EFBA 3WB1A 3J80N 1O9HA 1NVPD 1Y76B 1YHQV 3A0HZ 4JZGA 2BTQA 2XTAA 4UCVA 1FAFA 5JH7A 3CRQA 2LP7A 5IWAO 2UUCB 2DOSA 2ATKC 3D8CA 4NTYA 2OWOA 3UT5A 4FLYA 3ZCCA 1BZKA 2MK3A 4IL6Z 3RYCB 1Y67A 2CH7A 4JI7O 1HNXO 3GB7C 1FXVA 4OX9B 4DR4O 1V54C 1ZUQA 1FFXA 1E1QG 1I94O 2LQTA 2WPDG 3SPCA 1JNBA 2KB1A 3F7VC 2DWDC 1HR0B 3EFFK 3IJ4A 1ZAUA 1SQBH 1US6A 4GLXA 1MSDA 1V54B 3WB0A 3AEIA 1YIJV 1HDJA 1ORQC 4I4TA 4LP8A 1CP9A 4MW3A 4BIZA 5L3EA 4JASA 1VQPV 1K8AW 1FD9A 4ICGA 3BCCH 5EBLC 3L70H 3OE7G 4F6RA 5JVDA 3H1IH 2Q67A 3D3IA 4UCUA 4LF8B 4DUYO 4DV3B 4MW8A 1FXKB 1VQNV 4XDLA 3G6EV 4J41A 1MA1A 5IYDO 3FX7A 3Q4HA 3S3WA 3K9SA 5LA6A 4NXMB 3J81N 3TGUH 3ZHSA 1DF5A 4RO2A 3CRRA 2UUAB 3R66A 5CN0A 4I55B 1H2GA 1IBLO 4DV1O 4X64O 3FFQA 5BMVA 5ITZB 3F5TA 2EIKC 4BW9A 4NXNO 3K5NA 2Q5ZA 2P90A 2PGGA 3N2KB 4MVQA 4WBNB 5LHHA 2UXDB 2HJFC 4LF4O 4PA4A 3SJQC 5BXZA 1VQ9V 1MSWD 4GKKO 1LUWA 1NS1A 5FL7G 2BTOA 3D3QA 1G8MA 2C2AA 1K5SA 3W7WA 2IU0A 1FYJA 2UXBO 1YCIA 4RUFA 4FJCC 1NR7A 3K0DA 3JALA 4MVZA 1GM8A 4N23A 3SYAA 4LFBO 4CH6A 5LYJB 4WF9V 4DV6B 4X1IB 4IT5A 2GHYA 3CYOA 2ZDIC 1X4TA 4DV4B 3OT7A 1YXBA 1BQZA 2QKAA 1JVMA 4LCUC 5D5QA 1SRYA 4DV2O 3L74H 4NKGB 1DGSA 4X20A 2KKWA 5FPRA 3H1JH 1Q6UA 4R50A 2CDYA 2EIMB 4MTFA 4DW1A 1N33O 4O4IB 3E22B 5GTHZ 1G4YB 5LP6A 3K5OA 2KG7A 3MDSA 3NXSA 2HG5C 4ZIBA 4FZ1A 3JYCA 4DW0A 1FPOA 1Q43A 4LF7O 2UUBO 2JGDB 1P7GA 2YI8A 3H1HH 3CMAV 3IFXA 4R8CA 5EC1C 1T5EA 1XMQB 3K08A 3EHBB 5LBQA 3PJSK 1Q81W 2XUMA 2IJKA 5J2TA 1K92A 4FLXA 4GX5A 1HNZO 1XHXA 2QWPB 4JTAB 4I50B 3BA9A 3ZRSA 1QLEB 1GM9A 3VQWA 3B09A 3CCEV 1YITV 4YHHO 5E79Z 4YJ2A 4JF3A 3G6BA 4I9WA 2D3OW 4XDJA 4O2BB 3ABLC 3F7YC 3SPGA 1RP3B 1I08A 2UXCB 2EZOA 2P4VA 2JEUA 5LOVA 1HNWB 3CJHA 2RMKB 3JATA 2UXXA 3ABKC 4IIJA 1A32A 4X88A 2JK5C 4H44B 1GO3F 1EZVH 4PDVA 2CTQA 2OIEA 1L0NH 1G6UA 3VQXA 1I7FA 2Y4TA 4Q6GA 3CCUV 1XHZA 1AR5A 2CE4A 4WFGA 2YICA 1S5LZ 1MZFA 2DMXA 5B1OA 3WB2A 4WCEV 1XNQO 4U7OA 3MHSC 1G1XB 2VQFB 2E75B 4LWSA 1GAXA 3ETDA 3ZMUA 2HVJC 1XNRO 4DR6B 1PNMA 3VQYA 4LF5O 4JI5O 4TV8B 2W6JG 4DV5B 3ASOB 1S5HC 1HWYA 3U0ZA 3BA8A 4NB5A 2EZPA 4EB6B 4MVMA 3LUTB 1N0NA 5EBMC 1GTOA 1YJWV 1JMKC 3K79A 4D6TH 5LXTB 4UXNA 3AK1A 2ETNA 3UM7A 1AI6A 1OZ0A 2XAHA 4ZOLA 4DR3O 1IX9A 1GMGA 5IJ9B 1EM1A 4PDRA 4X9QA 2ITDC 3ZHRA 1JOYA 2F1MA 2LW7A 1SERA 4D7SA 1XL6A 1WPXA 1K7DA 2BTQB 3U11A 3HKEB 5JH7B 3JARA 5KLVH 1YSCA 1Z5VA 3CP1A 3ZN0A 5JWPA 2EILC 5FNVA 1NH2B 1K4DC 1E79G 2CH7B 4U3JA 4KL1A 2XAFA 4JI8O 5DECA 2F23A 1LNQA 1SQPH 2EINC 3T1HO 1COWG 2EILB 2V1DA 2LGQA 3CC7V 4I5SA 3RW0A 2JS3A 5E1AC 3CRCA 1WLEA 3HKBA 4JAUA 3CMEV 5J2UB 2KQXA 1VMGA 1VIBA 1S77D 4JPRA 2QTSA 4B3SO 1H8EG 2Q73A 2QJ1A 2YI9A 4DXWA 4X66B 1P7BA 2Z0AA 4DR5B 2VQEO 1UPGA 3A0RA 1SQQH 4B3RB 4ZHQB 4J7JA 3AG7A 3K59A 3ZRWA 2NR5A 3JCZA 1GM7A 1JX9A 2DW4A 4DYLA 3A2FA 3CCMV 3Q4HB 2YIBD 4GYCB 4MS2A 2XT9A 4RQFA 4DV7B 2P5OA 4BIUA 3U10A 4FVMA 1YTFD 2RCVA 4DR7B 1M4UA 4FZ0A 4Z2WA 5BMVB 3ZHTA 4PI2A 2OIGA 4E4EA 2YEVB 1I5XA 3CWBH 2EBOA 1MG1A 3ZJZA 2QWQB 4J80A 1MNGA 4AQYB 1AP6A 3THOA 3VBBA 1SS3A 1R3LC 3B40A 5KAFZ 4JI2O 1PV0A 4KHPO 2YXYA 1U96A 4LNUA 4LF9O 1SC5B 5LHIA 1J5EB 2IH3C 3LNNA 2WLLB 3I5DA 5CB4B 1CEZA 4JAAA 1NTMH 3ETQA 1P84F 2WLMA 2KSDA 3OGIB 3LDEA 5LMUO 1YVWA 1Y4MA 2YIBA 3FB7C 3IC7A 3OEHG 4PDMA 4LFCO 2YDEA 4YY3O 2ZIMA 4K0KB 3C90A 1FOUA 2Q0AA 5LP6C 2WA4A 2ZE8A 1R3JC 4UVBA 5F2VO 2QEXV 4X65O 5KUKA 2WLNA 4L87A 2DWEC 4ZI7B 2X6CA 4YJ3A 2KG7B 2Q7HA 3I55V 3L73H 5JQGB 5C8YB 1S72V 1N32O 2ZKOA 2PZSA 3ABUA 4BIOA 1VQ5V 5EZYA 4J11A 1N4CA 2ZR2A 1VQ4V 2Q7GA 1QQCA 2DQ0A 2Y0PA 3JAKA 4UVCA 2ZXWC 5KMGB 3T4DA 1NJIW 3MHHC 1URFA 2ZE5A 1QBZA 4YJ2B 4FLVA 4JI0O 4JI3B 4O4LA 5EC2C 5CA3A 2IBZH 3FB8C 1XOUA 2ZXWB 4R6ZA 4JI6O 2CGOA 