1VEWA

Manganese superoxide dismutase from escherichia coli
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Crystal structure of Escherichia coli manganese superoxide dismutase at 2.1-angstrom resolution.
pubmed rcsb
molecule tags Oxidoreductase
total genus 75
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1998-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1vewA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1vewA02
1I08A 1XDCA 2CDYA 1BSMA 1JR9A 1KKCA 1MMMA 4YIOA 3DC6A 1GN4A 1AP5A 4GUNA 1AR4A 2QKAA 1MNGA 4JZGA 1WB7A 1XUQA 3K9SA 1SZXA 1IX9A 3LSUA 1XILA 2RCVA 4JYYA 2ADQB 2P4KA 1WB8A 3TJTA 1LUVA 1BT8A 3RN4A 5AG2A 1PL4A 1B06A 1Y67A 1N0NA 3AK1A 1EN6A 1AVMA 3DC5A 1BS3A 1AR5A 3QVNA 2QKCA 1PM9A 3IC9A 1EN5A 1MA1A 3C3SA 1ZLZA 1ZUQA 3KKYA 2CE4A 3CEIA 4YIPA 3EVKA 4JZ2A 1JA8A 3BFRA 1EM1A 1N0JA 2ADPA 4E4EA 1P7GA 2AW9A 1VARA 1ZSPA 3AK3A 1EN4A 3MDSA 4F6EA 5A9GA 4BR6A 1LUWA 3AK2A 4X9QA 1IXBA 4FFKA 1XREA 1MSDA 3OT7A 1VEWA 1ZTEA 1QNMA 4C7UA 1IDSA 1I0HA 1GN6A 1AP6A 1D5NA 1GN2A 3C3TA 2GDSA 1GN3A
chains in the Genus database with same CATH superfamily
3D36A 4WF9V 5B3SB 4Z1MG 4JI4B 3JD3A 2AXTZ 5H6QA 4MVRA 2EBOA 5LBQA 1F51A 4MS2A 2JGDB 2R9RB 2OYQA 5KMGB 1AI7A 1YZBA 3ZMVA 1VQ7V 4I50A 4EFBA 2HG5C 1HNWB 1OCZC 5BMVB 4X66O 2CUGA 4ZIBA 3RYCA 3HPLC 4JI5O 2PYLA 3ZN0A 1Y4MA 1EZJA 3UT5B 2XAGA 3HKDB 1ZAUA 1NJIW 3LSQA 4J11A 4OGQB 5GW7A 1VQ6V 3L74H 4ZI7A 5J2TB 1PL4A 1B06A 4FZ0A 1NR1A 3VQYA 1SQGA 3SJAC 2QEXV 2H94A 2KB1A 4I9WA 1PM9A 3WB1A 4DW1A 3G71V 2L35A 4FLTA 3ABMC 2Y0IA 2WLIA 2LW1A 2CE4A 2X6AA 4EEQA 2JK5C 2ZDIC 2Y0PA 1WJZA 4CH6A 1VARA 4DV2O 1XNRO 1KQSU 4D7SA 1LUWA 4U7NA 4G2KA 4X1YB 1XI1A 4AI8A 1FS0G 4BAYA 1KP3A 1FXKC 4YJ2A 3L73H 5KX5A 4JF3A 2K1EA 3OUSA 1JCHA 1RPOA 2CH7A 2E3CA 4GT1A 3AG1B 3CCEV 4X1KB 5J2UB 5LGTA 4DV1O 1WA8B 4X62B 2LGWA 2Q67A 5IWAO 2CAZC 3CMAV 1S72V 2DW4A 1R3LC 2PZSA 2JDIG 3QG5A 2PI4A 3N27A 4LFAB 4DR7B 5L3BA 4DR1O 2OIGA 2P4KA 1YEWA 4NR1A 3FKSG 1SS3A 4BW5A 4DV0B 1COWG 1S0VA 4GX1A 2QWQB 3WU2Z 3WFVA 2XOKG 1DK1A 1YJNV 3K79A 4DV7O 4B08A 3WB0A 3LSSA 4K0KO 4XBFA 4JI3B 2UUBO 5LHIA 2PF4E 3IC9A 1VQKV 1ZUQA 1UPGA 2DJVA 1E79G 1F4NA 3H01A 4EB6A 4MVOA 3CC4V 4O2BA 5IYDO 3CHXA 2AHZA 4LF6O 3H1JH 5IT9N 4G28B 3HB3B 1VQOV 2XHBA 1GRJA 2E74B 1AJNA 1K7DA 1F4MA 5CA1B 1TVKA 2CK3G 2YXYA 3RYHA 4U3FH 2Y69C 2LFSA 2LO1A 1J5EO 2QM4A 4GKJO 4LH6A 4JYCA 1VEWA 1O9HA 2PTMA 4CBCA 2BSKB 4U3JA 1M57C 3OTFA 2HVKC 3TCUA 1HR0O 4I55B 2K9PA 3AG2B 3CRQA 4X65B 5JQGA 2Q9LA 1CP9A 4QE7A 3CXHF 2IBZH 1GM8A 3DC6A 4B3MO 1PP9H 2P90A 1N36O 3P32A 3L71H 2YSUB 1VIBA 3CCMV 2VWKA 3JSLA 1NBMG 1XHZA 2JVDA 4OX9B 4HNAB 4OPHA 5FNVB 3APQA 5B1OA 1VQLV 3LSUA 3CS5A 4JASA 4LFBB 2IU3A 4J42A 4MVUA 4KP4A 1H8HG 4PELA 1TGOA 3TJTA 2EILB 5KUMA 1R3JC 4JI6B 1SKVA 5AG2A 3ASOB 4LF8B 3DXRB 3JCUZ 4JTAB 5IJ9A 1NTZH 1XL6A 4H0LB 5FL7G 1XMQO 2Z0AA 3ETGA 5B1AC 3T1CA 3CCSV 5KA6A 4MW3A 1XEQA 2DWDC 5EIBD 1N34O 4J7JA 3OM3B 2D3OW 3ABLB 3AG4C 1P4RA 1L0NH 3EHBB 4IT5A 4L87A 1XBLA 4LC1A 1U96A 1EZVH 2Q7GA 1K5QA 1Q6IA 4HZ3A 1V54B 4EB6B 1DF4A 4UVAA 2IJHA 5CA0B 4KFMA 3PJSK 3HKBA 4DV3O 1NH2D 5GONB 1B6QA 1TVKB 4GYCB 2EIKC 3CCRV 2B5UA 4UV9A 3JARA 5J9PC 2XAQA 3NXSA 1OV9A 1SF9A 2AZ0A 5C8YA 4B3SB 1S76D 3OE7G 3T1YO 2OTLV 4U3JB 5KUKA 5JJNB 3BABA 1ENVA 2QJ1A 3QO8A 5JQGB 1FXVA 1VQPV 4GUNA 1Q6UA 2C2AA 5IDJA 3SJQC 3LDEA 1YJ9V 4CH4A 5H9CA 1G4YB 3E89A 4MVSA 2BTQB 1IX9A 4MW8A 3FB7C 1KKDA 4LF9B 3E2EA 2ZIMA 1YITV 1K8AW 1V55C 3E35A 2LFRA 4LR3A 2XT9A 3ZRVA 1FD9A 4LWSA 3OEHG 3CCLV 1OCOB 3RN4A 3QNEA 1N8RW 4IL6Z 3JD4A 5L3DA 2P6JA 4PA3A 3CMEV 3RYFA 3SPHA 3OGCC 2RNBA 2FB5A 3O9OA 1H2LA 3ZMTA 4B3RO 1KYOF 1A32A 1BE3H 2HLDG 3JASA 3ZEDA 4X64B 2UXXA 3OMAB 1MZEA 4DR3O 4YIPA 4UCSA 1WPBA 4TUYA 2Q8VA 3L72H 1D2DA 2A0LA 1KD1W 4KHPB 1JPXA 3NR7A 4MVQA 5EBMC 4HBNA 2UXCO 3ABTA 2YXHA 2YEVA 1IBLB 4K35A 3OMIB 2UUCB 3RT3C 2GV9A 3ZRWB 1HP8A 1KUQA 1L8DA 3WB2A 2IJJA 4DV4O 4PA7A 2JS5A 2DYSC 3JYCA 3FX7A 4B7EA 1GN2A 4FLZA 3I56V 2UXDB 1GN3A 3ZHSA 2V4DA 3JAMN 2NNUA 2DYRB 1KMIZ 4RUEA 3UQ8A 1QR9A 4UCVA 2VQEB 2YI9A 2N05A 1NU1H 3IGAC 3JARB 3UM7A 2UU9B 3EFFK 2QKAA 1YIJV 4PV1B 5KHKA 4LF7O 