1QNMA

Human manganese superoxide dismutase mutant q143n
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNNDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Probing the active site of human manganese superoxide dismutase: the role of glutamine 143.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1qnmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1qnmA02
3IC9A 1GN3A 4BR6A 1SZXA 1AP6A 3RN4A 1ZLZA 1XREA 4X9QA 3EVKA 1P7GA 3C3SA 1IX9A 3OT7A 1BS3A 1EN5A 3MDSA 1EN4A 1VARA 3KKYA 1MA1A 2AW9A 1GN4A 1MNGA 2P4KA 2QKCA 4YIPA 1AVMA 1IXBA 4GUNA 5AG2A 1WB8A 1I08A 1LUVA 1JA8A 1B06A 3DC6A 1D5NA 3C3TA 4YIOA 1BSMA 1BT8A 1WB7A 1QNMA 1AR5A 5A9GA 1IDSA 1EN6A 1N0NA 1XUQA 1PM9A 1MMMA 1GN6A 1MSDA 4F6EA 1ZSPA 3BFRA 4JZ2A 4JZGA 1EM1A 1I0HA 1XDCA 1ZTEA 1Y67A 1AP5A 1N0JA 2ADQB 4E4EA 3LSUA 1GN2A 1XILA 3TJTA 2GDSA 1AR4A 3K9SA 2CE4A 3QVNA 1ZUQA 2ADPA 2CDYA 3DC5A 4JYYA 1PL4A 1KKCA 3AK1A 3CEIA 2RCVA 1LUWA 1VEWA 4C7UA 3AK3A 2QKAA 3AK2A 4FFKA 1JR9A
chains in the Genus database with same CATH superfamily
4TQFA 1DK1A 1SZXA 1N34B 2WAMA 2YEVA 4RO2A 4NXMO 4GKJO 2JS5A 1Q86W 4JTAB 1Q8IA 1N36B 3CC7V 3MHSC 3OUFA 3K3WA 2ZIOA 1EN5A 3ABLB 2X6CA 2QR4A 5FNVA 3N27A 4UCUA 2LW7A 1QQCA 4JI3O 2DYSB 3PJSK 2JDIG 4QGPA 2PTMA 1D5AA 1FD9A 4UVCA 2GSMB 4LNUA 4BW9A 3JYCA 4WF9V 3C3TA 1BGYH 2BTOA 1YSCA 4UVAA 3FD9A 3ETEA 3A0RA 2ZINA 1NTKH 4YJ3A 4O2BB 1QVGU 1S76D 3CC4V 1M5IA 4O4JB 2HP8A 4DR3O 4FM2A 5H6RA 1HDJA 3RYFA 5IYBO 1WPBA 5B3SB 1IVSA 1IBLB 2B1GA 2ETNA 4HAMA 5L3FA 3ZJZA 4O2AA 3TJTA 1OCCB 1M1KW 2KQXA 2V1DA 1Q7YW 3SPGA 3STLC 4DV0B 3SYQA 5BR8O 2ATKC 4HZ3A 3CSXA 3JARA 1XMQB 1GH6A 4DUZB 1WA8A 4PDRA 4BAYA 1ZWIC 4MVSA 3I56V 1G6UA 2DOSA 3E22A 4B3MB 3SR2C 2Q69A 3QO8A 3L9DA 4IHJA 1PV0A 1G8MA 4DR5O 2ZQMA 2IH1C 3RYIB 2NLJC 3H1HH 3IAYA 3LNNA 5EYPB 3K5NA 2LP7A 1VIBA 2WPDG 5IY5C 4LFCO 5H6QA 1WAZA 3AG1B 3T2MA 3SJAC 3ZRWB 2C2AA 1NVPB 1F23A 3FYEB 2CK3G 4JAVA 2PUSA 3KG2A 1XNQB 4E2LA 4QIWF 4UV9A 4JYAO 5IYCO 2V7QG 4Q6GA 1CXZB 2E5LO 4OPAA 3RFRA 1IBKB 4X1YB 1FJGB 2DE0X 2IW5A 3B8NA 2BTQB 3BFRA 4JZGA 2UUBB 5LOVB 1RPRA 2Z5UA 2VQEO 4J80A 1I94O 1QR8A 3JAMN 2QWQB 4J7ZA 1R6TA 4B08A 4UUJC 5L3EA 4O2BA 5JH7B 2EILC 4UCOA 2RJZA 1AR4A 2WLIB 3AG2B 1HWYA 3TXSA 3J7AU 2ADPA 3ASNB 5F2VO 