3T1YB 1NTKH 2WLHA 5LOVB 4AHCA 3JATB 1QU7A 3K0GA 4IIJB 4F6EA 2FYUH 4MT8A 2XAQA 1M5IA 4B3MB 4J7ZA 3OTOB 4MVSA 4JYAO 1BHBA 1SA0B 5L3CA 4DR1B 4DUZB 3G80A 3BAAA 3AK3A 3D36A 1IJGA 1K5QA 1WB8A 5AG2A 1JR9A 4X62B 2YUAA 2P6JA 2PI5A 4CS4A 1CPYA 2W0XA 3K5MA 2FMLA 5BR8O 1K34A 3G67A 4LWSB 3RN4A 4GKJO 2JDIG 3GVMA 1ZLZA 3DXRA 1AVMA 3FB6C 4FIPC 4BW5A 1F51A 5H6RA 2HKOA 1NR1A 3ZIAG 4JTDB 3E8FA 4PJ0Z 2VS0A 5L3BA 1F4MA 4MVRA 4OXSA 1HP8A 4PELA 3AG3C 3MD0A 3GWKC 1VQ7V 1O9GA 4BR6A 4H13B 2HVKC 4HYOA 4ZOLB 3SJAC 5FPOA 5KHGA 3BHPA 2VRZA 2F93B 2IJJA 2WAMA 3ASNC 1J5EO 3QNEA 2JVDA 1QNMA 4DR2O 4CBCA 1XMOO 2BCCH 3GWOA 4BAYA 1N36O 1OHHG 2YSUB 5CBHA 1AJQA 1LUVA 1S3JA 2YXLA 5IDJA 3JARB 3OW2U 1N34B 3OD4A 4K0KO 1WN7A 2JIZG 2P06A 2EIJC 5FNVB 1SZXA 1W0JG 3T1CA 2ZM6B 4B3TB 2NN4A 5GONA 1XBLA 4U3JB 1GN4A 2BSKB 4QIWF 4DV0O 2RN9A 3SJBC 3CE2A 3CRMA 2EIKB 5HFLA 4RWUA 3N27A 2NNUA 4UCSA 1AI5A 4JAVA 4UV9A 5HFMA 5A9GA 3T4ZA 3HKBB 3X2QC 4O4JA 4H33A 2HHHB 4MTOA 2E5LO 4JI4B 2F4VB 3WG7C 3CSXA 4JI1O 3RBZA 2QA4V 1AI4A 4K8ZA 3QF7A 4J9YB 2EX3A 2EJ7A 3ML0A 4C7UA 3SYCA 3ZHQA 3JASB 3QVNA 3K9AA 1IBKO 3E8BA 1ZL8A 2UU9O 1PL4A 5LMNO 1YJ9V 3TJTA 2E76B 1AROP 2A3QA 3SPIA 2LFRA 2O57A 1QVGU 3ZMSA 1TUBA 4LF6B 3ZRWB 1GN3A 2HP8A 4O2AA 3CCJV 1M1KW 3HKDA 4WFEA 4JGSA 5IJ0A 2CUGA 3BVOA 4GX0A 5IYZA 2X7RB 5IE9A 1V9PA 1DF4A 3ZBHA 4JTCB 1JFFB 3P3PA 2QM7A 1E1RG 1D5AA 1GH6A 3EXAA 2UUCO 5BZBA 2ZNJA 2N04A 4N21A 5H5NA 4R7CA 3FD9A 1X59A 1PNKA 4IYIA 3M99B 1XDCA 3BABA 5B3SC 5CA0B 3RYFA 1NBMG 2Y0IA 4OX9O 4F4LA 3W7UA 3FAVB 1KU9A 1AILA 3KKYA 3OM3B 1DK1A 3KDRA 5KHJA 1HR0O 2R9RB 3H1KH 5JJNB 3OTFA 3RT3C 2P4KA 1KMIZ 1PD3A 3SR2C 4L8JA 4K35A 4NTXA 3TK1A 4EKWA 3STZC 3BEHA 1M57C 3B4SA 3L75H 3CCQV 3CHXA 4DRXA 3ABLB 1Q86W 5CBFA 1TA8A 4JV5B 3FYIB 2R9AA 3UO2A 2N74A 4LBEC 1YTFB 4EEQA 1NTZH 3ABKB 4JYCA 4LF8O 4DV3O 1M57B 2Q4PA 1NQTA 2CTPA 1KBHA 1QR9A 2QWNB 3DC5A 4YIOA 3B2EE 1W2BU 2ITCC 4FFBA 1KECA 1SETA 4UUJC 1Q5OA 2F66C 4I0XB 4NXMO 1RSOB 1BT8A 1VQOV 2UUAO 4GX2A 2CGNA 4OPHA 2Z3YA 4ASUG 3RVZA 4H0LB 3VQVA 2Y4UA 2F95B 1KYOF 1BHAA 1P49A 4WFFA 1NT2B 4FM1A 1IBMB 2UXDO 2HJDA 1FJGB 3B77A 1IURA 4QGPA 2CTRA 1RPRA 1XREA 1WP8A 5IYCO 3JD0A 2QDOA 5B66Z 1AI7A 4LFAB 2UXNA 3CCSV 2AGAA 5B1AC 1K33A 1JQ0A 2A9HA 3G4SV 3M8AA 4H37A 4U7NA 2GBOA 2LFSA 3CEIA 4DV6O 3D36C 2OTLV 3ZEDA 1FXKA 5DEDA 1L8DA 4DV4O 1JCHA 2GUZA 1EBOA 3UT5B 1MZEA 1VEWA 4X1KA 2WSSG 5KHHA 1TVKA 3N2GA 1VQKV 1SZTA 1KUQA 2QTOA 2GDSA 2P22C 4J42A 4CH4A 1FFXB 2JEXA 4HAMA 2HR3A 1OCRC 4J10A 3QTCA 4CZZA 4XBFA 2OTJV 4WBNA 1F4NA 2EINB 4I4TB 3C3SA 3RYHA 3OUFA 4P30A 3H01A 2Z5UA 1OCRB 3K03A 2JGUA 1XMQO 1PNLA 5EK0A 4F6RB 4KXRA 5JVDB 2BOBC 1Y74A 1OJHA 3CRAA 1NI8A 4QE7A 2YIDA 3P30A 3M7MX 1EN5A 1NVPB 4UCRA 1MOFA 4TUYA 4DK1A 1THZA 1YDXA 4LH7A 3QO5A 3L9DA 4X1IA 5KHIA 3OMAB 4AILC 4X8AA 5K1XA 5LA6B 5IWAB 3JD1A 4RAIA 4UCTA 3SDLA 2UXCO 2ZNIA 1HNWO 1BGYH 1U97A 1H2KA 3H1LH 2CAZC 2Q68A 2QM4A 4JI7B 3HB3B 1HNXB 4DR4B 1BE3H 1I94B 1SQGA 4FPPA 3I56V 4OPAA 2PYJA 5GONB 1H2MA 2DYRC 1IDSA 3SYOA 4MVUA 1ZSPA 2Y48A 2AW9A 5KA6A 3QG5A 3APOA 1Q82W 2QM8A 3CCVV 1ZX3A 4NYKA 1WJZA 1BQ0A 2DYRB 4O4JB 1F7YA 3K06A 3JALB 2VQFO 5LGTA 3T2MA 4DR6O 3E35A 1OCCC 5IYBO 3KCYA 2BE3A 3L71H 2OYQA 1ENVA 4I50A 4DUYB 2FL4A 1OCOC 4DV5O 1CXZB 4B7KA 3QO8A 1ZL8B 4JZ2A 3AG2C 4NVPA 1KP2A 3CXHF 2XAGA 1R1BA 2JJ2G 2JRIA 4J9ZB 4O2BA 4ZBMA 3LDDA 5JJEB 2ZT9B 2A79B 2Q7EA 4X20B 4X1YA 1IBLB 4DV1B 3AG1C 4J7KA 4X64B 3OR7C 1M56C 5LGNA 2ZINA 3CB2A 5LP6B 4NXNB 5IYZB 2IJIA 4TQDA 3JCUZ 2QSAA 4LF4B 3OR6C 1F23A 1M56B 4GUNA 4GKKB 1I0HA 3HKCA 3SYQA 1OV9A 3F5WC 3B8NA 2UXBB 5J2TB 1XL4A 4CC5A 3ZMZA 2EULA 1WAZA 3ABMC 5L3GA 4FLZA 4TQFA 3RYFB 2QE7G 4HNAA 1PPJH 5B1NA 4LFBB 2IH1C 