2Z5UA 4WFGA 1S77D 1AB3A 4J41A 3FYIB 3OTOB 5EYPB 4OXSA 3RYIB 4DO2A 1VQ4V 1H2NA 1AROP 5BMVA 2YI8A 1K34A 1JX9A 2HHHO 3HKEB 1N0NA 4JYAB 2N74A 2IH3C 3HKDA 2CTPA 4DXWA 4LWSB 4DYLA 2XTAA 3N2KA 3ZHTA 1KB9F 2YXLA 2JS3A 4RWUA 2R70A 1H2KA 4O4JB 1I94O 2YC0A 3ZMZA 1G8MA 1YXBA 3ETQA 4NTXA 1M1KW 1W0KG 2Y48A 2XAHA 5CBHA 5LMNB 5L3GA 1RFYA 2ADPA 4QJFB 4R50A 2LJ2A 4D6TH 4P30A 3CWBH 3SYQA 1Q5OA 1TUEB 5E79Z 3FFQA 4IIJA 1MSDA 1N32B 4X1YA 4UCOA 2YEVB 4YHHB 2EIMC 2ZR3A 3ETEA 5IYZB 4PDLA 1D5NA 4DUYB 3ZHUA 2V1DA 3O65A 2WSSG 4Z2WA 4B3TB 1MOFA 1RSOB 2LGQA 2Q5ZA 5JJEB 2VQFO 4X1KA 4YIOA 5K1PA 3GWKC 3CRMA 3OAAG 1GN4A 4DR2B 1BQ0A 2EIJC 1AI6A 1HDJA 4PD4F 2B1IA 1BHAA 1HNWO 3P3NA 2QWPB 3HKCA 4YY3B 3WG7C 1SZXA 1SQBH 1EFRG 2QWNB 2D2CB 3JATA 5H2FZ 4DR6B 2KKWA 1LUVA 2QDOA 1H38A 2QR4A 2HVJC 1QR8A 3A0BZ 2HR3A 3N2GA 4PA4A 2AHYA 1DGSA 2OTJV 1JOYA 1R6NA 5FPRA 1FAFA 1SZTA 3QVNA 5HFMA 1MA1A 1VF5B 3CXCU 5E1AC 3K5MA 4RQFA 1FXKA 5JCOC 2Z3YA 1XMOO 3N2KB 4MVZA 3W7UA 1NH2B 1EM1A 3OR6C 2DMXA 3SPJA 2BOCC 1P7GA 3R65A 3ZRSA 3AK3A 4JTDB 3CPWU 4TV9A 5LP6C 4X9QA 3T1HB 4JV5O 4MTOA 4FK5C 3RWRD 5CA1A 3L75H 3KCYA 4TT3G 3OW2U 2G38A 4FFBB 1GM7A 2DQ3A 1I0HA 1PPJH 2CTQA 4GCZA 4I5SA 4ABMA 1NKDA 2XUMA 4JI8B 2UXBB 2BSKA 3TK1A 4IIJB 3CCUV 1GMGA 4X62O 5KHHA 4I55A 1JVMA 1NVPD 2CDYA 3LDCA 1BSMA 3T2MA 2WLNA 3CRCA 2WWWA 2ZE6A 2WA3A 3ASNC 1M4UA 4WBNB 1OCZB 5HFLA 4LFAO 3M99B 1WB7A 2EJRA 4IGGA 3SJCC 1DLBA 3VOUA 3JCZA 3UO3A 4L8JA 4EFEA 1IBKB 3BPZA 3CYOA 4U7OA 4HNAA 4DV0O 3TXQA 5FNVA 1YTFD 3HKCB 4PHZA 3MAQA 2RJZA 5EZYA 4UCUA 2B1GA 1Y74B 3JATB 2MW2B 4JI3O 4J7ZA 2LQTA 1SESA 3SJBC 3ABMB 3DXRA 5EBLC 2ZE8A 3AG3C 1JMKC 3CJHB 3N2GB 1IBMO 1M90W 1N33B 1KP2A 3CRAA 4BIZA 3FB8C 1N0JA 1B3QA 2CGNA 2GTAA 4RAIA 4DW0A 4CS4A 3J80N 1EN4A 1I5YA 4TSFG 3EXAA 1FXKB 2HJDA 5EK0A 4F4LA 1KC8W 2ZXWC 4DK1A 4R8CA 4FM0A 3H1KH 4N23A 2A79B 3K9AA 5B5EZ 1QNMA 1NS1A 2ZE5A 4X65O 2KG7A 1MABG 3LNNA 4TV9B 5CA0A 3ZN1A 4FLVA 4FM2A 5GONA 4CC6A 3G6EV 1FFXB 4FLYA 3K59A 1AP5A 4X20B 4JI0O 3FB6C 4Q20A 1CEZA 3F7YC 1KU9A 4OX9O 5KLVH 5B1BC 2Q73A 3K0DA 1P7BA 3CCJV 4QIWF 4DV7B 4I7ZB 5KHIA 5BXZA 2RCVA 3AG3B 2ZQMA 4I0XB 4LFBO 4HAMA 3FD9A 3CX5F 4K0KB 2P5OA 2FTKA 3KZIZ 3OUFA 2M6YA 5GTIZ 1BQZA 2Q7EA 4JI6O 2BTQA 5K1XA 3TXSA 4LF8O 2DOSA 4LFCO 4JYBA 1YDXA 4LH7A 3BCCH 3B40A 3S3WA 2ZR2A 4LF6B 1AVMA 5KA5A 2W0XA 3S3XA 1IZ3A 3TGUH 5EZYB 3ZRXA 2WLHA 3A8TA 3BA9A 4NXNB 2R72A 4ICGA 5LL6Y 1R3IC 4I4TB 3T4ZA 2PUSA 1S5LZ 2Y69B 1VQ5V 2JEXA 4YJ3B 1OHHG 1VQMV 3K5OA 1Q8IA 2BE3A 1HNZB 1H5WA 1SQFA 2JRIA 3LNMB 3LUTB 5DEDA 2ILMA 1OCCC 1M57B 5B1BB 1HNXB 1N36B 3OT7A 3ICXA 3FYEB 4J10A 4MTGA 3KG2A 2HJFC 2F4VO 4C7UA 2X6BA 4TQDA 4IYHA 3ZRWA 1FYJA 4B3SO 2X0LA 2ZE7A 4KXRA 4EKWA 3ZHQA 4DR4B 4WCEV 1DTOA 4WFEA 4G27B 2KG7B 4RUFA 1VF7A 1M5IA 5IJ0B 1X4TA 1QVGU 4CC5A 2FMLA 1R1BA 5JVDA 3ML0A 3SYCA 1IURA 2OCCC 1W0JG 3D3IA 2ETNA 3K57A 2E76B 2ADQB 1EBOA 2EINC 1Y6XA 3AG7A 4XDJA 1XNQO 3MHHC 1WLEA 1BT8A 2N04A 1N34B 5EYPA 2PGGA 5A2QN 4P9OA 3RYIA 2Q6AA 2XNDG 1HWYA 4AQYB 3TETA 4FZ1A 5B1AB 3G67A 2HP8A 3HKEA 4LCUC 4IYIA 4DR5O 2E5LB 1S3JA 3AG4B 1EN5A 1SA0B 4X64O 3SPIA 3CCQV 4TQFA 1FFTB 4KHPO 4O4JA 4DV6B 1M9NA 1YVWA 4GX5A 2PYJA 4LF4B 2YIAA 2IJKA 1IBLO 3MDSA 1OCRC 2UUCO 3OMNB 2R9AA 3T1YB 4FFKA 1VF6C 2EIKB 4MVMA 1D5AA 3JD1A 3G6BA 4NB5A 1FJGB 4X1IB 1IVSA 4JI7O 3BEHA 3MD0A 2P67A 4JAVA 1VMGA 2IM9A 4J9YB 3IJ4A 2YIDA 1YSCA 2F93B 4RQEA 3F5WC 2WA4A 2VQEO 2ZINA 3CC2V 5IYZA 3CC7V 1LNQA 2P7TC 3W7WA 4WFAV 4FJCC 4DV5B 3RGBA 2QE7G 4ZOLB 3T4DA 1RSOA 3E8BA 3H1LH 4TV8A 3GWOA 5LGNA 2EZOA 2UUAB 3KCXA 1V55B 1IJGA 1N4CA 3OTOO 3A2FA 1WP7A 1PKXA 2FYUH 2ZM6O 5JH7B 2YDEA 5LYJA 2XAJA 1GAXA 3J81N 1Y76A 5JVDB 1XL4A 3SPGA 4FIPC 3THOA 1GK9A 4UCRA 4JYAO 4DR3B 4CS3A 4PI2A 1BHBA 1Q90D 2F1MA 3X2QC 1AR5A 2VWJA 4KUMA 5BR8O 1PD3A 1QBZA 4ZHQA 4LF5B 3FAVB 5LMNO 1OJHA 1JA8A 3BFRA 3F7VC 1Q81W 3CSXA 3B77A 1ZSPA 4NTYA 2CTWA 2NLJC 1VQ8V 3ZCCA 2H3OA 1THZA 1N32O 2Q69A 2OIEA 2GBOA 3STLC 2OCHA 1NTKH 1RP3B 2DYSB 4YHHO 3KDRA 4UVCA 2P4VA 3B8MA 4Z1VA 5L3CA 4FFBA 2A06H 2UXNA 1QLEC 4NTWA 1W59A 4I9QA 4JI1B 3CCVV 2JIZG 3J7AU 2AGAA 1SQXH 1J95A 4O4LB 4O4HB 1AJPA 1PL0A 1WNSA 3X2QB 4UFZA 