3B8MA 3ZMSA 2YIBD 2H8PC 1F4MA 2EINC 2LGWA 3LDCA 4ZIBA 4R7CA 3ZIAG 3F7YC 1OCOB 1FYJA 3FB5C 3ABKB 1VQ8V 1VQ7V 1KMIZ 4EB6B 1AP6A 3UT5B 2WA3A 4TOIA 5B1BB 2QWOB 4JI4B 4NVPA 3CPWU 4NTYA 4JV5O 4JGSA 2R9IA 2E75B 5E79Z 4P2ZA 2WLLB 2Q9LA 2A9HA 5J2TB 2OYQA 1CP9A 1MA1A 3T1YB 3CRRA 2P4KA 3ZHRA 2LJ2A 4FPPA 2QM7A 2A7WA 1I08A 3BABA 3U0ZA 5IT9N 1WP7A 5HFLA 1TVKB 2D3OW 4DR4B 4ZBMA 4LF9B 4D7TA 4TV9B 2RQ6A 1CEZA 4JTCB 3RYIA 4K0KB 4DV4B 2UXXA 5EYPA 1R3LC 2X6BA 1IXMA 5K1XA 1N8RW 4IYIA 4EKWA 4J7KA 4F4LA 1QLNA 2YC0A 1PM9A 2XAFA 1KQSU 1PKXA 1SC5B 2BOCC 1OCZC 4JI8B 1WN7A 2UXCB 3ZRWA 4MTGA 3RYHB 1SQFA 4B7EA 3JCZA 4LFBO 4B3RO 1YJ9V 3RVYA 2JEXA 1V54B 2KKWA 5IYZB 1X59A 1SQGA 5JVDB 1ROPA 1DTOA 1MG1A 1HR0O 3ZRSA 3BVOA 1MSWD 4X1YA 3AEIA 4DXWA 3D3QA 4FLWA 3HPLC 5BXZA 1Y66A 5LOVA 4P9OA 4GX1A 2A79B 3CEIA 3CCRV 1OV9A 1Q81W 4FFKA 2F66C 4LF7B 2DJVA 1NH2B 5JH7A 5JCOC 2YS8A 4NTXA 4WFFA 2WLIA 1BHBA 4LF4B 1FS0G 4K35A 2VQFB 1KKDA 3D36A 1JPXA 4DV1O 2BCCH 4U3JB 4J7JA 1AILA 5A2QN 3VQWA 1A32A 1HNWO 5FL7G 3G80A 4H33A 1L0NH 3W7TA 5H5NA 1FXKC 4EB6A 3UT5A 2JJ2G 1BSMA 3GB7C 1N33B 3QTCA 4LF5B 3FX7A 1H2KA 2QEXV 3E35A 2YXYA 4DUYO 1Q6HA 4H44B 4NB5A 2WLLA 4I4TB 5J2TA 1XQ8A 5KAFZ 4ICGA 5CMUA 2KB1A 1H2MA 2WWWA 4CC5A 5JQGA 1KECA 1K5SA 1MSDA 3B40A 4FZ1A 1TVKA 3HKDA 4JF3A 2EIJC 1YJNV 1RFYA 3OMIB 3E89A 1RSOB 1QLEB 2Y4UA 4TV9A 4O4IB 4DW1A 1N34O 3IC7A 4CH4A 2YSUB 4A5UB 4DR7B 2FKXA 2LQTA 1N36O 1NVPD 5DECA 2CH7B 2ZIMA 2BE3A 1BQ0A 3K9SA 4ASUG 3SDLA 2ZXWC 4TUYB 3LSQA 1US6A 2P6JA 1O9GA 4X8AA 4JI5B 3T1HB 4TQDA 2F95B 3ABTA 2HHHO 3RYHA 2CGOA 1E1RG 2P67A 4FK5C 3CCUV 2VRZA 3NR7A 5DEDA 3T4DA 1VP7A 5DN6G 3X2QC 4W4LA 1VF7A 1VF5B 4NYKA 4X20A 5IYZA 5JVDA 2XAQA 4YY3B 1YITV 4KFMA 3FKSG 3SJBC 2ZR3A 1ZLZA 4EFEA 3H1IH 2OTJV 3AG3B 1W0KG 2EIMC 3OMAB 1K7DA 2GTSA 3KKYA 4D7SA 4HBNA 2Z3YA 4YHHB 1IXBA 2Q68A 4JI1B 2HJDA 1VF6C 5LP6C 3OTOB 3A0HZ 2FB5A 1X4TA 2FYUH 3K0DA 3KCYA 3LDEA 5KA5A 3K08A 3ZCCA 3GVMA 4DV0O 1XBLA 2G38A 4U3JA 1XMQO 4ZI7A 1IDSA 3ZMZA 3WB2A 4DUZO 1SA0B 2GV9A 2NNUA 3G6EV 3CB2A 4JZ2A 2VS0A 4B3MO 4HYOA 1H38A 2Y4TA 3T1CA 2P90A 1JQ0A 2IJKA 2JGUA 1RM1B 1JJ2U 1GMGA 5J2UB 1GN2A 3HKCB 1FKAO 5EBWC 3KDRA 3ICXA 4FJCC 1M93A 2EX3A 5EBLC 3EXAA 4TV8B 3CD6V 2HR3A 5KHIA 3JARB 2W0FC 4PI0A 4WFAV 