1VEWA

Manganese superoxide dismutase from escherichia coli
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Escherichia coli manganese superoxide dismutase at 2.1-angstrom resolution.
pubmed rcsb
molecule tags Oxidoreductase
total genus 75
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1vewA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1vewA02
1MMMA 3IC9A 3KKYA 1ZTEA 1BS3A 3C3TA 1AP5A 3MDSA 4JZGA 4X9QA 1GN2A 3EVKA 1XILA 1MNGA 1ZLZA 1XUQA 3DC5A 1I0HA 1I08A 1XREA 2ADQB 2CDYA 1EN6A 1Y67A 1D5NA 2CE4A 1IDSA 1JR9A 4C7UA 1VEWA 3CEIA 3LSUA 4JZ2A 2AW9A 2GDSA 5AG2A 1GN3A 1MSDA 1WB8A 1AVMA 3QVNA 4E4EA 1BSMA 4JYYA 3AK1A 1MA1A 3DC6A 1WB7A 3TJTA 1GN4A 1KKCA 1LUVA 1EM1A 2QKAA 3AK3A 5A9GA 1AR5A 1AR4A 1EN5A 4F6EA 1QNMA 3OT7A 1BT8A 1IX9A 4YIPA 3BFRA 1GN6A 4YIOA 1B06A 1EN4A 1AP6A 3RN4A 1N0NA 1IXBA 3K9SA 1N0JA 1LUWA 4GUNA 2RCVA 4BR6A 2ADPA 1PL4A 1VARA 2P4KA 1ZUQA 3C3SA 1PM9A 2QKCA 4FFKA 1P7GA 1XDCA 1ZSPA 3AK2A 1JA8A 1SZXA
chains in the Genus database with same CATH superfamily
4KFMA 2EILB 2HLDG 3LUTB 4MT8A 4P2ZA 2JVDA 1VIBA 3L72H 4WFGA 2W0XA 3RT3C 3ZCCA 5LP6A 3OUSA 5JQGA 3HKCA 3N2KB 4PV1B 2XT9A 3VQXA 4CC5A 2XAGA 2BE3A 3HKDA 2XAJA 2GHYA 1XQ8A 4TOIA 2DWDC 3IFXA 2VWJA 3TK1A 3JD1A 3E83A 3ASNB 1YITV 2AW9A 1AJNA 1GN3A 4IHJB 1IBLO 4X20A 3H1JH 4PA4A 2JEUA 1KBHA 2CAZC 3G4SV 4FLXA 1NQTA 1HNXO 1EZVH 1G4YB 3SDLA 4CS4A 4RWUA 1HNXB 2HR3A 2ATKC 3BEHA 4G27B 1VQ8V 2HFEC 1I5XA 3QO8A 1PNMA 4DO2A 2X7RB 4X64O 1TUBA 4JAVA 4X64B 1HW7A 2P06A 2OTLV 5B1NA 2ZDIC 2HVKC 2FTKA 4Z2WA 2RMKB 2EILC 1WPBA 1Q8IA 3B8NA 5KMGB 2QWRB 1SQQH 3R66A 2WA4A 2UXCO 5EBMC 2VRZA 2UXCB 4UVBA 3BAAA 4HBNA 1TAEA 5CMUA 4NVPA 3CMEV 1FYJA 2F4VO 4TUYA 2F4VB 1ZAUA 4LF4B 5HFLA 2CUGA 3CCUV 4DR3O 1H8HG 4LCUC 5J2TB 2M7WA 4DR3B 3ASNC 3EHBB 2ITDC 1J95A 4LF6O 4K8ZA 1YEWA 1RPRA 2ITCC 3GVMA 3KKYA 5J2UB 4PA3A 3MDSA 2E75B 4DW1A 5J9PC 1M1KW 2WLIA 3JD2A 2XASA 3JAWB 2CGOA 2QJ1A 5CA3A 5D5PA 1J5EO 4DXWA 3UQ8A 4UCUA 5IY5B 1J5EB 2JIZG 3WG7B 3RVYA 2B1GA 3E22B 3B40A 3OEHG 2YUAA 3LDDA 1Q3EA 5IDJA 3UKMA 3P3NA 4X8AA 4PA9A 5FL7G 1U96A 3ZMTA 3CS5A 4N21A 2V7QG 2YSUB 1D5AA 1OCOC 5A2QN 4CH3A 4DRXA 1YI2V 3JAKB 3JARB 5B1BB 4EEQA 4X1IB 3ZMZA 1QNMA 4YIPA 5JCOC 3ZN1A 4RQFA 1FXVA 2CGNA 5KLVH 1H2GA 2OTJV 1QVGU 1KQSU 4ICGA 4ZOLB 2EJ7A 2IM9A 2EZPA 3U0ZA 5D5QA 2VQEO 3KDRA 2K1EA 4DK1A 3HKEB 2YXHA 3OTFA 1S5HC 4TT3G 5ITZB 4CH5A 1M9NA 4GUNA 4BR6A 2MW2B 4B08A 2UXBO 3OGCC 4LFCO 1ZUQA 2UXBB 4LFCB 1BE3H 4JASA 1JFFA 4B3TO 3IGAC 5BZBA 4YJ2A 4B3TB 1KP2A 3WG7C 3RYFA 4O4JB 2JS3A 3ZMVA 3ETQA 2R9IA 2R9RB 2Q6AA 4W4KA 5CB4B 4EB6A 1X4TA 2ZKOA 1R3KC 4JYAO 1K73W 5JH7A 4JYAB 3ABMB 2JGDA 3K5OA 1EN6A 4LNUB 1W59A 1ZWIC 3K79A 1YSCA 5B1BC 2F66C 4JYCA 5AG2A 3SYQA 3HPLC 1Y74B 3BRCA 2MK3A 3CCSV 5IYZA 3JCUZ 3QO5A 3T4DA 2IW5A 4MSWC 3FB7C 1SRYA 1KUQA 4FVMA 5LL6Y 4DR4O 3K3WA 1KKCA 2Y4UA 1S76D 4DR4B 1KB9F 2DWEC 5LGTA 4PI2A 5A9GA 5IJ9A 5LA6B 5KHGA 1R6NA 2EIMB 2YI8A 5CA1A 3CB2A 4JI3O 1VQNV 1OCZB 4JI3B 3RN4A 2OIEA 1RM1B 5LBQA 5FLXN 1F7YA 3W7SA 4NB5A 4QJFB 4TV8A 1JNBA 2FKXA 5EC1C 4JTAB 3JASB 1Z5VA 3L70H 2EINB 3ABMC 4O2BA 3SJCC 4PDRA 3DTUB 3L73H 2D3OW 1P7GA 2RQ6A 1Q5OA 4PD4F 3ZHQA 5C93A 1MMMA 4FIPC 1K4CC 4DR2O 4H33A 2UXDO 4DR2B 2UXDB 4LH6A 4AQYO 2Q4PA 4NXMO 1R6KA 4AQYB 4TQDA 4NXMB 1YIJV 4X9QA 2PYJA 3MAQA 3F7YC 4ZHQB 3ML0A 3I55V 3PN1A 1JQ0A 3AG2B 4I4TA 3ZBHA 1FFXB 1S72V 1JR9A 3DGEA 2XAHA 2KB1A 1BZKA 3OAAG 1P84F 3LSUA 2EIMC 4EFBA 1W2BU 4CBCA 4X1YB 3K57A 1H2MA 5KA5A 1E1RG 3ZHRA 1BCCH 3IAYA 2NLJC 2GTSA 1OCZC 4BW9A 4MVUA 3VQVA 1KC8W 2XHBA 3JATA 1NS1A 1RM1C 1QBZA 2PGGA 2WAMA 5C8YA 2YIBD 1Y66A 4CH6A 5B5EZ 5E79Z 4LBEC 4B3SO 3SPJA 4FM1A 4I0XA 3UT5B 4F6RB 4B3SB 1BQZA 4HNAA 4UFZA 4F6EA 1BT8A 1R1BA 2N05A 2YIDA 4LF5O 1M5IA 4G28B 4LF5B 1M57B 3CWBH 2DN9A 2LJ2A 4DR7O 3TXSA 3OW2U 4DR7B 3WU2Z 2IBZH 2A79B 3WB2A 1MSWD 2IU0A 4FM0A 1WN7A 2HJFC 1SQXH 2EZOA 3K58A 4G2KA 1WP8A 3CPWU 2XTAA 3H1LH 5KA6A 1N33O 3T4ZA 2EBOA 5L3EA 1K33A 1N33B 3RYCA 1SA0A 4NXNO 3C90A 3OD4A 4JI7B 1N4CA 2GTAA 4R50A 2R70A 4GLXA 4P9PA 4HZ3A 2GBOA 3FYIB 3UCSC 1FJGO 1FJGB 1GN2A 4WF9V 1XUQA 3GWOA 4X66O 4X66B 4XDKA 1CPYA 