5H5NA 5DECA 1VP7A 4BW9A 2GTSA 2NR5A 4WBNA 4FVMA 4D7TA 4JI4O 4DR6O 4TV8B 2ZIOA 1HW7A 1YF2A 2VS0A 1ROPA 3ZS8C 4UCTA 5LMUB 1R73A 1JNBA 1WP8A 5JCOA 1XQ8A 3AK1A 5LYJB 4JI2B 1Z2GA 1JFFB 2BCCH 4XDLA 1Y76B 4FM1A 4NXMB 1Y74A 3STZC 5LP6A 3D8CA 1UJWB 4UUJC 2IJIA 4UVBA 4DRXB 1QQCA 2FKXA 1TAEA 4QE9A 3EVKA 3JALB 4K8ZA 1JQ0A 1Q7YW 2Q68A 3CJHA 2P06A 2LP7A 4O2AA 2ZDIA 3BAAA 1RM1C 2AW9A 4ZHQB 1AJQA 3T1HO 3UCSC 5A9GA 4F6RA 1K73W 5EC2C 1NZ6A 2HEPA 3B09A 2VQFB 1B04A 4DUZB 2IW5A 3W7TA 2EIMB 2ZNJA 5CB4B 2GHYA 4DK0A 3M7MX 1X59A 2F23A 4JI8O 3MHSC 2UXBO 1ORQC 5KHJA 4A5UB 3AG1C 4GKKB 5H6RA 4ASUG 1FOUA 2KQXA 2GSMB 4FLXA 4UV8A 4ZKIA 4JPRA 3H1IH 1JR9A 2EIJB 2KSDA 5IY5C 1K97A 3VBBA 1FFXA 3WG7B 2CGOA 3DTUB 1IBKO 3L9DA 4X20A 3D36C 1XILA 2QKSA 1IXMA 4X66B 4JI5B 1YI2V 3IC7A 1M93A 4CS2A 1GM9A 3ABKC 1XOUA 4I0XA 4WFHA 1RM1B 5LOVA 4PDVA 5B1NA 1Y67A 3RBZA 2QM7A 1XMOB 1K3EA 2AZ2A 4W4LA 3SYAA 4BIOA 5IYBO 5JJJB 1WAZA 4DR7O 2DWEC 1BS3A 3AEIA 4R7CA 3ZIAG 4MSWC 1K9MW 1AI5A 2QKCA 3K0GA 1K4DC 1Q86W 4JV5B 1AR1B 1ZLZA 4H37A 1N33O 2F66C 4GZRB 3HR0A 1FPOA 3P30A 3QF7A 1WN7A 5LP6B 4FLWA 5CBGA 4UB8Z 2W0FC 5IY5B 4I4TA 4NVPA 4DV2B 1XNRB 4P2ZA 1Z5VA 1R6KA 5C93A 1XREA 4XDKA 2IU0A 4YJ3A 3E83A 4O2AB 1QLNA 2WLLA 2W6IG 4AHCA 5D5QA 2X6CA 3U10A 2JJ1G 5IYCO 1SQPH 5IE9A 3CE2A 4F6RB 4NKGB 1K92A 3C3TA 1QVFU 3AG2C 1WPXA 1I08A 3ABKB 3QO5A 4MTFA 1GKFA 3ASNB 2WLKA 4DV1B 4I50B 5GTHZ 5LHHA 4FMTA 3LDDA 4PJ0Z 3RYCB 4PDMA 5IWAB 1MNGA 2JGUA 2QWOB 4O4IA 4K8XA 2DE0X 5KAFZ 1S5JA 5IJ0A 2OT5A 2R9IA 2Q0AA 3SR2C 2QM8A 4JYYA 2WPDG 3CRRA 2ITCC 2P22C 4ZI7B 4GLXA 1MSWD 2QTSA 4CH3A 5D5PA 3K5NA 4DR1B 3ZJZA 1IBMB 2LW7A 2YIBD 3K04A 3G4SV 1CXZB 4LNUA 4WFFA 5LXTA 2EILC 2DQ0A 2WAMA 2ZD9A 2L6LA 3ASOC 4TOIA 5BZBA 3SYPA 2WLIB 3CD6V 3GVMA 3BHPA 5LOVB 3E8FA 4X88A 2UUBB 3E22A 4NXNO 3ZBHA 3ZMUA 4GX0A 3JAWA 3JD2A 3CEIA 2EJ7A 3ABLC 1Q43A 1SA0A 2A7WA 2Q4PA 3JAKA 1GH6A 1HNZO 1DF5A 2ZXWB 4YJ2B 3ZHRA 5KX5B 2EX3A 5KAIZ 4F6EA 3P3PA 4BR6A 2DN9A 2CH7B 1HNXO 1MZFA 1V54C 1R6TA 2YS8A 3GB7C 1J5EB 2RDCA 4GKJB 4J9ZB 2GUZA 1SC5B 2JJ2G 2HFEC 3OD4A 1Q6HA 3W7XA 1K5SA 4JI0B 4QNHB 4MT8A 2WLMA 1ZWIC 2Q0OC 3ZX6A 4ZBMA 1AP6A 1HR0B 4TWKA 5EBWC 4DR4O 4WFBV 1E1QG 3SPCA 1SERA 2OWOA 1K33A 2RN9A 4X1IA 2QSAA 2WLLB 4CZZA 1F23A 1NTMH 3RVZA 2IH1C 1MMMA 2X7RB 1H2MA 3K58A 4CH5A 5ITZA 4B3MB 1QU7A 4H44B 4JTCB 1LR1A 1AR4A 4LFCB 4JZGA 3K9SA 2ITDC 4ZOLA 4QPJA 5FLXN 3B4SA 3H1HH 3ETDA 5BY1A 3A0RA 3FB5C 4RO2A 1Q82W 4Q6GA 1Y66A 4O4IB 5L3EA 1S5HC 4PA9A 3E8GA 5EC1C 5B66Z 4AQYO 5JH7A 2F43G 1OCOC 3L70H 4JGSA 1EN6A 2ZKOA 3BVOA 2VRZA 2E5LO 4LF9O 1AILA 3C90A 1SQVH 5LGUA 1H2GA 3JD0A 2V7QG 4O2BB 1XMQB 1VQNV 2QWRB 2A9HA 3C3SA 4LNUB 5LXTB 4YXWG 1F7YA 1ZL8A 4DV6O 1VQ9V 1VF6A 2JEUA 1SETA 1PNLA 3OFNG 5LHGA 3U0ZA 3RYHB 1MG1A 3QTCA 4LF4O 1TUBA 2ZCEA 2F4VB 3JSNA 3RVYA 1ZX3A 1KECA 3E22B 5JWPA 3CP1A 3FAVA 3BY6A 1H2SB 1OCCB 1NQTA 2W6JG 3K03A 3JAWB 3AK2A 1E1RG 3ZMSA 4J80A 3APOA 1XHXA 2PI5A 3JAKB 1FJGO 1H8EG 1JJOA 3QO7A 4HYOA 4DV3B 1IDSA 5DM6V 5TISZ 3K08A 4FPPA 1L0LH 2QGNA 1YJWV 4PA6A 4E2LA 2GUZB 4X89A 1KBHA 2YIBA 1SRYA 1KKCA 4FLUA 4DV5O 4R6ZA 2DYRC 2EZPA 1V9PA 1NVPB 1O9GA 1U97A 1XNQB 3OEEG 5FPOA 2UUAO 3ZHVA 1FXHA 2XAFA 4IHJA 2OCCB 4UB6Z 1P49A 1PV0A 2UXDO 3BRCA 3RFRA 1BZKA 1CPYA 2EINB 3B2EE 4O4LA 4O4HA 3M8AA 5ITZB 2BOBC 4NYKA 4DR5B 1OZ0A 2UU9O 1G1XB 5IJ9B 1Z5WA 1TA8A 3I55V 1BGYH 4GX2A 1G6UA 2ARHA 1YTFB 1UFIA 5DN6G 4JAAA 1I5XA 3I5DA 4KL1A 4PI0A 2Q7HA 2ZNIA 5F2VO 3SYOA 2H8PC 2EULA 3E8HA 3K5LA 4LF5O 3W7SA 1JFFA 4UXNA 3Q4HA 4B3RB 1YCIA 1US6A 2E75B 2XASA 3ABUA 2CTRA 4W4KA 5LA6A 1OCRB 4E4EA 4JI7B 1GO3F 2WLJA 4DRXA 3RW0A 3HKBB 4BWAA 2Y4TA 2NN4A 3JALA 2UXCB 1T5EA 1ZL8B 2HKOA 4AILC 4N21A 1IXBA 3H9VA 4P9PA 1TUBB 1QHTA 3PN1A 2MK3A 3R66A 4BIUA 5C8YB 2B9ZA 1URFA 3SDLA 1GN6A 5CMUA 4DV4B 1BCCH 3IFXA 2JGDA 3K3WA 3OR7C 4JAUA 5KMGA 5CB4A 3UO2A 1NR7A 3IAYA 1XDCA 2Y4UA 4JI1O 4QPKA 2ZM6B 3F5TA 3G80A 1GTOA 2YICA 3UT5A 3E86A 2A3QA 4DUYO 1YHQV 1XUQA 4X8AA 3D3QA 3VQXA 4B3TO 4LF7B 5J2TA 1RPRA 2QA4V 2M7WA 5L3FA 4DR2O 4QGPA 4IHJB 1M56C 1WB8A 5BR8B 1R3KC 2ATKC 5LMUO 5B3SC 4MTXA 3K06A 1NI8A 1SQQH 3RYFB 1BMFG 4OPAA 2HHHB 1I7FA 4JI2O 5CN0A 2ODMA 4YY3O 3B8NA 4H33A 5EIBC 1NT2B 3DC5A 5CA3A 3JASB 4NXMO 1QCEA 1PNMA 1W2BU 2ZT9B 3U11A 4TUYB 1FKAO 3DGEA 1JJ2U 1I94B 3BA8A 3KKYA 5CBFA 3A0HZ 1L1FA 4JZ2A 2F95B 2FL4A 2PY5A 4LBEC 2O57A 3OGIB 3Q4HB 4B7KA 3DSQA 5KHGA 1BL8A 4DUZO 1P84F 5LA6B 4H13B 4K3AA 3VQWA 2RMKB 3UKMA 1AI4A 4PDRA 5J2UA 1ZTEA 2RQ6A 1PNKA 1WA8A 2QTOA 2BTOA 3CB2A 3SGIA 4GKKO 1K4CC 4LP8A 3VQVA 2GDSA 4J7KA 1Q3EA 2YUAA 1M56B 1QLEB