1YJNV 2E3CA 4IYHA 2M6YA 5GW7A 1WA8A 3OFNG 3AG4C 1B3QA 1R6TA 4XDKA 1XI1A 1UJWB 3CJHB 2GV9A 1ZTEA 2K9PA 2L6LA 4X66O 1L0LH 4DR5O 1FXHA 4G2KA 4FFKA 2OCHA 1JJ2U 1J95A 1N33B 4B3RO 5IJ9A 1FS0G 1Q90D 1KKCA 1M90W 1SQVH 1SESA 2YXHA 4LF7B 2UUBB 4FFBB 4GX1A 1W59A 2XHBA 1AR1B 1MABG 3HKEA 3ZMVA 4Z1VA 3R65A 2WLIA 2ZIOA 4BWAA 4DV7O 1VF7A 1K3EA 4IHJA 3ZS8C 5EYPA 2X6AA 1V55C 1HNZB 3FYEB 4DR7O 4YXWG 3O9OA 1ROPA 4UV8A 4O4HA 5JCOA 3DC6A 1PKXA 5EIBD 1KKDA 3SGIA 2ZD9A 1DTOA 1V55B 3FB5C 3A0BZ 3TCUA 4YHHB 2PY5A 2HEPA 4KUMA 3E83A 4AQYO 4I9QA 4LH6A 4TT3G 5J2UA 4GCZA 3ZMTA 4AI8A 1SKVA 3ZHVA 3RWRD 5B5EZ 1XEQA 2ARHA 1FXKC 3UCSC 3P32A 3AG3B 5IY5C 2RQ6A 1IVSA 3NR7A 2DE0X 1ZWIC 4ZHQA 1B04A 5LGUA 2PUSA 2Q6AA 3A8TA 2X6BA 2XOKG 3OUSA 4E2LA 3ASNB 1KD1W 5IY5B 3S3XA 2GUZB 1L1FA 2H3OA 3UQ8A 1NU1H 3E89A 4X1KB 5EBWC 2F43G 1XNQB 5KUMA 1KC8W 2CK3G 1TVKB 3N2GB 3JD2A 2QKCA 3SYPA 2NLJC 5D5PA 1H8HG 4PI0A 1XNRB 4LF5B 4NTWA 3OEEG 4JI5B 3ZRXA 2EIJB 1N8RW 1M9NA 3DGEA 1GRJA 1BL8A 3MAQA 4CH5A 2RJZA 2ODMA 3CS5A 2YEVA 2XNDG 3BFRA 5KHKA 2YS8A 1M93A 1I5YA 2M7WA 2R9IA 3B8MA 3CCLV 3RYHB 2AZ2A 3JAWA 2LJ2A 4K8XA 1Q8IA 2PF4E 3X2QB 4UCOA 4D7TA 2ZE7A 1AR4A 3WG7B 4NR1A 4U3FH 1Y74B 1YZBA 1H2SB 3K57A 1EFRG 2XAJA 4JYBA 2E74B 4MVOA 4DR3B 2A7WA 4TUYB 4QNHB 2WLLA 1KP3A 4PD4F 4QPKA 3JAMN 5CB4A 3W7TA 2RDCA 2CTWA 1KQSU 2FKXA 5BY1A 2VWJA 4JI3O 3P3NA 1XUQA 3T1YO 3JSNA 2EIMC 3KCXA 1HW7A 3UO3A 2P7TC 1EN4A 3TXQA 4JYYA 2B9ZA 4PDLA 5C93A 4JI8B 4B3MO 2A06H 3OTOO 2B5UA 4Z1MG 2QKSA 2P67A 3PN1A 1DLBA 3E2EA 2RNBA 3T1HB 4ZI7A 1VQ6V 4DR1O 4DUZO 4FM2A 2B1GA 2ADPA 1QR8A 5CA1A 5KAIZ 2YIAA 4X62O 1WPBA 2GSMB 4QPJA 3TETA 2L35A 3HR0A 5JQGA 5C8YA 1GK9A 1VF6A 5JJJB 4B3SB 5L3DA 4LNUB 4CH3A 1H2NA 1Q6HA 2WWWA 5H9CA 1QLEC 5B3SB 1UFIA 2VQEB 1GKFA 3ZRVA 2AHYA 1AB3A 1D5NA 1TGOA 3RFRA 5KMGA 2B1IA 4WFBV 5DM6V 1RM1C 3LDCA 3EVKA 3LNMB 1NKDA 5KX5A 2R72A
chains in the Genus database with same CATH topology
1IXBA 1BT8A 1N0NA 1P7GA 3AK1A 1AP5A 1XILA 1AR4A 3C3TA 1B06A 4BR6A 1EN5A 1WB7A 1IX9A 2RCVA 3IC9A 1EM1A 4X9QA 3DC6A 1N0JA 4E4EA 4JZGA 1GN2A 1QNMA 1VARA 1LUWA 1XREA 4GUNA 1I0HA 1MNGA 1AP6A 1XUQA 1I08A 1LUVA 1BSMA 1Y67A 1XDCA 1EN4A 1BS3A 4JYYA 1SZXA 1ZUQA 4F6EA 3KKYA 3CEIA 3KDRA 3AK2A 1GN4A 1MMMA 1IDSA 1MSDA 2ADPA 1ZSPA 2ADQB 3AK3A 3OT7A 2AW9A 2P4KA 5A9GA 1WB8A 1VEWA 1AR5A 3LSUA 1JR9A 2CE4A 2QKAA 5AG2A 1GN6A 1EN6A 1ZTEA 2QKCA 2GDSA 4C7UA 2CDYA 3QVNA 4FFKA 3RN4A 1ZLZA 1PL4A 1AVMA 3MDSA 3DC5A 1KKCA 1PM9A 4YIOA 4YIPA 3TJTA 4JZ2A 1D5NA 1MA1A 1JA8A 3BFRA 3C3SA 1GN3A 3EVKA 3K9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IXB A;  1BT8 A;  1N0N A;  1P7G A;  3AK1 A;  1AP5 A;  1XIL A;  1AR4 A;  3C3T A;  1B06 A;  4BR6 A;  1EN5 A;  1WB7 A;  1IX9 A;  2RCV A;  3IC9 A;  1EM1 A;  4X9Q A;  3DC6 A;  1N0J A;  4E4E A;  4JZG A;  1GN2 A;  1QNM A;  1VAR A;  1LUW A;  1XRE A;  4GUN A;  1I0H A;  1MNG A;  1AP6 A;  1XUQ A;  1I08 A;  1LUV A;  1BSM A;  1Y67 A;  1XDC A;  1EN4 A;  1BS3 A;  4JYY A;  1SZX A;  1ZUQ A;  4F6E A;  3KKY A;  3CEI A;  3AK2 A;  1GN4 A;  1MMM A;  1IDS A;  1MSD A;  2ADP A;  1ZSP A;  2ADQ B;  3AK3 A;  3OT7 A;  2AW9 A;  2P4K A;  5A9G A;  1WB8 A;  1VEW A;  1AR5 A;  3LSU A;  1JR9 A;  2CE4 A;  2QKA A;  5AG2 A;  1GN6 A;  1EN6 A;  1ZTE A;  2QKC A;  2GDS A;  4C7U A;  2CDY A;  3QVN A;  4FFK A;  3RN4 A;  1ZLZ A;  1PL4 A;  1AVM A;  3MDS A;  3DC5 A;  1KKC A;  1PM9 A;  4YIO A;  4YIP A;  3TJT A;  4JZ2 A;  1D5N A;  1MA1 A;  1JA8 A;  3BFR A;  3C3S A;  1GN3 A;  3EVK A;  3K9S A; 
#chains in the Genus database with same CATH topology
 1TAE A;  3LSS A;  1VQL V;  3RYI A;  2JS5 A;  2EJR A;  2H94 A;  4TV9 A;  4TSF G;  2ZQM A;  3C3T A;  3JD4 A;  1RM1 B;  3E86 A;  1LR1 A;  4MTX A;  2MW2 B;  4X1Y B;  2X0L A;  4FLU A;  4KP4 A;  1Y76 A;  4YJ3 B;  2A0L A;  1K73 W;  3CXC U;  2D2C B;  1OCZ C;  3K3W A;  1SA0 A;  3G71 V;  1WNS A;  1VAR A;  1IXM A;  1AJN A;  1Q6I A;  5CMU A;  2AZ0 A;  3HKC B;  1Z5W A;  3RYC A;  1QHT A;  1OCZ B;  5TIS Z;  2WA3 A;  3H9V A;  4FLT A;  5EZY B;  2N05 A;  1N34 O;  4JI2 B;  3SJC C;  2ZM6 O;  4KHP B;  1D2D A;  4PHZ A;  4LF9 B;  4B3T O;  3ASO C;  1QLN A;  3AK2 A;  3ZN1 A;  4HNA B;  3JAK B;  4UB6 Z;  3CC2 V;  4MSW C;  4LC1 A;  5LL6 Y;  1WA8 B;  4K3A A;  3KZI Z;  2W6I G;  4FMT A;  2ILM A;  3CCR V;  5LMU B;  4O4L B;  2DYS C;  2K1E A;  2HHH O;  3ETG A;  4PA7 A;  4JI4 O;  4QE9 A;  4LFC B;  3O65 A;  4MTG A;  3RGB A;  3K04 A;  2F4V O;  1GN6 A;  2IU3 A;  4UFZ A;  4YY3 B;  4FLW A;  4P9P A;  2YC0 A;  2QGN A;  2QWO B;  3TXS A;  1NZ6 A;  3OGC C;  2DN9 A;  3JD3 A;  2DYS B;  5B1A B;  3J7A U;  4PA6 A;  2FB5 A;  5J9P C;  4X65 B;  4EFE A;  4G28 B;  4RQE A;  1PM9 A;  4YIP A;  4P9O A;  3ABT A;  1Q3E A;  3FKS G;  2LO1 A;  4HBN A;  4LF6 O;  1R73 A;  2OCC C;  4KFM A;  2V7Q G;  1N32 B;  4I55 A;  5H2F Z;  2Y69 C;  1SQF A;  2JJ1 G;  3CPW U;  5JCO C;  4PV1 B;  2WLI B;  1JJO A;  5ITZ A;  4UVA A;  1B06 A;  2PYL A;  1S5J A;  2OCC B;  4IHJ B;  5EYP B;  1WB7 A;  2WLJ A;  3IC9 A;  1VQ8 V;  3DXR B;  3N2K A;  1JPX A;  2AHZ A;  1N0J A;  2Y69 B;  3BPZ A;  5L3F A;  2AXT Z;  4O4H B;  2BSK A;  1Y66 A;  2IM9 A;  2H8P C;  5IT9 N;  5KA5 A;  4GZR B;  2R70 A;  4JI0 B;  2VWK A;  2ZR3 A;  4LR3 A;  4JI6 B;  2Q9L A;  4X89 A;  5FLX N;  3BY6 A;  1XQ8 A;  3E8G A;  4OGQ B;  1BS3 A;  5LYJ A;  2WLK A;  2OT5 A;  1QCE A;  3HPL C;  3E8H A;  3JAS A;  3IGA C;  1PL0 A;  3W7X A;  1PP9 H;  1EZJ A;  4JYA B;  4UB8 Z;  2ZE6 A;  5H6Q A;  2ADQ B;  1AJP A;  1KB9 F;  2BOC C;  2XAS A;  3LSU A;  2ZDI A;  1EN6 A;  5EIB C;  2V4D A;  3JSL A;  4JV5 O;  1YI2 V;  4B7E A;  2ZCE A;  3OMN B;  2IW5 A;  1S76 D;  4ABM A;  4A5U B;  5BR8 B;  4O4I A;  3E22 A;  4GKJ B;  4CC6 A;  1Z2G A;  2FTK A;  1IZ3 A;  3DSQ A;  2JGD A;  3CC4 V;  1JA8 A;  3KG2 A;  2LW1 A;  3BRC A;  1JFF A;  4FM0 A;  4HZ3 A;  4B08 A;  1S0V A;  2DJV A;  2Q8V A;  3CD6 V;  3JAW B;  4RUE A;  1AP5 A;  5A2Q N;  4PA9 A;  2QWR B;  3OMI B;  5CA0 A;  3UKM A;  1QVF U;  4CS3 A;  3WFV A;  5GTI Z;  3FAV A;  1W0K G;  1IBM O;  1FJG O;  4IGG A;  4Q20 A;  1OCC B;  1Q7Y W;  4G27 B;  1TUB B;  1R3K C;  3QO7 A;  3IAY A;  1GN2 A;  1OCO B;  4DR2 B;  3SPH A;  5K1P A;  4PA3 A;  2IJH A;  1SF9 A;  1XMO B;  1BCC H;  2QR4 A;  1N36 B;  4O2A B;  3STL C;  1VF5 B;  5CBG A;  4LFA O;  3AG2 B;  3K5L A;  1YEW A;  3HKD B;  2HFE C;  3ETE A;  1P4R A;  1H2L A;  1BSM A;  5IJ0 B;  4I7Z B;  1H38 A;  1FKA O;  1K4C C;  4TOI A;  5B1B C;  3OAA G;  2DQ3 A;  1YF2 A;  3AG1 B;  3VOU A;  1R6K A;  4QJF B;  1R3I C;  4DV0 B;  1WP7 A;  1MMM A;  1H5W A;  2G38 A;  1TUE B;  3ZHU A;  1FFT B;  4W4K A;  2PI4 A;  1R6N A;  2Q69 A;  5B1B B;  3SPJ A;  1VF6 C;  1B6Q A;  2HLD G;  1RFY A;  3RVY A;  4I0X A;  5CA1 B;  4CS2 A;  1RSO A;  1VQM V;  2E5L B;  3K58 A;  3DTU B;  4FK5 C;  4JI1 B;  4W4L A;  2LGW A;  1K97 A;  3ZX6 A;  1NH2 D;  1K9M W;  1VP7 A;  3W7S A;  1RPO A;  3ABM B;  4TV8 A;  1IBK B;  5DN6 G;  4WFA V;  5LMN B;  4TWK A;  2UU9 B;  1SQX H;  4ZKI A;  1BMF G;  4EB6 A;  2GTA A;  4WFH A;  3CX5 F;  4GT1 A;  5LHG A;  1IXB A;  3L72 H;  5LXT A;  2PTM A;  3APQ A;  3AG4 B;  1Y6X A;  4DV2 B;  3WU2 Z;  5KX5 B;  4DRX B;  4DK0 A;  2GTS A;  3RYI B;  1XIL A;  3LSQ A;  2W0F C;  3ICX A;  4DO2 A;  4TV9 B;  4P2Z A;  2Q0O C;  4EFB A;  3WB1 A;  3J80 N;  1O9H A;  1NVP D;  1Y76 B;  1YHQ V;  3A0H Z;  4JZG A;  2BTQ A;  2XTA A;  4UCV A;  1FAF A;  5JH7 A;  3CRQ A;  2LP7 A;  