1QR8A 3CYOA 3B09A 3D36A 1RP3B 2F95B 1TUEB 4JF3A 4TSFG 1BHAA 4O4IA 1SQFA 5LYJB 4IYIA 3ZRWA 2QEXV 2AHYA 1WA8A 1WP7A 2X6CA 3BABA 4PDLA 4GKJO 3E89A 1BGYH 4GKJB 3AK1A 4I50A 1V55B 1NZ6A 2Q67A 4X1KA 3P3PA 4JTDB 1K97A 4UV9A 3A8TA 1AI6A 4O4HA 1LUVA 2A06H 3MHSC 4GZRB 1AR5A 5IJ0B 4DW0A 4DV7O 1PKXA 3A0BZ 4DV7B 3E2EA 4OXSA 3NR7A 3T1CA 2E76B 5EBWC 5FPRA 2WLNA 3G6EV 1DK1A 1B06A 1IZ3A 1K92A 3T1HO 3T1HB 2UXNA 3K9AA 4WFHA 2JGDB 1XOUA 5EZYA 3CXHF 3UO2A 5EIBC 1W0KG 5LHIA 4DR5O 3ZX6A 3G67A 4LF9O 4DR5B 4LF9B 2RJZA 1OCRB 3TCUA 4D6TH 5LOVA 5IT9N 1Q6HA 3F5WC 1VQOV 2CTPA 4MTFA 2NR5A 2ADPA 2P4KA 1IXMA 4WFAV 5LMNO 5LMNB 1XDCA 1ZSPA 1SETA 1JA8A 4AHCA 3N2GA 1L8DA 3CRRA 2UUBO 1GH6A 2UUBB 1P4RA 3LSQA 3W7TA 3J80N 2XAFA 2BSKB 1V55C 3EVKA 2GUZA 3SYOA 4Z1MG 2OWOA 1ZLZA 5JVDB 3CHXA 4WFEA 3CCQV 5B1OA 4WBNA 4MVRA 1Y67A 4J7KA 2CE4A 5K1PA 4C7UA 5L3FA 4DV0O 2V1DA 3BA8A 2XOKG 4DV0B 1PL0A 1TVKB 3E35A 4ZBMA 1WNSA 4ASUG 1GKFA 1N8RW 1UFIA 4O4LA 4J7ZA 4QE9A 4LC1A 1FXKB 5EIBD 4BIOA 3FB5C 3CJHB 1QLNA 2X6AA 1FFTB 1E1QG 2QKAA 1OCRC 3SPGA 3SYCA 2ZNIA 1WJZA 1HNWO 1EN5A 3JD0A 3JALA 5F2VO 1HNWB 2A3QA 2WLKA 2AHZA 5GTHZ 1K3EA 4L8JA 4FM2A 2P4VA 4QPJA 3ICXA 2LP7A 2ETNA 2ZR3A 2QDOA 4YJ3B 2CH7A 1N0NA 4QIWF 5TISZ 3JD4A 2YDEA 3SPHA 1IXBA 1B3QA 1UPGA 4LWSB 5KAFZ 1YHQV 2E5LO 2E5LB 3HKBA 4MTXA 2EX3A 4PJ0Z 2LW1A 5FNVB 4MW3A 3JYCA 4BIZA 4BW5A 1GRJA 4IIJA 4FK5C 3ZRSA 5LXTA 1NT2B 4L87A 3BHPA 3AG3C 1OCOB 4UVCA 2IH3C 4R7CA 2KG7B 3OUFA 4GX0A 4Q20A 2W6IG 1SQGA 2YS8A 4J80A 1FXKC 2ZIMA 4LF4O 3E86A 4GCZA 1I0HA 3OR7C 2JRIA 3LNNA 3CRAA 1YF2A 1B6QA 4YHHO 4DYLA 3RBZA 3AG4B 3AEIA 2QSAA 5K1XA 4YHHB 3L74H 4J42A 3CP1A 3BY6A 2XNDG 4TV9B 3ZN0A 1GMGA 1YCIA 3OEEG 3L75H 4Z1VA 2HG5C 3AG7A 4R8CA 4PDMA 3CCRV 4WFFA 2IJKA 4FLYA 1QVFU 2WLJA 2IJIA 4K0KO 3GB7C 4CZZA 4K0KB 1AI5A 3E8GA 1RSOA 4LF8O 1AP6A 2Q8VA 4LP8A 5EYPB 4LF8B 1RFYA 2DOSA 1VQ4V 2BCCH 3DXRB 3FD9A 4PHZA 1Q82W 2UUCB 1K7DA 1H2KA 3M99B 4U3JB 1R3LC 2HHHO 4DUZO 2HHHB 4DUZB 1PNLA 4P30A 3DSQA 4TQFA 2P5OA 1SF9A 4U7NA 1PL4A 2IH1C 3CMAV 2E74B 5CA0B 4X65O 1QLEC 1FXHA 3HR0A 4X65B 3Q4HB 3RYHB 2P22C 4KUMA 3AG4C 4MTGA 2LFSA 4DV6O 4DV6B 4O2AB 2LW7A 3CC4V 1AR1B 4MS2A 1L1FA 3CCLV 1AP5A 2WLLA 4FZ1A 4GKKO 1XMQB 4GKKB 5KX5B 4DV2O 2ZNJA 4DV2B 1XHXA 3CX5F 2VQFO 3OMNB 2VQFB 2P67A 3SJBC 3RWRD 4NR1A 4ZI7A 2QM7A 1MABG 2Q7HA 4PDVA 3B4SA 2Q7GA 3FAVB 1AJQA 4QPKA 3JAMN 1D2DA 5LOVB 5IWAO 1ZL8A 5IWAB 3OMIB 3E8FA 1Q86W 1Q6UA 3ETEA 3D36C 2QWOB 4UVAA 2BTQB 3G6BA 3TJTA 3K08A 3CC7V 1I94O 2ZE6A 4RUEA 1I94B 1AB3A 1VF6A 1S5JA 1NH2D 4IL6Z 2X0LA 4FFBA 1YDXA 1ROPA 3ETGA 5B1AB 3RYIB 1Y76A 1S3JA 2R9AA 1AI4A 3A0RA 3S3WA 3ZEDA 1GTOA 2CTWA 2OCCB 5GONA 2DYRB 5IYDO 2F93B 2EIJB 1K4DC 2ZE7A 2YIAA 3B77A 2HEPA 4X62O 4X62B 4PELA 2Y0PA 3SPIA 5LP6B 1PM9A 1H2SB 1G8MA 5JQGB 3HKCB 5E1AC 3FB8C 3EXAA 3AK2A 2PUSA 2QA4V 4ABMA 5GW7A 3HKDB 2Y0IA 3ABLB 4ZKIA 4I55A 2BTOA 2Q73A 3ZS8C 3TXQA 5CN0A 2LFRA 4NYKA 2QR4A 1YJ9V 4X20B 1UJWB 4BAYA 1GO3F 2LGQA 2EULA 1R3JC 1R73A 4I7ZB 1JMKC 3ZHSA 1JJ2U 2ZDIA 1QR9A 3VQWA 3T2MA 3ASOB 1QHTA 2Q69A 1IVSA 4LR3A 1XI1A 1FS0G 1Q43A 5B1AC 1DF4A 2N04A 4JI5O 2XUMA 1AVMA 1TUBB 4LH7A 1XNQO 4JI5B 4JAUA 1IBMO 1XNQB 1K34A 3B2EE 2DE0X 1IBMB 5DM6V 3VQYA 1HP8A 2CK3G 2OCCC 4JV5O 4LFBO 3N2KA 3CRMA 3CD6V 4JV5B 2ZIOA 2ZD9A 4LFBB 2DYRC 3U10A 3BVOA 1QQCA 3M8AA 1GN4A 3MHHC 2EIJC 4UV8A 1SQBH 4IHJA 3OR6C 2LQTA 3KZIZ 2EIKC 5LP6C 1V9PA 5GTIZ 3J81N 1VF5B 4TUYB 4MVMA 3K06A 3ABLC 3JD3A 3UO3A 4K8XA 2B5UA 5DEDA 2HVJC 4NTYA 1OJHA 1SZTA 5BXZA 4I9QA 3CSXA 1I5YA 2ZCEA 3RGBA 2WLIB 4K3AA 3ASOC 1AROP 1M56B 5BMVA 5L3GA 2YXLA 3STLC 2YXYA 3LDEA 3G80A 2QE7G 4FPPA 1DGSA 1JPXA 2FMLA 1HNZB 1K8AW 1P7BA 1NU1H 1ZTEA 1CP9A 3C3TA 2P90A 4MVSA 5JCOA 2WSSG 2QWPB 4I9WA 2BOCC 4HYOA 4BIUA 5LGUA 2CDYA 5IE9A 4JI7O 5J2TA 2LO1A 2UU9O 1NTZH 1VEWA 4DRXB 2UU9B 5JJJB 4CC6A 3OE7G 4RO2A 3K5NA 1E79G 2ZT9B 2VS0A 1MSDA 3SYAA 3APOA 1K5SA 1Q90D 3JAWA 4UXNA 1VQ9V 1MA1A 3IJ4A 3E22A 2IU3A 4EKWA 4B3MO 4B3MB 3A0HZ 3JSNA 2A9HA 1NR7A 3OT7A 1M56C 2FL4A 1NTMH 1JFFB 4YJ2B 2RN9A 3RYFB 2KQXA 4W4LA 3W7XA 3JAKA 3VOUA 3JARA 3E8BA 1LUWA 4X1IA 2UUAO 2DQ0A 2WLMA 4EB6B 1XL4A 3QF7A 2UUAB 