chains in the Genus database with same CATH topology
1I08A 1XDCA 2CDYA 1BSMA 1JR9A 1KKCA 1MMMA 4YIOA 3DC6A 1GN4A 1AP5A 4GUNA 1AR4A 2QKAA 1MNGA 4JZGA 1WB7A 1XUQA 3K9SA 1SZXA 1IX9A 3LSUA 1XILA 2RCVA 4JYYA 2ADQB 2P4KA 1WB8A 3TJTA 1LUVA 1BT8A 3RN4A 5AG2A 1PL4A 1B06A 1Y67A 1N0NA 3AK1A 1EN6A 1AVMA 3DC5A 1BS3A 1AR5A 3QVNA 2QKCA 1PM9A 3IC9A 1EN5A 1MA1A 3C3SA 1ZLZA 1ZUQA 3KKYA 2CE4A 3CEIA 4YIPA 3EVKA 4JZ2A 1JA8A 3BFRA 1EM1A 1N0JA 2ADPA 4E4EA 1P7GA 2AW9A 1VARA 1ZSPA 3AK3A 1EN4A 3MDSA 4F6EA 5A9GA 4BR6A 1LUWA 3AK2A 4X9QA 1IXBA 4FFKA 1XREA 1MSDA 3OT7A 1VEWA 1ZTEA 3KDRA 1QNMA 4C7UA 1IDSA 1I0HA 1GN6A 1AP6A 1D5NA 1GN2A 3C3TA 2GDSA 1GN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I08 A;  1XDC A;  2CDY A;  1BSM A;  1JR9 A;  1KKC A;  1MMM A;  4YIO A;  3DC6 A;  1GN4 A;  1AP5 A;  4GUN A;  1AR4 A;  2QKA A;  1MNG A;  4JZG A;  1WB7 A;  1XUQ A;  3K9S A;  1SZX A;  1IX9 A;  3LSU A;  1XIL A;  2RCV A;  4JYY A;  2ADQ B;  2P4K A;  1WB8 A;  3TJT A;  1LUV A;  1BT8 A;  3RN4 A;  5AG2 A;  1PL4 A;  1B06 A;  1Y67 A;  1N0N A;  3AK1 A;  1EN6 A;  1AVM A;  3DC5 A;  1BS3 A;  1AR5 A;  3QVN A;  2QKC A;  1PM9 A;  3IC9 A;  1EN5 A;  1MA1 A;  3C3S A;  1ZLZ A;  1ZUQ A;  3KKY A;  2CE4 A;  3CEI A;  4YIP A;  3EVK A;  4JZ2 A;  1JA8 A;  3BFR A;  1EM1 A;  1N0J A;  2ADP A;  4E4E A;  1P7G A;  2AW9 A;  1VAR A;  1ZSP A;  3AK3 A;  1EN4 A;  3MDS A;  4F6E A;  5A9G A;  4BR6 A;  1LUW A;  3AK2 A;  4X9Q A;  1IXB A;  4FFK A;  1XRE A;  1MSD A;  3OT7 A;  1VEW A;  1ZTE A;  1QNM A;  4C7U A;  1IDS A;  1I0H A;  1GN6 A;  1AP6 A;  1D5N A;  1GN2 A;  3C3T A;  2GDS A;  1GN3 A; 
#chains in the Genus database with same CATH topology
 3D36 A;  4WF9 V;  5B3S B;  4Z1M G;  4JI4 B;  3JD3 A;  2AXT Z;  5H6Q A;  4MVR A;  2EBO A;  5LBQ A;  1F51 A;  4MS2 A;  2JGD B;  2R9R B;  2OYQ A;  5KMG B;  1AI7 A;  1YZB A;  3ZMV A;  1VQ7 V;  4I50 A;  4EFB A;  2HG5 C;  1HNW B;  1OCZ C;  5BMV B;  4X66 O;  2CUG A;  4ZIB A;  3RYC A;  3HPL C;  4JI5 O;  2PYL A;  3ZN0 A;  1Y4M A;  1EZJ A;  3UT5 B;  2XAG A;  3HKD B;  1ZAU A;  1NJI W;  3LSQ A;  4J11 A;  4OGQ B;  5GW7 A;  1VQ6 V;  3L74 H;  4ZI7 A;  5J2T B;  1PL4 A;  1B06 A;  4FZ0 A;  1NR1 A;  3VQY A;  1SQG A;  3SJA C;  2QEX V;  2H94 A;  2KB1 A;  4I9W A;  1PM9 A;  3WB1 A;  4DW1 A;  3G71 V;  2L35 A;  4FLT A;  3ABM C;  2Y0I A;  2WLI A;  2LW1 A;  2CE4 A;  2X6A A;  4EEQ A;  2JK5 C;  2ZDI C;  2Y0P A;  1WJZ A;  4CH6 A;  1VAR A;  4DV2 O;  1XNR O;  1KQS U;  4D7S A;  1LUW A;  4U7N A;  4G2K A;  4X1Y B;  1XI1 A;  4AI8 A;  1FS0 G;  4BAY A;  1KP3 A;  1FXK C;  4YJ2 A;  3L73 H;  5KX5 A;  4JF3 A;  2K1E A;  3OUS A;  1JCH A;  1RPO A;  2CH7 A;  2E3C A;  4GT1 A;  3AG1 B;  3CCE V;  4X1K B;  5J2U B;  5LGT A;  4DV1 O;  1WA8 B;  4X62 B;  2LGW A;  2Q67 A;  5IWA O;  2CAZ C;  3CMA V;  1S72 V;  2DW4 A;  1R3L C;  2PZS A;  2JDI G;  3QG5 A;  2PI4 A;  3N27 A;  4LFA B;  4DR7 B;  5L3B A;  4DR1 O;  2OIG A;  2P4K A;  1YEW A;  4NR1 A;  3FKS G;  1SS3 A;  4BW5 A;  4DV0 B;  1COW G;  1S0V A;  4GX1 A;  2QWQ B;  3WU2 Z;  3WFV A;  2XOK G;  1DK1 A;  1YJN V;  3K79 A;  4DV7 O;  4B08 A;  3WB0 A;  3LSS A;  4K0K O;  4XBF A;  4JI3 B;  2UUB O;  5LHI A;  2PF4 E;  3IC9 A;  1VQK V;  1ZUQ A;  1UPG A;  2DJV A;  1E79 G;  1F4N A;  3H01 A;  4EB6 A;  4MVO A;  3CC4 V;  4O2B A;  5IYD O;  3CHX A;  2AHZ A;  4LF6 O;  3H1J H;  5IT9 N;  4G28 B;  3HB3 B;  1VQO V;  2XHB A;  1GRJ A;  2E74 B;  1AJN A;  1K7D A;  1F4M A;  5CA1 B;  1TVK A;  2CK3 G;  2YXY A;  3RYH A;  4U3F H;  2Y69 C;  2LFS A;  2LO1 A;  1J5E O;  2QM4 A;  4GKJ O;  4LH6 A;  4JYC A;  1VEW A;  1O9H A;  2PTM A;  4CBC A;  2BSK B;  4U3J A;  1M57 C;  3OTF A;  2HVK C;  3TCU A;  1HR0 O;  4I55 B;  2K9P A;  3AG2 B;  3CRQ A;  4X65 B;  5JQG A;  2Q9L A;  1CP9 A;  4QE7 A;  3CXH F;  2IBZ H;  1GM8 A;  3DC6 A;  4B3M O;  1PP9 H;  2P90 A;  1N36 O;  3P32 A;  3L71 H;  2YSU B;  1VIB A;  3CCM V;  2VWK A;  3JSL A;  1NBM G;  1XHZ A;  2JVD A;  4OX9 B;  4HNA B;  4OPH A;  5FNV B;  3APQ A;  5B1O A;  1VQL V;  3LSU A;  3CS5 A;  4JAS A;  4LFB B;  2IU3 A;  4J42 A;  4MVU A;  4KP4 A;  1H8H G;  4PEL A;  1TGO A;  3TJT A;  2EIL B;  5KUM A;  1R3J C;  4JI6 B;  1SKV A;  5AG2 A;  3ASO B;  4LF8 B;  3DXR B;  3JCU Z;  4JTA B;  5IJ9 A;  1NTZ H;  1XL6 A;  4H0L B;  5FL7 G;  1XMQ O;  2Z0A A;  3ETG A;  5B1A C;  3T1C A;  3CCS V;  5KA6 A;  4MW3 A;  1XEQ A;  2DWD C;  5EIB D;  1N34 O;  4J7J A;  3OM3 B;  2D3O W;  3ABL B;  3AG4 C;  1P4R A;  1L0N H;  3EHB B;  4IT5 A;  4L87 A;  1XBL A;  4LC1 A;  1U96 A;  1EZV H;  2Q7G A;  1K5Q A;  1Q6I A;  4HZ3 A;  1V54 B;  4EB6 B;  1DF4 A;  4UVA A;  2IJH A;  5CA0 B;  4KFM A;  3PJS K;  3HKB A;  4DV3 O;  1NH2 D;  5GON B;  1B6Q A;  1TVK B;  4GYC B;  2EIK C;  3CCR V;  2B5U A;  4UV9 A;  3JAR A;  5J9P C;  2XAQ A;  3NXS A;  1OV9 A;  1SF9 A;  2AZ0 A;  5C8Y A;  4B3S B;  1S76 D;  3OE7 G;  3T1Y O;  2OTL V;  4U3J B;  5KUK A;  5JJN B;  3BAB A;  1ENV A;  2QJ1 A;  3QO8 A;  5JQG B;  1FXV A;  1VQP V;  4GUN A;  1Q6U A;  2C2A A;  5IDJ A;  3SJQ C;  3LDE A;  1YJ9 V;  4CH4 A;  5H9C A;  1G4Y B;  3E89 A;  4MVS A;  2BTQ B;  1IX9 A;  4MW8 A;  3FB7 C;  1KKD A;  4LF9 B;  3E2E A;  2ZIM A;  1YIT V;  1K8A W;  1V55 C;  3E35 A;  2LFR A;  4LR3 A;  2XT9 A;  3ZRV A;  1FD9 A;  4LWS A;  3OEH G;  3CCL V;  1OCO B;  3RN4 A;  3QNE A;  1N8R W;  4IL6 Z;  3JD4 A;  5L3D A;  2P6J A;  4PA3 A;  3CME V;  3RYF A;  3SPH A;  3OGC C;  2RNB A;  2FB5 A;  3O9O A;  1H2L A;  3ZMT A;  4B3R O;  1KYO F;  1A32 A;  1BE3 H;  2HLD G;  3JAS A;  3ZED A;  4X64 B;  2UXX A;  3OMA B;  1MZE A;  4DR3 O;  4YIP A;  4UCS A;  1WPB A;  4TUY A;  2Q8V A;  3L72 H;  1D2D A;  2A0L A;  1KD1 W;  4KHP B;  1JPX A;  3NR7 A;  4MVQ A;  5EBM C;  4HBN A;  2UXC O;  3ABT A;  2YXH A;  2YEV A;  1IBL B;  4K35 A;  3OMI B;  2UUC B;  3RT3 C;  2GV9 A;  3ZRW B;  1HP8 A;  1KUQ A;  1L8D A;  3WB2 A;  2IJJ A;  4DV4 O;  4PA7 A;  2JS5 A;  2DYS C;  3JYC A;  3FX7 A;  4B7E A;  1GN2 A;  4FLZ A;  3I56 V;  2UXD B;  1GN3 A;  3ZHS A;  2V4D A;  3JAM N;  2NNU A;  2DYR B;  1KMI Z;  4RUE A;  3UQ8 A;  1QR9 A;  4UCV A;  2VQE B;  2YI9 A;  2N05 A;  1NU1 H;  3IGA C;  3JAR B;  3UM7 A;  2UU9 B;  3EFF K;  2QKA A;  1YIJ V;  4PV1 B;  5KHK A;  4LF7 O;  2Z5U A;  4WFG A;  1S77 D;  1AB3 A;  4J41 A;  3FYI B;  3OTO B;  5EYP B;  4OXS A;  3RYI B;  4DO2 A;  1VQ4 V;  1H2N A;  1ARO P;  5BMV A;  2YI8 A;  1K34 A;  1JX9 A;  2HHH O;  3HKE B;  1N0N A;  4JYA B;  2N74 A;  2IH3 C;  3HKD A;  2CTP A;  4DXW A;  4LWS B;  4DYL A;  2XTA A;  3N2K A;  3ZHT A;  1KB9 F;  2YXL A;  2JS3 A;  4RWU A;  2R70 A;  1H2K A;  4O4J B;  1I94 O;  2YC0 A;  3ZMZ A;  1G8M A;  1YXB A;  3ETQ A;  4NTX A;  1M1K W;  1W0K G;  2Y48 A;  2XAH A;  5CBH A;  5LMN B;  5L3G A;  1RFY A;  2ADP A;  4QJF B;  4R50 A;  2LJ2 A;  4D6T H;  4P30 A;  3CWB H;  3SYQ A;  1Q5O A;  1TUE B;  5E79 Z;  3FFQ A;  4IIJ A;  1MSD A;  1N32 B;  4X1Y A;  4UCO A;  2YEV B;  4YHH B;  2EIM C;  2ZR3 A;  3ETE A;  5IYZ B;  4PDL A;  1D5N A;  4DUY B;  3ZHU A;  2V1D A;  3O65 A;  2WSS G;  4Z2W A;  4B3T B;  1MOF A;  1RSO B;  2LGQ A;  2Q5Z A;  5JJE B;  2VQF O;  4X1K A;  4YIO A;  5K1P A;  3GWK C;  3CRM A;  3OAA G;  1GN4 A;  4DR2 B;  1BQ0 A;  2EIJ C;  1AI6 A;  1HDJ A;  4PD4 F;  2B1I A;  1BHA A;  1HNW O;  3P3N A;  2QWP B;  3HKC A;  4YY3 B;  3WG7 C;  1SZX A;  1SQB H;  1EFR G;  2QWN B;  2D2C B;  3JAT A;  5H2F Z;  4DR6 B;  2KKW A;  1LUV A;  2QDO A;  1H38 A;  2QR4 A;  2HVJ C;  1QR8 A;  3A0B Z;  2HR3 A;  3N2G A;  4PA4 A;  2AHY A;  1DGS A;  2OTJ V;  1JOY A;  1R6N A;  5FPR A;  1FAF A;  1SZT A;  3QVN A;  5HFM A;  1MA1 A;  1VF5 B;  3CXC U;  5E1A C;  3K5M A;  4RQF A;  1FXK A;  5JCO C;  2Z3Y A;  1XMO O;  3N2K B;  4MVZ A;  3W7U A;  1NH2 B;  1EM1 A;  3OR6 C;  2DMX A;  3SPJ A;  2BOC C;  1P7G A;  3R65 A;  3ZRS A;  3AK3 A;  4JTD B;  3CPW U;  4TV9 A;  5LP6 C;  4X9Q A;  3T1H B;  4JV5 O;  4MTO A;  4FK5 C;  3RWR