5IWA O;  2UUC B;  2DOS A;  2ATK C;  3D8C A;  4NTY A;  2OWO A;  3UT5 A;  4FLY A;  3ZCC A;  1BZK A;  2MK3 A;  4IL6 Z;  3RYC B;  1Y67 A;  2CH7 A;  4JI7 O;  1HNX O;  3GB7 C;  1FXV A;  4OX9 B;  4DR4 O;  1V54 C;  1ZUQ A;  1FFX A;  1E1Q G;  1I94 O;  2LQT A;  2WPD G;  3SPC A;  1JNB A;  2KB1 A;  3F7V C;  2DWD C;  1HR0 B;  3EFF K;  3IJ4 A;  1ZAU A;  1SQB H;  1US6 A;  4GLX A;  1MSD A;  1V54 B;  3WB0 A;  3AEI A;  1YIJ V;  1HDJ A;  1ORQ C;  4I4T A;  4LP8 A;  1CP9 A;  4MW3 A;  4BIZ A;  5L3E A;  4JAS A;  1VQP V;  1K8A W;  1FD9 A;  4ICG A;  3BCC H;  5EBL C;  3L70 H;  3OE7 G;  4F6R A;  5JVD A;  3H1I H;  2Q67 A;  3D3I A;  4UCU A;  4LF8 B;  4DUY O;  4DV3 B;  4MW8 A;  1FXK B;  1VQN V;  4XDL A;  3G6E V;  4J41 A;  1MA1 A;  5IYD O;  3FX7 A;  3Q4H A;  3S3W A;  3K9S A;  5LA6 A;  4NXM B;  3J81 N;  3TGU H;  3ZHS A;  1DF5 A;  4RO2 A;  3CRR A;  2UUA B;  3R66 A;  5CN0 A;  4I55 B;  1H2G A;  1IBL O;  4DV1 O;  4X64 O;  3FFQ A;  5BMV A;  5ITZ B;  3F5T A;  2EIK C;  4BW9 A;  4NXN O;  3K5N A;  2Q5Z A;  2P90 A;  2PGG A;  3N2K B;  4MVQ A;  4WBN B;  5LHH A;  2UXD B;  2HJF C;  4LF4 O;  4PA4 A;  3SJQ C;  5BXZ A;  1VQ9 V;  1MSW D;  4GKK O;  1LUW A;  1NS1 A;  5FL7 G;  2BTO A;  3D3Q A;  1G8M A;  2C2A A;  1K5S A;  3W7W A;  2IU0 A;  1FYJ A;  2UXB O;  1YCI A;  4RUF A;  4FJC C;  1NR7 A;  3K0D A;  3JAL A;  4MVZ A;  1GM8 A;  4N23 A;  3SYA A;  4LFB O;  4CH6 A;  5LYJ B;  4WF9 V;  4DV6 B;  4X1I B;  4IT5 A;  2GHY A;  3CYO A;  2ZDI C;  1X4T A;  4DV4 B;  3OT7 A;  1YXB A;  1BQZ A;  2QKA A;  1JVM A;  4LCU C;  5D5Q A;  1SRY A;  4DV2 O;  3L74 H;  4NKG B;  1DGS A;  4X20 A;  2KKW A;  5FPR A;  3H1J H;  1Q6U A;  4R50 A;  2CDY A;  2EIM B;  4MTF A;  4DW1 A;  1N33 O;  4O4I B;  3E22 B;  5GTH Z;  1G4Y B;  5LP6 A;  3K5O A;  2KG7 A;  3MDS A;  3NXS A;  2HG5 C;  4ZIB A;  4FZ1 A;  3JYC A;  4DW0 A;  1FPO A;  1Q43 A;  4LF7 O;  2UUB O;  2JGD B;  1P7G A;  2YI8 A;  3H1H H;  3CMA V;  3IFX A;  4R8C A;  5EC1 C;  1T5E A;  1XMQ B;  3K08 A;  3EHB B;  5LBQ A;  3PJS K;  1Q81 W;  2XUM A;  2IJK A;  5J2T A;  1K92 A;  4FLX A;  4GX5 A;  1HNZ O;  1XHX A;  2QWP B;  4JTA B;  4I50 B;  3BA9 A;  3ZRS A;  1QLE B;  1GM9 A;  3VQW A;  3B09 A;  3CCE V;  1YIT V;  4YHH O;  5E79 Z;  4YJ2 A;  4JF3 A;  3G6B A;  4I9W A;  2D3O W;  4XDJ A;  4O2B B;  3ABL C;  3F7Y C;  3SPG A;  1RP3 B;  1I08 A;  2UXC B;  2EZO A;  2P4V A;  2JEU A;  5LOV A;  1HNW B;  3CJH A;  2RMK B;  3JAT A;  2UXX A;  3ABK C;  4IIJ A;  1A32 A;  4X88 A;  2JK5 C;  4H44 B;  1GO3 F;  1EZV H;  4PDV A;  2CTQ A;  2OIE A;  1L0N H;  1G6U A;  3VQX A;  1I7F A;  2Y4T A;  4Q6G A;  3CCU V;  1XHZ A;  1AR5 A;  2CE4 A;  4WFG A;  2YIC A;  1S5L Z;  1MZF A;  2DMX A;  5B1O A;  3WB2 A;  4WCE V;  1XNQ O;  4U7O A;  3MHS C;  1G1X B;  2VQF B;  2E75 B;  4LWS A;  1GAX A;  3ETD A;  3ZMU A;  2HVJ C;  1XNR O;  4DR6 B;  1PNM A;  3VQY A;  4LF5 O;  4JI5 O;  4TV8 B;  2W6J G;  4DV5 B;  3ASO B;  1S5H C;  1HWY A;  3U0Z A;  3BA8 A;  4NB5 A;  2EZP A;  4EB6 B;  4MVM A;  3LUT B;  1N0N A;  5EBM C;  1GTO A;  1YJW V;  1JMK C;  3K79 A;  4D6T H;  5LXT B;  4UXN A;  3AK1 A;  2ETN A;  3UM7 A;  1AI6 A;  1OZ0 A;  2XAH A;  4ZOL A;  4DR3 O;  1IX9 A;  1GMG A;  5IJ9 B;  1EM1 A;  4PDR A;  4X9Q A;  2ITD C;  3ZHR A;  1JOY A;  2F1M A;  2LW7 A;  1SER A;  4D7S A;  1XL6 A;  1WPX A;  1K7D A;  2BTQ B;  3U11 A;  3HKE B;  5JH7 B;  3JAR A;  5KLV H;  1YSC A;  1Z5V A;  3CP1 A;  3ZN0 A;  5JWP A;  2EIL C;  5FNV A;  1NH2 B;  1K4D C;  1E79 G;  2CH7 B;  4U3J A;  4KL1 A;  2XAF A;  4JI8 O;  5DEC A;  2F23 A;  1LNQ A;  1SQP H;  2EIN C;  3T1H O;  1COW G;  2EIL B;  2V1D A;  2LGQ A;  3CC7 V;  4I5S A;  3RW0 A;  2JS3 A;  5E1A C;  3CRC A;  1WLE A;  3HKB