1NKDA 3ABTA 1EBOA 2EJRA 3GWKC 1QCEA 5JH7B 3CE2A 4X88A 4ZOLA 4GYCB 1KU9A 1WAZA 3E8HA 4OX9O 4OX9B 1SZXA 4DV1O 4J9YB 3HKEA 4DV1B 3O65A 5ITZA 2AZ2A 4KP4A 5IYZB 5FPOA 3P30A 4J11A 3KCYA 3ZMUA 5L3DA 4O4JA 1IDSA 5IJ9B 3ZHUA 3SR2C 1H5WA 4R6ZA 3WFVA 5CB4A 1JX9A 3QO7A 1BSMA 2P7TC 1MZEA 3OMAB 1H38A 3JCZA 5CA1B 1BQ0A 1Z2GA 1DF5A 2OCHA 3L71H 4LNUA 4RQEA 1EM1A 2WPDG 4TV8B 4MVZA 2YEVA 2V4DA 1AR4A 4UCTA 3CCVV 3AG3B 5BY1A 3OFNG 1OCCB 1Y74A 2IJHA 2BOBC 1N36O 4FLWA 1N36B 1XEQA 4O2BB 1EN4A 5KHIA 4DR6O 4Q6GA 1VQPV 4DR6B 5LA6A 1GM9A 3K0GA 1W0JG 1N32O 1N32B 4KXRA 4DV5O 4DV5B 3IC7A 2JJ2G 3F7VC 1M90W 3OGIB 1KP3A 1MOFA 2QKSA 4FFKA 2PY5A 3B8MA 2R72A 1GM8A 2QTSA 3TETA 4I4TB 1VQ5V 2WA3A 1NVPD 2F23A 5LHGA 1OZ0A 2ZE5A 1BHBA 3KCXA 2HKOA 3JASA 3O9OA 1IBLB 4JI6O 2RDCA 1BL8A 4JI6B 4X89A 1OHHG 1YXBA 1THZA 2FYUH 3STZC 3JATB 3QTCA 3I5DA 5DN6G 4AI8A 3QNEA 1PD3A 5C8YB 4OPAA 1JJOA 3FB6C 1L0NH 1OCCC 4JZ2A 4I0XB 2L35A 4HNAB 1ENVA 2KSDA 2XAQA 5BR8O 3KG2A 1NH2B 3H9VA 4ZHQA 5BR8B 1VQKV 4GX1A 3APQA 4J41A 1VQ6V 4LFAO 4JI8O 1XNRO 5BMVB 3DC6A 4LFAB 4JI8B 1XNRB 1FFXA 4FLVA 1QLEB 5EK0A 3AK3A 4TWKA 4X1YA 1G6UA 1GK9A 1GN6A 2O57A 2CTQA 4H13B 4NTXA 2Y48A 3RYCB 4N23A 1SA0B 3U11A 2AZ0A 3K9SA 1KKDA 4QNHB 4LF6B 1JVMA 3UT5A 4F6RA 2M6YA 2UXXA 4WFBV 4LF7O 4LF7B 3C3SA 2DQ3A 4D7TA 4NTWA 2QM4A 2KKWA 1VQLV 1I7FA 3ABKB 1EZJA 4KHPO 4KHPB 2OT5A 2UUCO 4XDJA 4O4IB 1KD1W 3JSLA 1DLBA 1Q81W 4JAAA 1RPOA 1MG1A 3ZRWB 3LNMB 1WA8B 4U3FH 3FFQA 3H1HH 4UCRA 1GM7A 5H6RA 2Z3YA 1SERA 3QG5A 4I50B 4H37A 4X1KB 1NJIW 2ADQB 1JOYA 2C2AA 1AI7A 1GAXA 4O4HB 2Q9LA 3CEIA 1G1XB 1XBLA 2GDSA 4J10A 1FPOA 3QVNA 1XMQO 3SGIA 3VBBA 4J9ZB 2CTRA 3K03A 4JYYA 1IURA 2H94A 1ZX3A 1YJNV 5EZYB 3RW0A 1R6TA 2VQEB 1FKAO 5LYJA 2Q5ZA 2W6JG 5CBFA 4PA6A 4I5SA 3RVZA 2RNBA 3K59A 2QWNB 1VQ7V 2Q7EA 4MVOA 4FZ0A 2N74A 2Q0AA 2B9ZA 4YIOA 3WB1A 4CS2A 1XL6A 3A2FA 5IY5C 3R65A 3ABKC 2ZM6O 3CCEV 2ZM6B 4A5UB 1KMIZ 1BMFG 2HP8A 3CCJV 4XDLA 1N34O 2JGUA 3N2GB 1NI8A 5IJ0A 1PP9H 1N34B 5LHHA 2JEXA 3CC2V 1LR1A 3LSSA 3SYPA 2K9PA 4IGGA 5H5NA 3ZJZA 2ARHA 1F4MA 5EBLC 2GUZB 1NTKH 2ODMA 4DK0A 5L3BA 2E3CA 2QKCA 4UB8Z 5IYBO 3K5MA 5IYCO 4E2LA 2HJDA 4WBNB 1AILA 2PYLA 1NBMG 3ZRXA 2OIGA 3I56V 3W7WA 1WLEA 2YEVB 3ABUA 4DR1O 4DR1B 1BS3A 2Z0AA 4F4LA 5HFMA 4O4LB 4OGQB 2AXTZ 1XILA 1MNGA 2YC0A 2EIKB 1IBKO 3DC5A 4MVQA 1IBKB 1Z5WA 3J7AU 2Y4TA 4FJCC 2OYQA 1YVWA 2H3OA 2WWWA 2ZINA 1WB8A 3JALB 4HAMA 2BSKA 1XMOO 3CRQA 2WLHA 1XMOB 1SC5B 2QTOA 5JVDA 1YTFB 1R3IC 5B3SB 2CH7B 3FYEB 3AG1B 3G71V 1F23A 4UCSA 1QU7A 5L3CA 1TVKA 1HR0O 3RFRA 1HDJA 3HKBB 1HR0B 2JJ1G 4XBFA 1IX9A 3BFRA 5KUMA 4U7OA 2PZSA 1Q6IA 1WPXA 1KYOF 2GV9A 4AILC 1FXKA 4IIJB 3S3XA 1S0VA 3CJHA 2DW4A 3W7UA 3H1IH 5LXTB 1CEZA 5LGNA 1VP7A 2Y69B 1N0JA 1K5QA 3NXSA 3SJQC 3H1KH 4QGPA 2Q68A 1TGOA 4JI4O 2ZE8A 2P6JA 4JI4B 4YJ3A 3X2QB 1YZBA 1B04A 3N27A 3UM7A 3THOA 4LWSA 4KL1A 3FKSG 3IC9A 2DJVA 5JWPA 1VF7A 2JS5A 3D8CA 5KHHA 3P32A 4QE7A 5B3SC 5FNVA 2ZQMA 1PPJH 3MD0A 3BA9A 4GX2A 1V54B 1I08A 1XREA 4UCVA 3AG1C 1ORQC 4K35A 5KMGA 1HNZO 2D2CB 2GSMB 4YXWG 4JPRA 1S5LZ 2Z5UA 3ZIAG 2EINC 2KG7A 4DV3O 4H0LB 4DV3B 1FOUA 4B3RO 1URFA 5EC2C 1RSOB 2A7WA 2JK5C 4B3RB 4J7JA 4CH4A 2ILMA 1T5EA 4JGSA 4DV4O 1O9GA 4DV4B 3T1YO 1H8EG 4JTCB 3T1YB 2QM8A 2Y69C 4GX5A 2NNUA 5J2UA 2A0LA 3F5TA 3D3IA 2L6LA 3LDCA 1L0LH 4RUFA 4TV9A 2LGWA 1VQMV 3AG2C 4FMTA 3X2QC 2AGAA 1IJGA 1SS3A 3CCMV 5DECA 1M93A 3SPCA 4NXNB 4IT5A 4PI0A 4P9OA 5JJNB 2JDIG 4UB6Z 5KHJA 4DUYO 1KECA 4DUYB 1VMGA 4CS3A 1NVPB 1AJPA 4B7EA 1YTFD 2RCVA 1JCHA 3M7MX 1EFRG 1U97A 3CRCA 2WLLB 2W0FC 4FLUA 1Y4MA 1VARA 2ZR2A 1V54C 1Q7YW 1XHZA 1S77D 5EYPA 5JJEB 2PI5A 1CXZB 1SQVH 1F4NA 3K0DA 2NN4A 3DXRA 1H2NA 4ZI7B 3ETDA 4JI2O 5H9CA 4JI2B 4U3JA 5CBGA 2ZXWB 4MW8A 1F51A 1M57C 2PF4E 3D3QA 3ZHTA 1SESA 4D7SA 4FLTA 3K5LA 4JZGA 1ZL8B 1COWG 1YJWV 2F43G 4WCEV 2PI4A 3PJSK 5CA0A 1NR1A 4UCOA 3Q4HA 4IYHA 3RYHA 2DYSB 1D5NA 1OV9A 4O2AA 1FD9A 2H8PC 2Q0OC 4JI0O 3ZRVA 3SJAC 1TA8A 4JI0B 4FFBB 3ZMSA 4E4EA 1PNKA 1Y76B 5KX5A 2G38A 1PV0A 4B7KA 4ZIBA 5H2FZ 2DMXA 2FB5A 1WB7A 1M4UA 5GONB 4YY3O 3OM3B 4YY3B 4OPHA 1DTOA 2B1IA 4FLZA 2QWQB 4BWAA 3FAVA 2YIBA 1LNQA 1SQPH 3EFFK 1X59A 1FAFA 4PA7A 4MTOA 1HWYA 4JYBA 1Y6XA 3TGUH 3WB0A 5B66Z 2BTQA 4GT1A 2IJJA 2YI9A 5KHKA 3BCCH 5CBHA 2YICA 2ZXWC 4I55B 3ZHVA 1MZFA 4JI1O 1A32A 2PTMA 2QGNA 4JI1B 1O9HA 4RAIA 2VWKA 3FX7A 3HB3B 2F1MA 3L9DA 3BPZA 3RYIA 4NKGB 5KUKA 3K04A 5KAIZ 3CXCU 1K9MW 1P49A 3OTOO 5LMUO 2X6BA 3OTOB 2DYSC 5LMUB 1US6A 1SKVA 4UUJC 4EFEA 5H6QA 1VF6C 3H01A 1H2LA 4H44B