D;  5CA1 A;  3L75 H;  3KCY A;  4TT3 G;  3OW2 U;  2G38 A;  4FFB B;  1GM7 A;  2DQ3 A;  1I0H A;  1PPJ H;  2CTQ A;  4GCZ A;  4I5S A;  4ABM A;  1NKD A;  2XUM A;  4JI8 B;  2UXB B;  2BSK A;  3TK1 A;  4IIJ B;  3CCU V;  1GMG A;  4X62 O;  5KHH A;  4I55 A;  1JVM A;  1NVP D;  2CDY A;  3LDC A;  1BSM A;  3T2M A;  2WLN A;  3CRC A;  2WWW A;  2ZE6 A;  2WA3 A;  3ASN C;  1M4U A;  4WBN B;  1OCZ B;  5HFL A;  4LFA O;  3M99 B;  1WB7 A;  2EJR A;  4IGG A;  3SJC C;  1DLB A;  3VOU A;  3JCZ A;  3UO3 A;  4L8J A;  4EFE A;  1IBK B;  3BPZ A;  3CYO A;  4U7O A;  4HNA A;  4DV0 O;  3TXQ A;  5FNV A;  1YTF D;  3HKC B;  4PHZ A;  3MAQ A;  2RJZ A;  5EZY A;  4UCU A;  2B1G A;  1Y74 B;  3JAT B;  2MW2 B;  4JI3 O;  4J7Z A;  2LQT A;  1SES A;  3SJB C;  3ABM B;  3DXR A;  5EBL C;  2ZE8 A;  3AG3 C;  1JMK C;  3CJH B;  3N2G B;  1IBM O;  1M90 W;  1N33 B;  1KP2 A;  3CRA A;  4BIZ A;  3FB8 C;  1N0J A;  1B3Q A;  2CGN A;  2GTA A;  4RAI A;  4DW0 A;  4CS4 A;  3J80 N;  1EN4 A;  1I5Y A;  4TSF G;  3EXA A;  1FXK B;  2HJD A;  5EK0 A;  4F4L A;  1KC8 W;  2ZXW C;  4DK1 A;  4R8C A;  4FM0 A;  3H1K H;  4N23 A;  2A79 B;  3K9A A;  5B5E Z;  1QNM A;  1NS1 A;  2ZE5 A;  4X65 O;  2KG7 A;  1MAB G;  3LNN A;  4TV9 B;  5CA0 A;  3ZN1 A;  4FLV A;  4FM2 A;  5GON A;  4CC6 A;  3G6E V;  1FFX B;  4FLY A;  3K59 A;  1AP5 A;  4X20 B;  4JI0 O;  3FB6 C;  4Q20 A;  1CEZ A;  3F7Y C;  1KU9 A;  4OX9 O;  5KLV H;  5B1B C;  2Q73 A;  3K0D A;  1P7B A;  3CCJ V;  4QIW F;  4DV7 B;  4I7Z B;  5KHI A;  5BXZ A;  2RCV A;  3AG3 B;  2ZQM A;  4I0X B;  4LFB O;  4HAM A;  3FD9 A;  3CX5 F;  4K0K B;  2P5O A;  2FTK A;  3KZI Z;  3OUF A;  2M6Y A;  5GTI Z;  1BQZ A;  2Q7E A;  4JI6 O;  2BTQ A;  5K1X A;  3TXS A;  4LF8 O;  2DOS A;  4LFC O;  4JYB A;  1YDX A;  4LH7 A;  3BCC H;  3B40 A;  3S3W A;  2ZR2 A;  4LF6 B;  1AVM A;  5KA5 A;  2W0X A;  3S3X A;  1IZ3 A;  3TGU H;  5EZY B;  3ZRX A;  2WLH A;  3A8T A;  3BA9 A;  4NXN B;  2R72 A;  4ICG A;  5LL6 Y;  1R3I C;  4I4T B;  3T4Z A;  2PUS A;  1S5L Z;  2Y69 B;  1VQ5 V;  2JEX A;  4YJ3 B;  1OHH G;  1VQM V;  3K5O A;  1Q8I A;  2BE3 A;  1HNZ B;  1H5W A;  1SQF A;  2JRI A;  3LNM B;  3LUT B;  5DED A;  2ILM A;  1OCC C;  1M57 B;  5B1B B;  1HNX B;  1N36 B;  3OT7 A;  3ICX A;  3FYE B;  4J10 A;  4MTG A;  3KG2 A;  2HJF C;  2F4V O;  4C7U A;  2X6B A;  4TQD A;  4IYH A;  3ZRW A;  1FYJ A;  4B3S O;  2X0L A;  2ZE7 A;  4KXR A;  4EKW A;  3ZHQ A;  4DR4 B;  4WCE V;  1DTO A;  4WFE A;  4G27 B;  2KG7 B;  4RUF A;  1VF7 A;  1M5I A;  5IJ0 B;  1X4T A;  1QVG U;  4CC5 A;  2FML A;  1R1B A;  5JVD A;  3ML0 A;  3SYC A;  1IUR A;  2OCC C;  1W0J G;  3D3I A;  2ETN A;  3K57 A;  2E76 B;  2ADQ B;  1EBO A;  2EIN C;  1Y6X A;  3AG7 A;  4XDJ A;  1XNQ O;  3MHH C;  1WLE A;  1BT8 A;  2N04 A;  1N34 B;  5EYP A;  2PGG A;  5A2Q N;  4P9O A;  3RYI A;  2Q6A A;  2XND G;  1HWY A;  4AQY B;  3TET A;  4FZ1 A;  5B1A B;  3G67 A;  2HP8 A;  3HKE A;  4LCU C;  4IYI A;  4DR5 O;  2E5L B;  1S3J A;  3AG4 B;  1EN5 A;  1SA0 B;  4X64 O;  3SPI A;  3CCQ V;  4TQF A;  1FFT B;  4KHP O;  4O4J A;  4DV6 B;  1M9N A;  1YVW A;  4GX5 A;  2PYJ A;  4LF4 B;  2YIA A;  2IJK A;  1IBL O;  3MDS A;  1OCR C;  2UUC O;  3OMN B;  2R9A A;  3T1Y B;  4FFK A;  1VF6 C;  2EIK B;  4MVM A;  1D5A A;  3JD1 A;  3G6B A;  4NB5 A;  1FJG B;  4X1I B;  1IVS A;  4JI7 O;  3BEH A;  3MD0 A;  2P67 A;  4JAV A;  1VMG A;  2IM9 A;  4J9Y B;  3IJ4 A;  2YID A;  1YSC A;  2F93 B;  4RQE A;  3F5W C;  2WA4 A;  2VQE O;  2ZIN A;  3CC2 V;  5IYZ A;  3CC7 V;  1LNQ A;  2P7T C;  3W7W A;  4WFA V;  4FJC C;  4DV5 B;  3RGB A;  2QE7 G;  4ZOL B;  3T4D A;  1RSO A;  3E8B A;  3H1L H;  4TV8 A;  3GWO A;  5LGN A;  2EZO A;  2UUA B;  3KCX A;  1V55 B;  1IJG A;  1N4C A;  3OTO O;  3A2F A;  1WP7 A;  1PKX A;  2FYU H;  2ZM6 O;  5JH7 B;  2YDE A;  5LYJ A;  2XAJ A;  1GAX A;  3J81 N;  1Y76 A;  5JVD B;  1XL4 A;  3SPG A;  4FIP C;  3THO A;  1GK9 A;  4UCR A;  4JYA O;  4DR3 B;  4CS3 A;  4PI2 A;  1BHB A;  1Q90 D;  2F1M A;  3X2Q C;  1AR5 A;  2VWJ A;  4KUM A;  5BR8 O;  1PD3 A;  1QBZ A;  4ZHQ A;  4LF5 B;  3FAV B;  5LMN O;  1OJH A;  1JA8 A;  3BFR A;  3F7V C;  1Q81 W;  3CSX A;  3B77 A;  1ZSP A;  4NTY A;  