A;  4JAU A;  3CME V;  5J2U B;  2KQX A;  1VMG A;  1VIB A;  1S77 D;  4JPR A;  2QTS A;  4B3S O;  1H8E G;  2Q73 A;  2QJ1 A;  2YI9 A;  4DXW A;  4X66 B;  1P7B A;  2Z0A A;  4DR5 B;  2VQE O;  1UPG A;  3A0R A;  1SQQ H;  4B3R B;  4ZHQ B;  4J7J A;  3AG7 A;  3K59 A;  3ZRW A;  2NR5 A;  3JCZ A;  1GM7 A;  1JX9 A;  2DW4 A;  4DYL A;  3A2F A;  3CCM V;  3Q4H B;  2YIB D;  4GYC B;  4MS2 A;  2XT9 A;  4RQF A;  4DV7 B;  2P5O A;  4BIU A;  3U10 A;  4FVM A;  1YTF D;  2RCV A;  4DR7 B;  1M4U A;  4FZ0 A;  4Z2W A;  5BMV B;  3ZHT A;  4PI2 A;  2OIG A;  4E4E A;  2YEV B;  1I5X A;  3CWB H;  2EBO A;  1MG1 A;  3ZJZ A;  2QWQ B;  4J80 A;  1MNG A;  4AQY B;  1AP6 A;  3THO A;  3VBB A;  1SS3 A;  1R3L C;  3B40 A;  5KAF Z;  4JI2 O;  1PV0 A;  4KHP O;  2YXY A;  1U96 A;  4LNU A;  4LF9 O;  1SC5 B;  5LHI A;  1J5E B;  2IH3 C;  3LNN A;  2WLL B;  3I5D A;  5CB4 B;  1CEZ A;  4JAA A;  1NTM H;  3ETQ A;  1P84 F;  2WLM A;  2KSD A;  3OGI B;  3LDE A;  5LMU O;  1YVW A;  1Y4M A;  2YIB A;  3FB7 C;  3IC7 A;  3OEH G;  4PDM A;  4LFC O;  2YDE A;  4YY3 O;  2ZIM A;  4K0K B;  3C90 A;  1FOU A;  2Q0A A;  5LP6 C;  2WA4 A;  2ZE8 A;  1R3J C;  4UVB A;  5F2V O;  2QEX V;  4X65 O;  5KUK A;  2WLN A;  4L87 A;  2DWE C;  4ZI7 B;  2X6C A;  4YJ3 A;  2KG7 B;  2Q7H A;  3I55 V;  3L73 H;  5JQG B;  5C8Y B;  1S72 V;  1N32 O;  2ZKO A;  2PZS A;  3ABU A;  4BIO A;  1VQ5 V;  5EZY A;  4J11 A;  1N4C A;  2ZR2 A;  1VQ4 V;  2Q7G A;  1QQC A;  2DQ0 A;  2Y0P A;  3JAK A;  4UVC A;  2ZXW C;  5KMG B;  3T4D A;  1NJI W;  3MHH C;  1URF A;  2ZE5 A;  1QBZ A;  4YJ2 B;  4FLV A;  4JI0 O;  4JI3 B;  4O4L A;  5EC2 C;  5CA3 A;  2IBZ H;  3FB8 C;  1XOU A;  2ZXW B;  4R6Z A;  4JI6 O;  2CGO A;  3T1Y B;  1NTK H;  2WLH A;  5LOV B;  4AHC A;  3JAT B;  1QU7 A;  3K0G A;  4IIJ B;  4F6E A;  2FYU H;  4MT8 A;  2XAQ A;  1M5I A;  4B3M B;  4J7Z A;  3OTO B;  4MVS A;  4JYA O;  1BHB A;  1SA0 B;  5L3C A;  4DR1 B;  4DUZ B;  3G80 A;  3BAA A;  3AK3 A;  3D36 A;  1IJG A;  1K5Q A;  1WB8 A;  5AG2 A;  1JR9 A;  4X62 B;  2YUA A;  2P6J A;  2PI5 A;  4CS4 A;  1CPY A;  2W0X A;  3K5M A;  2FML A;  5BR8 O;  1K34 A;  3G67 A;  4LWS B;  3RN4 A;  4GKJ O;  2JDI G;  3GVM A;  1ZLZ A;  3DXR A;  1AVM A;  3FB6 C;  4FIP C;  4BW5 A;  1F51 A;  5H6R A;  2HKO A;  1NR1 A;  3ZIA G;  4JTD B;  3E8F A;  4PJ0 Z;  2VS0 A;  5L3B A;  1F4M A;  4MVR A;  4OXS A;  1HP8 A;  4PEL A;  3AG3 C;  3MD0 A;  3GWK C;  1VQ7 V;  1O9G A;  4BR6 A;  4H13 B;  2HVK C;  4HYO A;  4ZOL B;  3SJA C;  5FPO A;  5KHG A;  3BHP A;  2VRZ A;  2F93 B;  2IJJ A;  2WAM A;  3ASN C;  1J5E O;  3QNE A;  2JVD A;  1QNM A;  4DR2 O;  4CBC A;  1XMO O;  2BCC H;  3GWO A;  4BAY A;  1N36 O;  1OHH G;  2YSU B;  5CBH A;  1AJQ A;  1LUV A;  1S3J A;  2YXL A;  5IDJ A;  3JAR B;  3OW2 U;  1N34 B;  3OD4 A;  4K0K O;  1WN7 A;  2JIZ G;  2P06 A;  2EIJ C;  5FNV B;  1SZX A;  1W0J G;  3T1C A;  2ZM6 B;  4B3T B;  2NN4 A;  5GON A;  1XBL A;  4U3J B;  1GN4 A;  2BSK B;  4QIW F;  4DV0 O;  2RN9 A;  3SJB C;  3CE2 A;  3CRM A;  2EIK B;  5HFL A;  4RWU A;  3N27 A;  2NNU A;  4UCS A;  1AI5 A;  4JAV A;  4UV9 A;  5HFM A;  5A9G A;  3T4Z A;  3HKB B;  3X2Q C;  4O4J A;  4H33 A;  2HHH B;  4MTO A;  2E5L O;  4JI4 B;  2F4V B;  3WG7 C;  3CSX A;  4JI1 O;  3RBZ A;  2QA4 V;  1AI4 A;  4K8Z A;  3QF7 A;  4J9Y B;  2EX3 A;  2EJ7 A;  3ML0 A;  4C7U A;  3SYC A;  3ZHQ A;  3JAS B;  3QVN A;  3K9A A;  1IBK O;  3E8B A;  1ZL8 A;  2UU9 O;  1PL4 A;  5LMN O;  1YJ9 V;  3TJT A;  2E76 B;  1ARO P;  2A3Q A;  3SPI A;  2LFR A;  2O57 A;  1QVG U;  3ZMS A;  1TUB A;  4LF6 B;  3ZRW B;  1GN3 A;  2HP8 A;  4O2A A;  3CCJ V;  1M1K W;  3HKD A;  4WFE A;  4JGS A;  5IJ0 A;  2CUG A;  3BVO A;  4GX0 A;  5IYZ A;  2X7R B;  5IE9 A;  1V9P A;  