chains in the Genus database with same CATH topology
1MMMA 3IC9A 3KKYA 1ZTEA 1BS3A 3C3TA 1AP5A 3MDSA 4JZGA 4X9QA 1GN2A 3EVKA 1XILA 1MNGA 1ZLZA 1XUQA 3DC5A 1I0HA 1I08A 1XREA 2ADQB 2CDYA 1EN6A 1Y67A 1D5NA 2CE4A 1IDSA 1JR9A 4C7UA 1VEWA 3CEIA 3LSUA 4JZ2A 2AW9A 2GDSA 5AG2A 1GN3A 1MSDA 1WB8A 1AVMA 3QVNA 4E4EA 1BSMA 4JYYA 3AK1A 1MA1A 3DC6A 1WB7A 3TJTA 1GN4A 1KKCA 1LUVA 1EM1A 2QKAA 3AK3A 5A9GA 1AR5A 1AR4A 1EN5A 4F6EA 1QNMA 3OT7A 1BT8A 1IX9A 4YIPA 3BFRA 1GN6A 4YIOA 1B06A 1EN4A 1AP6A 3RN4A 1N0NA 1IXBA 3KDRA 3K9SA 1N0JA 1LUWA 4GUNA 2RCVA 4BR6A 2ADPA 1PL4A 1VARA 2P4KA 1ZUQA 3C3SA 1PM9A 2QKCA 4FFKA 1P7GA 1XDCA 1ZSPA 3AK2A 1JA8A 1SZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMM A;  3IC9 A;  3KKY A;  1ZTE A;  1BS3 A;  3C3T A;  1AP5 A;  3MDS A;  4JZG A;  4X9Q A;  1GN2 A;  3EVK A;  1XIL A;  1MNG A;  1ZLZ A;  1XUQ A;  3DC5 A;  1I0H A;  1I08 A;  1XRE A;  2ADQ B;  2CDY A;  1EN6 A;  1Y67 A;  1D5N A;  2CE4 A;  1IDS A;  1JR9 A;  4C7U A;  1VEW A;  3CEI A;  3LSU A;  4JZ2 A;  2AW9 A;  2GDS A;  5AG2 A;  1GN3 A;  1MSD A;  1WB8 A;  1AVM A;  3QVN A;  4E4E A;  1BSM A;  4JYY A;  3AK1 A;  1MA1 A;  3DC6 A;  1WB7 A;  3TJT A;  1GN4 A;  1KKC A;  1LUV A;  1EM1 A;  2QKA A;  3AK3 A;  5A9G A;  1AR5 A;  1AR4 A;  1EN5 A;  4F6E A;  1QNM A;  3OT7 A;  1BT8 A;  1IX9 A;  4YIP A;  3BFR A;  1GN6 A;  4YIO A;  1B06 A;  1EN4 A;  1AP6 A;  3RN4 A;  1N0N A;  1IXB A;  3K9S A;  1N0J A;  1LUW A;  4GUN A;  2RCV A;  4BR6 A;  2ADP A;  1PL4 A;  1VAR A;  2P4K A;  1ZUQ A;  3C3S A;  1PM9 A;  2QKC A;  4FFK A;  1P7G A;  1XDC A;  1ZSP A;  3AK2 A;  1JA8 A;  1SZX A; 
#chains in the Genus database with same CATH topology
 4KFM A;  2EIL B;  2HLD G;  3LUT B;  4MT8 A;  4P2Z A;  2JVD A;  1VIB A;  3L72 H;  4WFG A;  2W0X A;  3RT3 C;  3ZCC A;  5LP6 A;  3OUS A;  5JQG A;  3HKC A;  3N2K B;  4PV1 B;  2XT9 A;  3VQX A;  4CC5 A;  2XAG A;  2BE3 A;  3HKD A;  2XAJ A;  2GHY A;  1XQ8 A;  4TOI A;  2DWD C;  3IFX A;  2VWJ A;  3TK1 A;  3JD1 A;  3E83 A;  3ASN B;  1YIT V;  2AW9 A;  1AJN A;  1GN3 A;  4IHJ B;  1IBL O;  4X20 A;  3H1J H;  4PA4 A;  2JEU A;  1KBH A;  2CAZ C;  3G4S V;  4FLX A;  1NQT A;  1HNX O;  1EZV H;  1G4Y B;  3SDL A;  4CS4 A;  4RWU A;  1HNX B;  2HR3 A;  2ATK C;  3BEH A;  4G27 B;  1VQ8 V;  2HFE C;  1I5X A;  3QO8 A;  1PNM A;  4DO2 A;  2X7R B;  4X64 O;  1TUB A;  4JAV A;  4X64 B;  1HW7 A;  2P06 A;  2OTL V;  5B1N A;  2ZDI C;  2HVK C;  2FTK A;  4Z2W A;  2RMK B;  2EIL C;  1WPB A;  1Q8I A;  3B8N A;  5KMG B;  2QWR B;  1SQQ H;  3R66 A;  2WA4 A;  2UXC O;  5EBM C;  2VRZ A;  2UXC B;  4UVB A;  3BAA A;  4HBN A;  1TAE A;  5CMU A;  4NVP A;  3CME V;  1FYJ A;  2F4V O;  4TUY A;  2F4V B;  1ZAU A;  4LF4 B;  5HFL A;  2CUG A;  3CCU V;  4DR3 O;  1H8H G;  4LCU C;  5J2T B;  2M7W A;  4DR3 B;  3ASN C;  3EHB B;  2ITD C;  1J95 A;  4LF6 O;  4K8Z A;  1YEW A;  1RPR A;  2ITC C;  3GVM A;  3KKY A;  5J2U B;  4PA3 A;  3MDS A;  2E75 B;  4DW1 A;  5J9P C;  1M1K W;  2WLI A;  3JD2 A;  2XAS A;  3JAW B;  2CGO A;  2QJ1 A;  5CA3 A;  5D5P A;  1J5E O;  4DXW A;  3UQ8 A;  4UCU A;  5IY5 B;  1J5E B;  2JIZ G;  3WG7 B;  3RVY A;  2B1G A;  3E22 B;  3B40 A;  3OEH G;  2YUA A;  3LDD A;  1Q3E A;  5IDJ A;  3UKM A;  3P3N A;  4X8A A;  4PA9 A;  5FL7 G;  1U96 A;  3ZMT A;  3CS5 A;  4N21 A;  2V7Q G;  2YSU B;  1D5A A;  1OCO C;  5A2Q N;  4CH3 A;  4DRX A;  1YI2 V;  3JAK B;  3JAR B;  5B1B B;  4EEQ A;  4X1I B;  3ZMZ A;  1QNM A;  4YIP A;  5JCO C;  3ZN1 A;  4RQF A;  1FXV A;  2CGN A;  5KLV H;  1H2G A;  2OTJ V;  1QVG U;  1KQS U;  4ICG A;  4ZOL B;  2EJ7 A;  2IM9 A;  2EZP A;  3U0Z A;  5D5Q A;  2VQE O;  3KDR A;  2K1E A;  4DK1 A;  3HKE B;  2YXH A;  3OTF A;  1S5H C;  4TT3 G;  5ITZ B;  4CH5 A;  1M9N A;  4GUN A;  4BR6 A;  2MW2 B;  4B08 A;  