2CTW A;  2NLJ C;  1VQ8 V;  3ZCC A;  2H3O A;  1THZ A;  1N32 O;  2Q69 A;  2OIE A;  2GBO A;  3STL C;  2OCH A;  1NTK H;  1RP3 B;  2DYS B;  4YHH O;  3KDR A;  4UVC A;  2P4V A;  3B8M A;  4Z1V A;  5L3C A;  4FFB A;  2A06 H;  2UXN A;  1QLE C;  4NTW A;  1W59 A;  4I9Q A;  4JI1 B;  3CCV V;  2JIZ G;  3J7A U;  2AGA A;  1SQX H;  1J95 A;  4O4L B;  4O4H B;  1AJP A;  1PL0 A;  1WNS A;  3X2Q B;  4UFZ A;  5H5N A;  5DEC A;  1VP7 A;  4BW9 A;  2GTS A;  2NR5 A;  4WBN A;  4FVM A;  4D7T A;  4JI4 O;  4DR6 O;  4TV8 B;  2ZIO A;  1HW7 A;  1YF2 A;  2VS0 A;  1ROP A;  3ZS8 C;  4UCT A;  5LMU B;  1R73 A;  1JNB A;  1WP8 A;  5JCO A;  1XQ8 A;  3AK1 A;  5LYJ B;  4JI2 B;  1Z2G A;  1JFF B;  2BCC H;  4XDL A;  1Y76 B;  4FM1 A;  4NXM B;  1Y74 A;  3STZ C;  5LP6 A;  3D8C A;  1UJW B;  4UUJ C;  2IJI A;  4UVB A;  4DRX B;  1QQC A;  2FKX A;  1TAE A;  4QE9 A;  3EVK A;  3JAL B;  4K8Z A;  1JQ0 A;  1Q7Y W;  2Q68 A;  3CJH A;  2P06 A;  2LP7 A;  4O2A A;  2ZDI A;  3BAA A;  1RM1 C;  2AW9 A;  4ZHQ B;  1AJQ A;  3T1H O;  3UCS C;  5A9G A;  4F6R A;  1K73 W;  5EC2 C;  1NZ6 A;  2HEP A;  3B09 A;  2VQF B;  1B04 A;  4DUZ B;  2IW5 A;  3W7T A;  2EIM B;  2ZNJ A;  5CB4 B;  2GHY A;  4DK0 A;  3M7M X;  1X59 A;  2F23 A;  4JI8 O;  3MHS C;  2UXB O;  1ORQ C;  5KHJ A;  4A5U B;  3AG1 C;  4GKK B;  5H6R A;  4ASU G;  1FOU A;  2KQX A;  2GSM B;  4FLX A;  4UV8 A;  4ZKI A;  4JPR A;  3H1I H;  1JR9 A;  2EIJ B;  2KSD A;  5IY5 C;  1K97 A;  3VBB A;  1FFX A;  3WG7 B;  2CGO A;  3DTU B;  1IBK O;  3L9D A;  4X20 A;  3D36 C;  1XIL A;  2QKS A;  1IXM A;  4X66 B;  4JI5 B;  1YI2 V;  3IC7 A;  1M93 A;  4CS2 A;  1GM9 A;  3ABK C;  1XOU A;  4I0X A;  4WFH A;  1RM1 B;  5LOV A;  4PDV A;  5B1N A;  1Y67 A;  3RBZ A;  2QM7 A;  1XMO B;  1K3E A;  2AZ2 A;  4W4L A;  3SYA A;  4BIO A;  5IYB O;  5JJJ B;  1WAZ A;  4DR7 O;  2DWE C;  1BS3 A;  3AEI A;  4R7C A;  3ZIA G;  4MSW C;  1K9M W;  1AI5 A;  2QKC A;  3K0G A;  1K4D C;  1Q86 W;  4JV5 B;  1AR1 B;  1ZLZ A;  4H37 A;  1N33 O;  2F66 C;  4GZR B;  3HR0 A;  1FPO A;  3P30 A;  3QF7 A;  1WN7 A;  5LP6 B;  4FLW A;  5CBG A;  4UB8 Z;  2W0F C;  5IY5 B;  4I4T A;  4NVP A;  4DV2 B;  1XNR B;  4P2Z A;  1Z5V A;  1R6K A;  5C93 A;  1XRE A;  4XDK A;  2IU0 A;  4YJ3 A;  3E83 A;  4O2A B;  1QLN A;  2WLL A;  2W6I G;  4AHC A;  5D5Q A;  2X6C A;  3U10 A;  2JJ1 G;  5IYC O;  1SQP H;  5IE9 A;  3CE2 A;  4F6R B;  4NKG B;  1K92 A;  3C3T A;  1QVF U;  3AG2 C;  1WPX A;  1I08 A;  3ABK B;  3QO5 A;  4MTF A;  1GKF A;  3ASN B;  2WLK A;  4DV1 B;  4I50 B;  5GTH Z;  5LHH A;  4FMT A;  3LDD A;  4PJ0 Z;  3RYC B;  4PDM A;  5IWA B;  1MNG A;  2JGU A;  2QWO B;  4O4I A;  4K8X A;  2DE0 X;  5KAF Z;  1S5J A;  5IJ0 A;  2OT5 A;  2R9I A;  2Q0A A;  3SR2 C;  2QM8 A;  4JYY A;  2WPD G;  3CRR A;  2ITC C;  2P22 C;  4ZI7 B;  4GLX A;  1MSW D;  2QTS A;  4CH3 A;  5D5P A;  3K5N A;  4DR1 B;  3ZJZ A;  1IBM B;  2LW7 A;  2YIB D;  3K04 A;  3G4S V;  1CXZ B;  4LNU A;  4WFF A;  5LXT A;  2EIL C;  2DQ0 A;  2WAM A;  2ZD9 A;  2L6L A;  3ASO C;  4TOI A;  5BZB A;  3SYP A;  2WLI B;  3CD6 V;  3GVM A;  3BHP A;  5LOV B;  3E8F A;  4X88 A;  2UUB B;  3E22 A;  4NXN O;  3ZBH A;  3ZMU A;  4GX0 A;  3JAW A;  3JD2 A;  3CEI A;  2EJ7 A;  3ABL C;  1Q43 A;  1SA0 A;  2A7W A;  2Q4P A;  3JAK A;  1GH6 A;  1HNZ O;  1DF5 A;  2ZXW B;  4YJ2 B;  3ZHR A;  5KX5 B;  2EX3 A;  5KAI Z;  4F6E A;  3P3P A;  4BR6 A;  2DN9 A;  2CH7 B;  1HNX O;  1MZF A;  1V54 C;  1R6T A;  2YS8 A;  3GB7 C;  1J5E B;  2RDC A;  4GKJ B;  4J9Z B;  2GUZ A;  1SC5 B;  2JJ2 G;  2HFE C;  3OD4 A;  1Q6H A;  3W7X A;  1K5S A;  4JI0 B;  4QNH B;  4MT8 A;  2WLM A;  1ZWI C;  2Q0O C;  3ZX6 A;  4ZBM A;  1AP6 A;  1HR0 B;  4TWK A;  5EBW C;  4DR4 O;  4WFB V;  1E1Q G;  3SPC A;  1SER A;  2OWO A;  1K33 A;  2RN9 A;  4X1I A;  2QSA A;  2WLL B;  4CZZ A;  1F23 A;  1NTM H;  3RVZ A;  2IH1 C;  1MMM A;  2X7R B;  1H2M A;  3K58 A;  4CH5 A;  5ITZ A;  4B3M B;  1QU7 A;  4H44 B;  4JTC B;  1LR1 A;  1AR4 A;  4LFC B;  4JZG A;  3K9S A;  2ITD C;  4ZOL A;  4QPJ A;  5FLX N;  3B4S A;  3H1H H;  3ETD A;  5BY1 A;  3A0R A;  3FB5 C;  4RO2 A;  1Q82 W;  4Q6G A;  1Y66 A;  4O4I B;  5L3E A;  1S5H C;  4PA9 A;  3E8G