1DF4 A;  3ZBH A;  4JTC B;  1JFF B;  3P3P A;  2QM7 A;  1E1R G;  1D5A A;  1GH6 A;  3EXA A;  2UUC O;  5BZB A;  2ZNJ A;  2N04 A;  4N21 A;  5H5N A;  4R7C A;  3FD9 A;  1X59 A;  1PNK A;  4IYI A;  3M99 B;  1XDC A;  3BAB A;  5B3S C;  5CA0 B;  3RYF A;  1NBM G;  2Y0I A;  4OX9 O;  4F4L A;  3W7U A;  3FAV B;  1KU9 A;  1AIL A;  3KKY A;  3OM3 B;  1DK1 A;  3KDR A;  5KHJ A;  1HR0 O;  2R9R B;  3H1K H;  5JJN B;  3OTF A;  3RT3 C;  2P4K A;  1KMI Z;  1PD3 A;  3SR2 C;  4L8J A;  4K35 A;  4NTX A;  3TK1 A;  4EKW A;  3STZ C;  3BEH A;  1M57 C;  3B4S A;  3L75 H;  3CCQ V;  3CHX A;  4DRX A;  3ABL B;  1Q86 W;  5CBF A;  1TA8 A;  4JV5 B;  3FYI B;  2R9A A;  3UO2 A;  2N74 A;  4LBE C;  1YTF B;  4EEQ A;  1NTZ H;  3ABK B;  4JYC A;  4LF8 O;  4DV3 O;  1M57 B;  2Q4P A;  1NQT A;  2CTP A;  1KBH A;  1QR9 A;  2QWN B;  3DC5 A;  4YIO A;  3B2E E;  1W2B U;  2ITC C;  4FFB A;  1KEC A;  1SET A;  4UUJ C;  1Q5O A;  2F66 C;  4I0X B;  4NXM O;  1RSO B;  1BT8 A;  1VQO V;  2UUA O;  4GX2 A;  2CGN A;  4OPH A;  2Z3Y A;  4ASU G;  3RVZ A;  4H0L B;  3VQV A;  2Y4U A;  2F95 B;  1KYO F;  1BHA A;  1P49 A;  4WFF A;  1NT2 B;  4FM1 A;  1IBM B;  2UXD O;  2HJD A;  1FJG B;  3B77 A;  1IUR A;  4QGP A;  2CTR A;  1RPR A;  1XRE A;  1WP8 A;  5IYC O;  3JD0 A;  2QDO A;  5B66 Z;  1AI7 A;  4LFA B;  2UXN A;  3CCS V;  2AGA A;  5B1A C;  1K33 A;  1JQ0 A;  2A9H A;  3G4S V;  3M8A A;  4H37 A;  4U7N A;  2GBO A;  2LFS A;  3CEI A;  4DV6 O;  3D36 C;  2OTL V;  3ZED A;  1FXK A;  5DED A;  1L8D A;  4DV4 O;  1JCH A;  2GUZ A;  1EBO A;  3UT5 B;  1MZE A;  1VEW A;  4X1K A;  2WSS G;  5KHH A;  1TVK A;  3N2G A;  1VQK V;  1SZT A;  1KUQ A;  2QTO A;  2GDS A;  2P22 C;  4J42 A;  4CH4 A;  1FFX B;  2JEX A;  4HAM A;  2HR3 A;  1OCR C;  4J10 A;  3QTC A;  4CZZ A;  4XBF A;  2OTJ V;  4WBN A;  1F4N A;  2EIN B;  4I4T B;  3C3S A;  3RYH A;  3OUF A;  4P30 A;  3H01 A;  2Z5U A;  1OCR B;  3K03 A;  2JGU A;  1XMQ O;  1PNL A;  5EK0 A;  4F6R B;  4KXR A;  5JVD B;  2BOB C;  1Y74 A;  1OJH A;  3CRA A;  1NI8 A;  4QE7 A;  2YID A;  3P30 A;  3M7M X;  1EN5 A;  1NVP B;  4UCR A;  1MOF A;  4TUY A;  4DK1 A;  1THZ A;  1YDX A;  4LH7 A;  3QO5 A;  3L9D A;  4X1I A;  5KHI A;  3OMA B;  4AIL C;  4X8A A;  5K1X A;  5LA6 B;  5IWA B;  3JD1 A;  4RAI A;  4UCT A;  3SDL A;  2UXC O;  2ZNI A;  1HNW O;  1BGY H;  1U97 A;  1H2K A;  3H1L H;  2CAZ C;  2Q68 A;  2QM4 A;  4JI7 B;  3HB3 B;  1HNX B;  4DR4 B;  1BE3 H;  1I94 B;  1SQG A;  4FPP A;  3I56 V;  4OPA A;  2PYJ A;  5GON B;  1H2M A;  2DYR C;  1IDS A;  3SYO A;  4MVU A;  1ZSP A;  2Y48 A;  2AW9 A;  5KA6 A;  3QG5 A;  3APO A;  1Q82 W;  2QM8 A;  3CCV V;  1ZX3 A;  4NYK A;  1WJZ A;  1BQ0 A;  2DYR B;  4O4J B;  1F7Y A;  3K06 A;  3JAL B;  2VQF O;  5LGT A;  3T2M A;  4DR6 O;  3E35 A;  1OCC C;  5IYB O;  3KCY A;  2BE3 A;  3L71 H;  2OYQ A;  1ENV A;  4I50 A;  4DUY B;  2FL4 A;  1OCO C;  4DV5 O;  1CXZ B;  4B7K A;  3QO8 A;  1ZL8 B;  4JZ2 A;  3AG2 C;  4NVP A;  1KP2 A;  3CXH F;  2XAG A;  1R1B A;  2JJ2 G;  2JRI A;  4J9Z B;  4O2B A;  4ZBM A;  3LDD A;  5JJE B;  2ZT9 B;  2A79 B;  2Q7E A;  4X20 B;  4X1Y A;  1IBL B;  4DV1 B;  3AG1 C;  4J7K A;  4X64 B;  3OR7 C;  1M56 C;  5LGN A;  2ZIN A;  3CB2 A;  5LP6 B;  4NXN B;  5IYZ B;  2IJI A;  4TQD A;  3JCU Z;  2QSA A;  4LF4 B;  3OR6 C;  1F23 A;  1M56 B;  4GUN A;  4GKK B;  1I0H A;  3HKC A;  3SYQ A;  1OV9 A;  3F5W C;  3B8N A;  2UXB B;  5J2T B;  1XL4 A;  4CC5 A;  3ZMZ A;  2EUL A;  1WAZ A;  3ABM C;  5L3G A;  4FLZ A;  4TQF A;  3RYF B;  2QE7 G;  4HNA A;  1PPJ H;  5B1N A;  4LFB B;  2IH1 C;  1YJN V;  2E3C A;  4IYH A;  2M6Y A;  5GW7 A;  1WA8 A;  3OFN G;  3AG4 C;  1B3Q A;  1R6T A;  4XDK A;  1XI1 A;  1UJW B;  3CJH B;  2GV9 A;  1ZTE A;  2K9P