2UXB O;  3OGC C;  4LFC O;  1ZUQ A;  2UXB B;  4LFC B;  1BE3 H;  4JAS A;  1JFF A;  4B3T O;  3IGA C;  5BZB A;  4YJ2 A;  4B3T B;  1KP2 A;  3WG7 C;  3RYF A;  4O4J B;  2JS3 A;  3ZMV A;  3ETQ A;  2R9I A;  2R9R B;  2Q6A A;  4W4K A;  5CB4 B;  4EB6 A;  1X4T A;  2ZKO A;  1R3K C;  4JYA O;  1K73 W;  5JH7 A;  4JYA B;  3ABM B;  2JGD A;  3K5O A;  1EN6 A;  4LNU B;  1W59 A;  1ZWI C;  3K79 A;  1YSC A;  5B1B C;  2F66 C;  4JYC A;  5AG2 A;  3SYQ A;  3HPL C;  1Y74 B;  3BRC A;  2MK3 A;  3CCS V;  5IYZ A;  3JCU Z;  3QO5 A;  3T4D A;  2IW5 A;  4MSW C;  3FB7 C;  1SRY A;  1KUQ A;  4FVM A;  5LL6 Y;  4DR4 O;  3K3W A;  1KKC A;  2Y4U A;  1S76 D;  4DR4 B;  1KB9 F;  2DWE C;  5LGT A;  4PI2 A;  5A9G A;  5IJ9 A;  5LA6 B;  5KHG A;  1R6N A;  2EIM B;  2YI8 A;  5CA1 A;  3CB2 A;  4JI3 O;  1VQN V;  1OCZ B;  4JI3 B;  3RN4 A;  2OIE A;  1RM1 B;  5LBQ A;  5FLX N;  1F7Y A;  3W7S A;  4NB5 A;  4QJF B;  4TV8 A;  1JNB A;  2FKX A;  5EC1 C;  4JTA B;  3JAS B;  1Z5V A;  3L70 H;  2EIN B;  3ABM C;  4O2B A;  3SJC C;  4PDR A;  3DTU B;  3L73 H;  2D3O W;  1P7G A;  2RQ6 A;  1Q5O A;  4PD4 F;  3ZHQ A;  5C93 A;  1MMM A;  4FIP C;  1K4C C;  4DR2 O;  4H33 A;  2UXD O;  4DR2 B;  2UXD B;  4LH6 A;  4AQY O;  2Q4P A;  4NXM O;  1R6K A;  4AQY B;  4TQD A;  4NXM B;  1YIJ V;  4X9Q A;  2PYJ A;  3MAQ A;  3F7Y C;  4ZHQ B;  3ML0 A;  3I55 V;  3PN1 A;  1JQ0 A;  3AG2 B;  4I4T A;  3ZBH A;  1FFX B;  1S72 V;  1JR9 A;  3DGE A;  2XAH A;  2KB1 A;  1BZK A;  3OAA G;  1P84 F;  3LSU A;  2EIM C;  4EFB A;  1W2B U;  4CBC A;  4X1Y B;  3K57 A;  1H2M A;  5KA5 A;  1E1R G;  3ZHR A;  1BCC H;  3IAY A;  2NLJ C;  2GTS A;  1OCZ C;  4BW9 A;  4MVU A;  3VQV A;  1KC8 W;  2XHB A;  3JAT A;  1NS1 A;  1RM1 C;  1QBZ A;  2PGG A;  2WAM A;  5C8Y A;  2YIB D;  1Y66 A;  4CH6 A;  5B5E Z;  5E79 Z;  4LBE C;  4B3S O;  3SPJ A;  4FM1 A;  4I0X A;  3UT5 B;  4F6R B;  4B3S B;  1BQZ A;  4HNA A;  4UFZ A;  4F6E A;  1BT8 A;  1R1B A;  2N05 A;  2YID A;  4LF5 O;  1M5I A;  4G28 B;  4LF5 B;  1M57 B;  3CWB H;  2DN9 A;  2LJ2 A;  4DR7 O;  3TXS A;  3OW2 U;  4DR7 B;  3WU2 Z;  2IBZ H;  2A79 B;  3WB2 A;  1MSW D;  2IU0 A;  4FM0 A;  1WN7 A;  2HJF C;  1SQX H;  2EZO A;  3K58 A;  4G2K A;  1WP8 A;  3CPW U;  2XTA A;  3H1L H;  5KA6 A;  1N33 O;  3T4Z A;  2EBO A;  5L3E A;  1K33 A;  1N33 B;  3RYC A;  1SA0 A;  4NXN O;  3C90 A;  3OD4 A;  4JI7 B;  1N4C A;  2GTA A;  4R50 A;  2R70 A;  4GLX A;  4P9P A;  4HZ3 A;  2GBO A;  3FYI B;  3UCS C;  1FJG O;  1FJG B;  1GN2 A;  4WF9 V;  1XUQ A;  3GWO A;  4X66 O;  4X66 B;  4XDK A;  1CPY A;  1QR8 A;  3CYO A;  3B09 A;  3D36 A;  1RP3 B;  2F95 B;  1TUE B;  4JF3 A;  4TSF G;  1BHA A;  4O4I A;  1SQF A;  5LYJ B;  4IYI A;  3ZRW A;  2QEX V;  2AHY A;  1WA8 A;  1WP7 A;  2X6C A;  3BAB A;  4PDL A;  4GKJ O;  3E89 A;  1BGY H;  4GKJ B;  3AK1 A;  4I50 A;  1V55 B;  1NZ6 A;  2Q67 A;  4X1K A;  3P3P A;  4JTD B;  1K97 A;  4UV9 A;  3A8T A;  1AI6 A;  4O4H A;  1LUV A;  2A06 H;  3MHS C;  4GZR B;  1AR5 A;  5IJ0 B;  4DW0 A;  4DV7 O;  1PKX A;  3A0B Z;  4DV7 B;  3E2E A;  4OXS A;  3NR7 A;  3T1C A;  2E76 B;  5EBW C;  5FPR A;  2WLN A;  3G6E V;  1DK1 A;  1B06 A;  1IZ3 A;  1K92 A;  3T1H O;  3T1H B;  2UXN A;  3K9A A;  4WFH A;  2JGD B;  1XOU A;  5EZY A;  3CXH F;  3UO2 A;  5EIB C;  1W0K G;  5LHI A;  4DR5 O;  3ZX6 A;  3G67 A;  4LF9 O;  4DR5 B;  4LF9 B;  2RJZ A;  1OCR B;  3TCU A;  4D6T H;  5LOV A;  5IT9 N;  1Q6H A;  3F5W C;  1VQO V;  2CTP A;  4MTF A;  2NR5 A;  2ADP A;  2P4K A;  1IXM A;  4WFA V;  5LMN O;  5LMN B;  1XDC A;  1ZSP A;  1SET A;  1JA8 A;  4AHC A;  3N2G A;  1L8D A;  3CRR A;  2UUB O;  1GH6 A;  2UUB B;  1P4R A;  3LSQ A;  3W7T A;  3J80 N;  2XAF A;  2BSK B;  1V55 C;  3EVK A;  2GUZ A;  3SYO A;  4Z1M G;  2OWO A;  1ZLZ A;  5JVD B;  3CHX A;  4WFE A;  3CCQ V;  5B1O A;  4WBN A;  4MVR A;  1Y67 A;  4J7K A;  2CE4 A;  5K1P A;  4C7U A;  5L3F A;  4DV0 O;  2V1D A;  3BA8 A;  2XOK G;  4DV0 B;  1PL0 A;  1TVK B;  3E35 A;  4ZBM A;  1WNS A;  4ASU G;  1GKF A;  1N8R W;  1UFI A;  4O4L A;  4J7Z A;  4QE9 A;  4LC1 A;  1FXK B;  5EIB D;  4BIO A;  3FB5 C;  3CJH B;  1QLN A;  2X6A A;  1FFT B;  1E1Q G;  2QKA A;  1OCR C;  