A;  5EC1 C;  5B66 Z;  4AQY O;  5JH7 A;  2F43 G;  1OCO C;  3L70 H;  4JGS A;  1EN6 A;  2ZKO A;  3BVO A;  2VRZ A;  2E5L O;  4LF9 O;  1AIL A;  3C90 A;  1SQV H;  5LGU A;  1H2G A;  3JD0 A;  2V7Q G;  4O2B B;  1XMQ B;  1VQN V;  2QWR B;  2A9H A;  3C3S A;  4LNU B;  5LXT B;  4YXW G;  1F7Y A;  1ZL8 A;  4DV6 O;  1VQ9 V;  1VF6 A;  2JEU A;  1SET A;  1PNL A;  3OFN G;  5LHG A;  3U0Z A;  3RYH B;  1MG1 A;  3QTC A;  4LF4 O;  1TUB A;  2ZCE A;  2F4V B;  3JSN A;  3RVY A;  1ZX3 A;  1KEC A;  3E22 B;  5JWP A;  3CP1 A;  3FAV A;  3BY6 A;  1H2S B;  1OCC B;  1NQT A;  2W6J G;  3K03 A;  3JAW B;  3AK2 A;  1E1R G;  3ZMS A;  4J80 A;  3APO A;  1XHX A;  2PI5 A;  3JAK B;  1FJG O;  1H8E G;  1JJO A;  3QO7 A;  4HYO A;  4DV3 B;  1IDS A;  5DM6 V;  5TIS Z;  3K08 A;  4FPP A;  1L0L H;  2QGN A;  1YJW V;  4PA6 A;  4E2L A;  2GUZ B;  4X89 A;  1KBH A;  2YIB A;  1SRY A;  1KKC A;  4FLU A;  4DV5 O;  4R6Z A;  2DYR C;  2EZP A;  1V9P A;  1NVP B;  1O9G A;  1U97 A;  1XNQ B;  3OEE G;  5FPO A;  2UUA O;  3ZHV A;  1FXH A;  2XAF A;  4IHJ A;  2OCC B;  4UB6 Z;  1P49 A;  1PV0 A;  2UXD O;  3BRC A;  3RFR A;  1BZK A;  1CPY A;  2EIN B;  3B2E E;  4O4L A;  4O4H A;  3M8A A;  5ITZ B;  2BOB C;  4NYK A;  4DR5 B;  1OZ0 A;  2UU9 O;  1G1X B;  5IJ9 B;  1Z5W A;  1TA8 A;  3I55 V;  1BGY H;  4GX2 A;  1G6U A;  2ARH A;  1YTF B;  1UFI A;  5DN6 G;  4JAA A;  1I5X A;  3I5D A;  4KL1 A;  4PI0 A;  2Q7H A;  2ZNI A;  5F2V O;  3SYO A;  2H8P C;  2EUL A;  3E8H A;  3K5L A;  4LF5 O;  3W7S A;  1JFF A;  4UXN A;  3Q4H A;  4B3R B;  1YCI A;  1US6 A;  2E75 B;  2XAS A;  3ABU A;  2CTR A;  4W4K A;  5LA6 A;  1OCR B;  4E4E A;  4JI7 B;  1GO3 F;  2WLJ A;  4DRX A;  3RW0 A;  3HKB B;  4BWA A;  2Y4T A;  2NN4 A;  3JAL A;  2UXC B;  1T5E A;  1ZL8 B;  2HKO A;  4AIL C;  4N21 A;  1IXB A;  3H9V A;  4P9P A;  1TUB B;  1QHT A;  3PN1 A;  2MK3 A;  3R66 A;  4BIU A;  5C8Y B;  2B9Z A;  1URF A;  3SDL A;  1GN6 A;  5CMU A;  4DV4 B;  1BCC H;  3IFX A;  2JGD A;  3K3W A;  3OR7 C;  4JAU A;  5KMG A;  5CB4 A;  3UO2 A;  1NR7 A;  3IAY A;  1XDC A;  2Y4U A;  4JI1 O;  4QPK A;  2ZM6 B;  3F5T A;  3G80 A;  1GTO A;  2YIC A;  3UT5 A;  3E86 A;  2A3Q A;  4DUY O;  1YHQ V;  1XUQ A;  4X8A A;  3D3Q A;  3VQX A;  4B3T O;  4LF7 B;  5J2T A;  1RPR A;  2QA4 V;  2M7W A;  5L3F A;  4DR2 O;  4QGP A;  4IHJ B;  1M56 C;  1WB8 A;  5BR8 B;  1R3K C;  2ATK C;  5LMU O;  5B3S C;  4MTX A;  3K06 A;  1NI8 A;  1SQQ H;  3RYF B;  1BMF G;  4OPA A;  2HHH B;  1I7F A;  4JI2 O;  5CN0 A;  2ODM A;  4YY3 O;  3B8N A;  4H33 A;  5EIB C;  1NT2 B;  3DC5 A;  5CA3 A;  3JAS B;  4NXM O;  1QCE A;  1PNM A;  1W2B U;  2ZT9 B;  3U11 A;  4TUY B;  1FKA O;  3DGE A;  1JJ2 U;  1I94 B;  3BA8 A;  3KKY A;  5CBF A;  3A0H Z;  1L1F A;  4JZ2 A;  2F95 B;  2FL4 A;  2PY5 A;  4LBE C;  2O57 A;  3OGI B;  3Q4H B;  4B7K A;  3DSQ A;  5KHG A;  1BL8 A;  4DUZ O;  1P84 F;  5LA6 B;  4H13 B;  4K3A A;  3VQW A;  2RMK B;  3UKM A;  1AI4 A;  4PDR A;  5J2U A;  1ZTE A;  2RQ6 A;  1PNK A;  1WA8 A;  2QTO A;  2BTO A;  3CB2 A;  3SGI A;  4GKK O;  1K4C C;  4LP8 A;  3VQV A;  2GDS A;  4J7K A;  1Q3E A;  2YUA A;  1M56 B;  1QLE B; 
#chains in the Genus database with same CATH homology
 1I08 A;  1XDC A;  2CDY A;  1BSM A;  1JR9 A;  1KKC A;  1MMM A;  4YIO A;  3DC6 A;  1GN4 A;  1AP5 A;  4GUN A;  1AR4 A;  2QKA A;  1MNG A;  4JZG A;  1WB7 A;  1XUQ A;  3K9S A;  1SZX A;  1IX9 A;  3LSU A;  1XIL A;  2RCV A;  4JYY A;  2ADQ B;  2P4K A;  1WB8 A;  3TJT A;  1LUV A;  1BT8 A;  3RN4 A;  5AG2 A;  1PL4 A;  1B06 A;  1Y67 A;  1N0N A;  3AK1 A;  1EN6 A;  1AVM A;  3DC5 A;  1BS3 A;  1AR5 A;  3QVN A;  2QKC A;  1PM9 A;  3IC9 A;  1EN5 A;  1MA1 A;  3C3S A;  1ZLZ A;  1ZUQ A;  3KKY A;  2CE4 A;  3CEI A;  4YIP A;  3EVK A;  4JZ2 A;  1JA8 A;  3BFR A;  1EM1 A;  1N0J A;  2ADP A;  4E4E A;  1P7G A;  2AW9 A;  1VAR A;  1ZSP A;  3AK3 A;  1EN4 A;  3MDS A;  4F6E A;  5A9G A;  4BR6 A;  1LUW A;  3AK2 A;  4X9Q A;  1IXB A;  4FFK A;  1XRE A;  1MSD A;  3OT7 A;  1VEW A;  1ZTE A;  3KDR A;  1QNM A;  4C7U A;  1IDS A;  1I0H A;  1GN6 A;  1AP6 A;  1D5N A;  1GN2 A;  3C3T A;  2GDS A;  1GN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...