A;  2L6L A;  4X66 O;  1L0L H;  4DR5 O;  1FXH A;  4G2K A;  4FFK A;  2OCH A;  1JJ2 U;  1J95 A;  1N33 B;  4B3R O;  5IJ9 A;  1FS0 G;  1Q90 D;  1KKC A;  1M90 W;  1SQV H;  1SES A;  2YXH A;  4LF7 B;  2UUB B;  4FFB B;  4GX1 A;  1W59 A;  2XHB A;  1AR1 B;  1MAB G;  3HKE A;  3ZMV A;  4Z1V A;  3R65 A;  2WLI A;  2ZIO A;  4BWA A;  4DV7 O;  1VF7 A;  1K3E A;  4IHJ A;  3ZS8 C;  5EYP A;  2X6A A;  1V55 C;  1HNZ B;  3FYE B;  4DR7 O;  4YXW G;  3O9O A;  1ROP A;  4UV8 A;  4O4H A;  5JCO A;  3DC6 A;  1PKX A;  5EIB D;  1KKD A;  3SGI A;  2ZD9 A;  1DTO A;  1V55 B;  3FB5 C;  3A0B Z;  3TCU A;  4YHH B;  2PY5 A;  2HEP A;  4KUM A;  3E83 A;  4AQY O;  4I9Q A;  4LH6 A;  4TT3 G;  5J2U A;  4GCZ A;  3ZMT A;  4AI8 A;  1SKV A;  3ZHV A;  3RWR D;  5B5E Z;  1XEQ A;  2ARH A;  1FXK C;  3UCS C;  3P32 A;  3AG3 B;  5IY5 C;  2RQ6 A;  1IVS A;  3NR7 A;  2DE0 X;  1ZWI C;  4ZHQ A;  1B04 A;  5LGU A;  2PUS A;  2Q6A A;  3A8T A;  2X6B A;  2XOK G;  3OUS A;  4E2L A;  3ASN B;  1KD1 W;  5IY5 B;  3S3X A;  2GUZ B;  1L1F A;  2H3O A;  3UQ8 A;  1NU1 H;  3E89 A;  4X1K B;  5EBW C;  2F43 G;  1XNQ B;  5KUM A;  1KC8 W;  2CK3 G;  1TVK B;  3N2G B;  3JD2 A;  2QKC A;  3SYP A;  2NLJ C;  5D5P A;  1H8H G;  4PI0 A;  1XNR B;  4LF5 B;  4NTW A;  3OEE G;  4JI5 B;  3ZRX A;  2EIJ B;  1N8R W;  1M9N A;  3DGE A;  1GRJ A;  1BL8 A;  3MAQ A;  4CH5 A;  2RJZ A;  2ODM A;  3CS5 A;  2YEV A;  2XND G;  3BFR A;  5KHK A;  2YS8 A;  1M93 A;  1I5Y A;  2M7W A;  2R9I A;  3B8M A;  3CCL V;  3RYH B;  2AZ2 A;  3JAW A;  2LJ2 A;  4K8X A;  1Q8I A;  2PF4 E;  3X2Q B;  4UCO A;  4D7T A;  2ZE7 A;  1AR4 A;  3WG7 B;  4NR1 A;  4U3F H;  1Y74 B;  1YZB A;  1H2S B;  3K57 A;  1EFR G;  2XAJ A;  4JYB A;  2E74 B;  4MVO A;  4DR3 B;  2A7W A;  4TUY B;  4QNH B;  2WLL A;  1KP3 A;  4PD4 F;  4QPK A;  3JAM N;  5CB4 A;  3W7T A;  2RDC A;  2CTW A;  1KQS U;  2FKX A;  5BY1 A;  2VWJ A;  4JI3 O;  3P3N A;  1XUQ A;  3T1Y O;  3JSN A;  2EIM C;  3KCX A;  1HW7 A;  3UO3 A;  2P7T C;  1EN4 A;  3TXQ A;  4JYY A;  2B9Z A;  4PDL A;  5C93 A;  4JI8 B;  4B3M O;  2A06 H;  3OTO O;  2B5U A;  4Z1M G;  2QKS A;  2P67 A;  3PN1 A;  1DLB A;  3E2E A;  2RNB A;  3T1H B;  4ZI7 A;  1VQ6 V;  4DR1 O;  4DUZ O;  4FM2 A;  2B1G A;  2ADP A;  1QR8 A;  5CA1 A;  5KAI Z;  2YIA A;  4X62 O;  1WPB A;  2GSM B;  4QPJ A;  3TET A;  2L35 A;  3HR0 A;  5JQG A;  5C8Y A;  1GK9 A;  1VF6 A;  5JJJ B;  4B3S B;  5L3D A;  4LNU B;  4CH3 A;  1H2N A;  1Q6H A;  2WWW A;  5H9C A;  1QLE C;  5B3S B;  1UFI A;  2VQE B;  1GKF A;  3ZRV A;  2AHY A;  1AB3 A;  1D5N A;  1TGO A;  3RFR A;  5KMG A;  2B1I A;  4WFB V;  5DM6 V;  1RM1 C;  3LDC A;  3EVK A;  3LNM B;  1NKD A;  5KX5 A;  2R72 A; 
#chains in the Genus database with same CATH homology
 1IXB A;  1BT8 A;  1N0N A;  1P7G A;  3AK1 A;  1AP5 A;  1XIL A;  1AR4 A;  3C3T A;  1B06 A;  4BR6 A;  1EN5 A;  1WB7 A;  1IX9 A;  2RCV A;  3IC9 A;  1EM1 A;  4X9Q A;  3DC6 A;  1N0J A;  4E4E A;  4JZG A;  1GN2 A;  1QNM A;  1VAR A;  1LUW A;  1XRE A;  4GUN A;  1I0H A;  1MNG A;  1AP6 A;  1XUQ A;  1I08 A;  1LUV A;  1BSM A;  1Y67 A;  1XDC A;  1EN4 A;  1BS3 A;  4JYY A;  1SZX A;  1ZUQ A;  4F6E A;  3KKY A;  3CEI A;  3KDR A;  3AK2 A;  1GN4 A;  1MMM A;  1IDS A;  1MSD A;  2ADP A;  1ZSP A;  2ADQ B;  3AK3 A;  3OT7 A;  2AW9 A;  2P4K A;  5A9G A;  1WB8 A;  1VEW A;  1AR5 A;  3LSU A;  1JR9 A;  2CE4 A;  2QKA A;  5AG2 A;  1GN6 A;  1EN6 A;  1ZTE A;  2QKC A;  2GDS A;  4C7U A;  2CDY A;  3QVN A;  4FFK A;  3RN4 A;  1ZLZ A;  1PL4 A;  1AVM A;  3MDS A;  3DC5 A;  1KKC A;  1PM9 A;  4YIO A;  4YIP A;  3TJT A;  4JZ2 A;  1D5N A;  1MA1 A;  1JA8 A;  3BFR A;  3C3S A;  1GN3 A;  3EVK A;  3K9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...