3SPG A;  3SYC A;  2ZNI A;  1WJZ A;  1HNW O;  1EN5 A;  3JD0 A;  3JAL A;  5F2V O;  1HNW B;  2A3Q A;  2WLK A;  2AHZ A;  5GTH Z;  1K3E A;  4L8J A;  4FM2 A;  2P4V A;  4QPJ A;  3ICX A;  2LP7 A;  2ETN A;  2ZR3 A;  2QDO A;  4YJ3 B;  2CH7 A;  1N0N A;  4QIW F;  5TIS Z;  3JD4 A;  2YDE A;  3SPH A;  1IXB A;  1B3Q A;  1UPG A;  4LWS B;  5KAF Z;  1YHQ V;  2E5L O;  2E5L B;  3HKB A;  4MTX A;  2EX3 A;  4PJ0 Z;  2LW1 A;  5FNV B;  4MW3 A;  3JYC A;  4BIZ A;  4BW5 A;  1GRJ A;  4IIJ A;  4FK5 C;  3ZRS A;  5LXT A;  1NT2 B;  4L87 A;  3BHP A;  3AG3 C;  1OCO B;  4UVC A;  2IH3 C;  4R7C A;  2KG7 B;  3OUF A;  4GX0 A;  4Q20 A;  2W6I G;  1SQG A;  2YS8 A;  4J80 A;  1FXK C;  2ZIM A;  4LF4 O;  3E86 A;  4GCZ A;  1I0H A;  3OR7 C;  2JRI A;  3LNN A;  3CRA A;  1YF2 A;  1B6Q A;  4YHH O;  4DYL A;  3RBZ A;  3AG4 B;  3AEI A;  2QSA A;  5K1X A;  4YHH B;  3L74 H;  4J42 A;  3CP1 A;  3BY6 A;  2XND G;  4TV9 B;  3ZN0 A;  1GMG A;  1YCI A;  3OEE G;  3L75 H;  4Z1V A;  2HG5 C;  3AG7 A;  4R8C A;  4PDM A;  3CCR V;  4WFF A;  2IJK A;  4FLY A;  1QVF U;  2WLJ A;  2IJI A;  4K0K O;  3GB7 C;  4CZZ A;  4K0K B;  1AI5 A;  3E8G A;  1RSO A;  4LF8 O;  1AP6 A;  2Q8V A;  4LP8 A;  5EYP B;  4LF8 B;  1RFY A;  2DOS A;  1VQ4 V;  2BCC H;  3DXR B;  3FD9 A;  4PHZ A;  1Q82 W;  2UUC B;  1K7D A;  1H2K A;  3M99 B;  4U3J B;  1R3L C;  2HHH O;  4DUZ O;  2HHH B;  4DUZ B;  1PNL A;  4P30 A;  3DSQ A;  4TQF A;  2P5O A;  1SF9 A;  4U7N A;  1PL4 A;  2IH1 C;  3CMA V;  2E74 B;  5CA0 B;  4X65 O;  1QLE C;  1FXH A;  3HR0 A;  4X65 B;  3Q4H B;  3RYH B;  2P22 C;  4KUM A;  3AG4 C;  4MTG A;  2LFS A;  4DV6 O;  4DV6 B;  4O2A B;  2LW7 A;  3CC4 V;  1AR1 B;  4MS2 A;  1L1F A;  3CCL V;  1AP5 A;  2WLL A;  4FZ1 A;  4GKK O;  1XMQ B;  4GKK B;  5KX5 B;  4DV2 O;  2ZNJ A;  4DV2 B;  1XHX A;  3CX5 F;  2VQF O;  3OMN B;  2VQF B;  2P67 A;  3SJB C;  3RWR D;  4NR1 A;  4ZI7 A;  2QM7 A;  1MAB G;  2Q7H A;  4PDV A;  3B4S A;  2Q7G A;  3FAV B;  1AJQ A;  4QPK A;  3JAM N;  1D2D A;  5LOV B;  5IWA O;  1ZL8 A;  5IWA B;  3OMI B;  3E8F A;  1Q86 W;  1Q6U A;  3ETE A;  3D36 C;  2QWO B;  4UVA A;  2BTQ B;  3G6B A;  3TJT A;  3K08 A;  3CC7 V;  1I94 O;  2ZE6 A;  4RUE A;  1I94 B;  1AB3 A;  1VF6 A;  1S5J A;  1NH2 D;  4IL6 Z;  2X0L A;  4FFB A;  1YDX A;  1ROP A;  3ETG A;  5B1A B;  3RYI B;  1Y76 A;  1S3J A;  2R9A A;  1AI4 A;  3A0R A;  3S3W A;  3ZED A;  1GTO A;  2CTW A;  2OCC B;  5GON A;  2DYR B;  5IYD O;  2F93 B;  2EIJ B;  1K4D C;  2ZE7 A;  2YIA A;  3B77 A;  2HEP A;  4X62 O;  4X62 B;  4PEL A;  2Y0P A;  3SPI A;  5LP6 B;  1PM9 A;  1H2S B;  1G8M A;  5JQG B;  3HKC B;  5E1A C;  3FB8 C;  3EXA A;  3AK2 A;  2PUS A;  2QA4 V;  4ABM A;  5GW7 A;  3HKD B;  2Y0I A;  3ABL B;  4ZKI A;  4I55 A;  2BTO A;  2Q73 A;  3ZS8 C;  3TXQ A;  5CN0 A;  2LFR A;  4NYK A;  2QR4 A;  1YJ9 V;  4X20 B;  1UJW B;  4BAY A;  1GO3 F;  2LGQ A;  2EUL A;  1R3J C;  1R73 A;  4I7Z B;  1JMK C;  3ZHS A;  1JJ2 U;  2ZDI A;  1QR9 A;  3VQW A;  3T2M A;  3ASO B;  1QHT A;  2Q69 A;  1IVS A;  4LR3 A;  1XI1 A;  1FS0 G;  1Q43 A;  5B1A C;  1DF4 A;  2N04 A;  4JI5 O;  2XUM A;  1AVM A;  1TUB B;  4LH7 A;  1XNQ O;  4JI5 B;  4JAU A;  1IBM O;  1XNQ B;  1K34 A;  3B2E E;  2DE0 X;  1IBM B;  5DM6 V;  3VQY A;  1HP8 A;  2CK3 G;  2OCC C;  4JV5 O;  4LFB O;  3N2K A;  3CRM A;  3CD6 V;  4JV5 B;  2ZIO A;  2ZD9 A;  4LFB B;  2DYR C;  3U10 A;  3BVO A;  1QQC A;  3M8A A;  1GN4 A;  3MHH C;  2EIJ C;  4UV8 A;  1SQB H;  4IHJ A;  3OR6 C;  2LQT A;  3KZI Z;  2EIK C;  5LP6 C;  1V9P A;  5GTI Z;  3J81 N;  1VF5 B;  4TUY B;  4MVM A;  3K06 A;  3ABL C;  3JD3 A;  3UO3 A;  4K8X A;  2B5U A;  5DED A;  2HVJ C;  4NTY A;  1OJH A;  1SZT A;  5BXZ A;  4I9Q A;  3CSX A;  1I5Y A;  2ZCE A;  3RGB A;  2WLI B;  4K3A A;  3ASO C;  1ARO P;  1M56 B;  5BMV A;  5L3G A;  2YXL A;  3STL C;  2YXY A;  3LDE A;  3G80 A;  2QE7 G;  4FPP A;  1DGS A;  1JPX A;  2FML A;  1HNZ B;  1K8A W;  1P7B A;  1NU1 H;  1ZTE A;  1CP9 A;  3C3T A;  2P90 A;  4MVS A;  5JCO A;  2WSS G;  2QWP B;  4I9W A;  2BOC C;  4HYO A;  4BIU A;  5LGU A;  2CDY A;  5IE9 A;  4JI7 O;  5J2T A;  2LO1 A;  2UU9 O;  1NTZ H;  1VEW A;  4DRX B;  2UU9 B;  5JJJ B;  4CC6 A;  3OE7 G;  4RO2 A;  3K5N A;  1E79 G;  2ZT9 B;  2VS0 A;  1MSD A;  3SYA A;  3APO A;  1K5S A;  1Q90 D;  3JAW A;  4UXN A;  1VQ9 V;  1MA1 A;  3IJ4 A;  3E22 A;  2IU3 A;  4EKW A;  4B3M O;  4B3M B;  3A0H Z;  3JSN A;  2A9H A;  1NR7 A;  3OT7 A;  1M56 C;  2FL4 A;  1NTM H;  1JFF B;  4YJ2 B;  2RN9 A;  3RYF B;  2KQX A;  4W4L A;  3W7X A;  3JAK A;  3VOU A;  3JAR A;  3E8B A;  1LUW A;  4X1I A;  2UUA O;  2DQ0 A;  2WLM A;  4EB6 B;  1XL4 A;  3QF7 A;  2UUA B;  1NKD A;  3ABT A;  1EBO A;  2EJR A;  3GWK C;  1QCE A;  5JH7 B;  3CE2 A;  4X88 A;  4ZOL A;  4GYC B;  1KU9 A;  1WAZ A;  3E8H A;  4OX9 O;  4OX9 B;  1SZX A;  4DV1 O;  4J9Y B;  3HKE A;  4DV1 B;  3O65 A;  5ITZ A;  2AZ2 A;  4KP4 A;  5IYZ B;  5FPO A;  3P30 A;  4J11 A;  3KCY A;  3ZMU A;  5L3D A;  4O4J A;  1IDS A;  5IJ9 B;  3ZHU A;  3SR2 C;  1H5W A;  4R6Z A;  3WFV A;  5CB4 A;  1JX9 A;  3QO7 A;  1BSM A;  2P7T C;  1MZE A;  3OMA B;  1H38 A;  3JCZ A;  5CA1 B;  1BQ0 A;  1Z2G A;  1DF5 A;  2OCH A;  3L71 H;  4LNU A;  4RQE A;  1EM1 A;  2WPD G;  4TV8 B;  4MVZ A;  2YEV A;  2V4D A;  1AR4 A;  4UCT A;  3CCV V;  3AG3 B;  5BY1 A;  3OFN G;  1OCC B;  1Y74 A;  2IJH A;  2BOB C;  1N36 O;  4FLW A;  1N36 B;  1XEQ A;  4O2B B;  1EN4 A;  5KHI A;  4DR6 O;  4Q6G A;  1VQP V;  4DR6 B;  5LA6 A;  1GM9 A;  3K0G A;  1W0J G;  1N32 O;  1N32 B;  4KXR A;  4DV5 O;  4DV5 B;  3IC7 A;  2JJ2 G;  3F7V C;  1M90 W;  3OGI B;  1KP3 A;  1MOF A;  2QKS A;  4FFK A;  2PY5 A;  3B8M A;  2R72 A;  1GM8 A;  2QTS A;  3TET A;  4I4T B;  1VQ5 V;  2WA3 A;  1NVP D;  2F23 A;  5LHG A;  1OZ0 A;  2ZE5 A;  1BHB A;  3KCX A;  2HKO A;  3JAS A;  3O9O A;  1IBL B;  4JI6 O;  2RDC A;  1BL8 A;  4JI6 B;  4X89 A;  1OHH G;  1YXB A;  1THZ A;  2FYU H;  3STZ C;  3JAT B;  3QTC A;  3I5D A;  5DN6 G;  4AI8 A;  3QNE A;  1PD3 A;  5C8Y B;  4OPA A;  1JJO A;  3FB6 C;  1L0N H;  1OCC C;  4JZ2 A;  4I0X B;  2L35 A;  4HNA B;  1ENV A;  2KSD A;  2XAQ A;  5BR8 O;  3KG2 A;  1NH2 B;  3H9V A;  4ZHQ A;  5BR8 B;  1VQK V;  4GX1 A;  3APQ A;  4J41 A;  1VQ6 V;  4LFA O;  4JI8 O;  1XNR O;  5BMV B;  3DC6 A;  4LFA B;  4JI8 B;  1XNR B;  1FFX A;  4FLV A;  1QLE B;  5EK0 A;  3AK3 A;  4TWK A;  4X1Y A;  1G6U A;  1GK9 A;  1GN6 A;  2O57 A;  2CTQ A;  4H13 B;  4NTX A;  2Y48 A;  3RYC B;  4N23 A;  1SA0 B;  3U11 A;  2AZ0 A;  3K9S A;  1KKD A;  4QNH B;  4LF6 B;  1JVM A;  3UT5 A;  4F6R A;  2M6Y A;  2UXX A;  4WFB V;  4LF7 O;  4LF7 B;  3C3S A;  2DQ3 A;  4D7T A;  4NTW A;  2QM4 A;  2KKW A;  1VQL V;  1I7F A;  3ABK B;  1EZJ A;  4KHP O;  4KHP B;  2OT5 A;  2UUC O;  4XDJ A;  4O4I B;  1KD1 W;  3JSL A;  1DLB A;  1Q81 W;  4JAA A;  1RPO A;  1MG1 A;  3ZRW B;  3LNM B;  1WA8 B;  4U3F H;  3FFQ A;  3H1H H;  4UCR A;  1GM7 A;  5H6R A;  2Z3Y A;  1SER A;  3QG5 A;  4I50 B;  4H37 A;  4X1K B;  1NJI W;  2ADQ B;  1JOY A;  2C2A A;  1AI7 A;  1GAX A;  4O4H B;  2Q9L A;  3CEI A;  1G1X B;  1XBL A;  2GDS A;  4J10 A;  1FPO A;  3QVN A;  1XMQ O;  3SGI A;  3VBB A;  4J9Z B;  2CTR A;  3K03 A;  4JYY A;  1IUR A;  2H94 A;  1ZX3 A;  1YJN V;  5EZY B;  3RW0 A;  1R6T A;  2VQE B;  1FKA O;  5LYJ A;  2Q5Z A;  2W6J G;  5CBF A;  4PA6 A;  4I5S A;  3RVZ A;  2RNB A;  3K59 A;  2QWN B;  1VQ7 V;  2Q7E A;  4MVO A;  4FZ0 A;  2N74 A;  2Q0A A;  2B9Z A;  4YIO A;  3WB1 A;  4CS2 A;  1XL6 A;  3A2F A;  5IY5 C;  3R65 A;  3ABK C;  2ZM6 O;  3CCE V;  2ZM6 B;  4A5U B;  1KMI Z;  1BMF G;  2HP8 A;  3CCJ V;  4XDL A;  1N34 O;  2JGU A;  3N2G B;  1NI8 A;  5IJ0 A;  1PP9 H;  1N34 B;  5LHH A;  2JEX A;  3CC2 V;  1LR1 A;  3LSS A;  3SYP A;  2K9P A;  4IGG A;  5H5N A;  3ZJZ A;  2ARH A;  1F4M A;  5EBL C;  2GUZ B;  1NTK H;  2ODM A;  4DK0 A;  5L3B A;  2E3C A;  2QKC A;  4UB8 Z;  5IYB O;  3K5M A;  5IYC O;  4E2L A;  2HJD A;  4WBN B;  1AIL A;  2PYL A;  1NBM G;  3ZRX A;  2OIG A;  3I56 V;  3W7W A;  1WLE A;  2YEV B;  3ABU A;  4DR1 O;  4DR1 B;  1BS3 A;  2Z0A A;  4F4L A;  5HFM A;  4O4L B;  4OGQ B;  2AXT Z;  1XIL A;  1MNG A;  2YC0 A;  2EIK B;  1IBK O;  3DC5 A;  4MVQ A;  1IBK B;  1Z5W A;  3J7A U;  2Y4T A;  4FJC C;  2OYQ A;  1YVW A;  2H3O A;  2WWW A;  2ZIN A;  1WB8 A;  3JAL B;  4HAM A;  2BSK A;  1XMO O;  3CRQ A;  2WLH A;  1XMO B;  1SC5 B;  2QTO A;  5JVD A;  1YTF B;  1R3I C;  5B3S B;  2CH7 B;  3FYE B;  3AG1 B;  3G71 V;  1F23 A;  4UCS A;  1QU7 A;  5L3C A;  1TVK A;  1HR0 O;  3RFR A;  1HDJ A;  3HKB B;  1HR0 B;  2JJ1 G;  4XBF A;  1IX9 A;  3BFR A;  5KUM A;  4U7O A;  2PZS A;  1Q6I A;  1WPX A;  1KYO F;  2GV9 A;  4AIL C;  1FXK A;  4IIJ B;  3S3X A;  1S0V A;  3CJH A;  2DW4 A;  3W7U A;  3H1I H;  5LXT B;  1CEZ A;  5LGN A;  1VP7 A;  2Y69 B;  1N0J A;  1K5Q A;  3NXS A;  3SJQ C;  3H1K H;  4QGP A;  2Q68 A;  1TGO A;  4JI4 O;  2ZE8 A;  2P6J A;  4JI4 B;  4YJ3 A;  3X2Q B;  1YZB A;  1B04 A;  3N27 A;  3UM7 A;  3THO A;  4LWS A;  4KL1 A;  3FKS G;  3IC9 A;  2DJV A;  5JWP A;  1VF7 A;  2JS5 A;  3D8C A;  5KHH A;  3P32 A;  4QE7 A;  5B3S C;  5FNV A;  2ZQM A;  1PPJ H;  3MD0 A;  3BA9 A;  4GX2 A;  1V54 B;  1I08 A;  1XRE A;  4UCV A;  3AG1 C;  1ORQ C;  4K35 A;  5KMG A;  1HNZ O;  2D2C B;  2GSM B;  4YXW G;  4JPR A;  1S5L Z;  2Z5U A;  3ZIA G;  2EIN C;  2KG7 A;  4DV3 O;  4H0L B;  4DV3 B;  1FOU A;  4B3R O;  1URF A;  5EC2 C;  1RSO B;  2A7W A;  2JK5 C;  4B3R B;  4J7J A;  4CH4 A;  2ILM A;  1T5E A;  4JGS A;  4DV4 O;  1O9G A;  4DV4 B;  3T1Y O;  1H8E G;  4JTC B;  3T1Y B;  2QM8 A;  2Y69 C;  4GX5 A;  2NNU A;  5J2U A;  2A0L A;  3F5T A;  3D3I A;  2L6L A;  3LDC A;  1L0L H;  4RUF A;  4TV9 A;  2LGW A;  1VQM V;  3AG2 C;  4FMT A;  3X2Q C;  2AGA A;  1IJG A;  1SS3 A;  3CCM V;  5DEC A;  1M93 A;  3SPC A;  4NXN B;  4IT5 A;  4PI0 A;  4P9O A;  5JJN B;  2JDI G;  4UB6 Z;  5KHJ A;  4DUY O;  1KEC A;  4DUY B;  1VMG A;  4CS3 A;  1NVP B;  1AJP A;  4B7E A;  1YTF D;  2RCV A;  1JCH A;  3M7M X;  1EFR G;  1U97 A;  3CRC A;  2WLL B;  2W0F C;  4FLU A;  1Y4M A;  1VAR A;  2ZR2 A;  1V54 C;  1Q7Y W;  1XHZ A;  1S77 D;  5EYP A;  5JJE B;  2PI5 A;  1CXZ B;  1SQV H;  1F4N A;  3K0D A;  2NN4 A;  3DXR A;  1H2N A;  4ZI7 B;  3ETD A;  4JI2 O;  5H9C A;  4JI2 B;  4U3J A;  5CBG A;  2ZXW B;  4MW8 A;  1F51 A;  1M57 C;  2PF4 E;  3D3Q A;  3ZHT A;  1SES A;  4D7S A;  4FLT A;  3K5L A;  4JZG A;  1ZL8 B;  1COW G;  1YJW V;  2F43 G;  4WCE V;  2PI4 A;  3PJS K;  5CA0 A;  1NR1 A;  4UCO A;  3Q4H A;  4IYH A;  3RYH A;  2DYS B;  1D5N A;  1OV9 A;  4O2A A;  1FD9 A;  2H8P C;  2Q0O C;  4JI0 O;  3ZRV A;  3SJA C;  1TA8 A;  4JI0 B;  4FFB B;  3ZMS A;  4E4E A;  1PNK A;  1Y76 B;  5KX5 A;  2G38 A;  1PV0 A;  4B7K A;  4ZIB A;  5H2F Z;  2DMX A;  2FB5 A;  1WB7 A;  1M4U A;  5GON B;  4YY3 O;  3OM3 B;  4YY3 B;  4OPH A;  1DTO A;  2B1I A;  4FLZ A;  2QWQ B;  4BWA A;  3FAV A;  2YIB A;  1LNQ A;  1SQP H;  3EFF K;  1X59 A;  1FAF A;  4PA7 A;  4MTO A;  1HWY A;  4JYB A;  1Y6X A;  3TGU H;  3WB0 A;  5B66 Z;  2BTQ A;  4GT1 A;  2IJJ A;  2YI9 A;  5KHK A;  3BCC H;  5CBH A;  2YIC A;  2ZXW C;  4I55 B;  3ZHV A;  1MZF A;  4JI1 O;  1A32 A;  2PTM A;  2QGN A;  4JI1 B;  1O9H A;  4RAI A;  2VWK A;  3FX7 A;  3HB3 B;  2F1M A;  3L9D A;  3BPZ A;  3RYI A;  4NKG B;  5KUK A;  3K04 A;  5KAI Z;  3CXC U;  1K9M W;  1P49 A;  3OTO O;  5LMU O;  2X6B A;  3OTO B;  2DYS C;  5LMU B;  1US6 A;  1SKV A;  4UUJ C;  4EFE A;  5H6Q A;  1VF6 C;  3H01 A;  1H2L A;  4H44 B; 
#chains in the Genus database with same CATH homology
 1MMM A;  3IC9 A;  3KKY A;  1ZTE A;  1BS3 A;  3C3T A;  1AP5 A;  3MDS A;  4JZG A;  4X9Q A;  1GN2 A;  3EVK A;  1XIL A;  1MNG A;  1ZLZ A;  1XUQ A;  3DC5 A;  1I0H A;  1I08 A;  1XRE A;  2ADQ B;  2CDY A;  1EN6 A;  1Y67 A;  1D5N A;  2CE4 A;  1IDS A;  1JR9 A;  4C7U A;  1VEW A;  3CEI A;  3LSU A;  4JZ2 A;  2AW9 A;  2GDS A;  5AG2 A;  1GN3 A;  1MSD A;  1WB8 A;  1AVM A;  3QVN A;  4E4E A;  1BSM A;  4JYY A;  3AK1 A;  1MA1 A;  3DC6 A;  1WB7 A;  3TJT A;  1GN4 A;  1KKC A;  1LUV A;  1EM1 A;  2QKA A;  3AK3 A;  5A9G A;  1AR5 A;  1AR4 A;  1EN5 A;  4F6E A;  1QNM A;  3OT7 A;  1BT8 A;  1IX9 A;  4YIP A;  3BFR A;  1GN6 A;  4YIO A;  1B06 A;  1EN4 A;  1AP6 A;  3RN4 A;  1N0N A;  1IXB A;  3KDR A;  3K9S A;  1N0J A;  1LUW A;  4GUN A;  2RCV A;  4BR6 A;  2ADP A;  1PL4 A;  1VAR A;  2P4K A;  1ZUQ A;  3C3S A;  1PM9 A;  2QKC A;  4FFK A;  1P7G A;  1XDC A;  1ZSP A;  3AK2 A;  1JA8 A;  1SZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...