4MT8A 3ZRVA 3DC5A 3BHPA 1BL8A 3H01A 1FAFA 3BA8A 4BIOA 1RSOA 3HR0A 4X62O 2JIZG 1KKCA 1NQTA 3HKEB 1R73A 3CXCU 5BY1A 5IE9A 1FPOA 3F5WC 3UO2A 4UCTA 2CH7A 3CRCA 2UUCO 4JI2O 1HNXB 2CTQA 4TUYA 1OHHG 3QO7A 2KSDA 2A3QA 2Q4PA 1IBKO 1FJGO 2CAZC 3P3NA 2UUBO 3BEHA 1TUEB 2DMXA 2Q0AA 3BY6A 2WSSG 5KHKA 4JI0B 1Q5OA 5LXTB 4DV5B 1NBMG 1S77D 4PA4A 1NH2D 3OW2U 5KA6A 3ABMC 3K58A 4WFBV 2PY5A 1VMGA 1NI8A 4LP8A 3T4ZA 2EZOA 1WLEA 3WG7C 1VQ5V 1K9MW 2D2CB 4GX0A 1Z5WA 1UPGA 3P3PA 1SQQH 2VWKA 3M8AA 2QSAA 3CRMA 1JJOA 4LC1A 2EJ7A 4BIUA 2ODMA 2RMKB 1K34A 1KU9A 3CCLV 2DQ0A 4JI4O 1Y4MA 1G4YB 3H1KH 4UV8A 4JAUA 1RPOA 2ZKOA 1S72V 5GONB 2Y69B 4IT5A 1SA0A 4OGQB 4GKKB 4Z1VA 2CE4A 5BZBA 3T1YO 3G6BA 2AHZA 2FL4A 5FPRA 4JYYA 1Z5VA 2ZM6B 3ZMTA 2X6AA 4DR4O 5FPOA 1I7FA 3F5TA 5B1AB 4LF9O 5J2UA 3ZMUA 3HKCA 4HNAB 1Q3EA 3CX5F 2AZ0A 3TXQA 2HLDG 3EFFK 4TV8A 1MZFA 4DV4O 2Q7GA 3CRQA 4X9QA 2Y48A 1MZEA 2RDCA 3E83A 3IFXA 1G1XB 2B1IA 2Q67A 4WBNB 1Z2GA 2QTOA 2F43G 5EC1C 4QJFB 3HKEA 1YI2V 4JI8O 5CN0A 1S5JA 1QU7A 2JJ1G 4WFHA 5GW7A 1H5WA 5CBHA 2UXNA 1T5EA 2Q7EA 3B09A 1BQZA 3E8FA 4UXNA 2ZE6A 3N2KB 1QR9A 4CH5A 3U11A 1KP3A 4BWAA 2XT9A 2N05A 1W0JG 1J5EB 1GN6A 2E76B 2XAJA 2HG5C 1COWG 5LXTA 5C93A 4X1KA 3STZC 4LF7O 4GYCB 5LMNB 3RW0A 2QJ1A 2EIKC 1N0JA 2P7TC 1H8EG 2ADQB 4UFZA 4E4EA 1V55B 4LF4O 4GX5A 2DWEC 2VQFO 1YXBA 3VQYA 1P4RA 3L74H 4X1IB 4LFAB 4ZKIA 3QVNA 1QCEA 5L3GA 3E8BA 1KYOF 2DYRC 1KD1W 5LGUA 1S5HC 1EZVH 2PZSA 5JWPA 4GX2A 5LYJB 2R72A 1N33O 4H37A 1HP8A 3W7SA 4LF5O 5L3DA 4QE9A 1AROP 1YCIA 5GONA 3R65A 1B6QA 1R3KC 3JSNA 2UUAB 5EIBD 3SYPA 4JTDB 4NXNO 4Q20A 4QE7A 5B5EZ 1SQXH 2W6JG 4G2KA 3CCEV 1K33A 1LUVA 2OIGA 4HNAA 4IIJA 3FB6C 3CJHA 4K8ZA 5EC2C 2CUGA 3ASOB 4ABMA 4GLXA 5IWAB 1XL6A 2OCCC 2YI8A 1WB7A 2OT5A 1JNBA 1N32B 4WBNA 1NZ6A 4P30A 4CZZA 4H13B 4JI5O 4TT3G 5L3CA 3T1HO 3JD1A 1OCRB 5JQGB 1F4NA 2IH3C 3ABLC 4F6EA 1D2DA 3HKDB 3K79A 4OX9B 2WLJA 2DYSC 1IBMO 4FLVA 1SS3A 3SJQC 4YJ2B 4YY3O 2CGNA 4XDJA 4FM1A 2XNDG 3LSUA 3N2KA 4JI7B 1I5YA 1HNZB 1L1FA 4X66B 3VBBA 5LGTA 3VQXA 4YHHO 3CRAA 5LA6B 4N21A 3JAKB 2PYLA 5BR8B 1VEWA 3OTOO 3UKMA 3AK3A 4X20B 3SYAA 4P9PA 3IJ4A 5B3SC 1YIJV 3DXRB 3ZEDA 3A8TA 3IC9A 3JATB 5DM6V 1GN3A 4UB8Z 4IL6Z 1GKFA 2BSKA 1XREA 3QNEA 4X1IA 4RUFA 4U7NA 2ZNJA 1AI7A 2Q73A 1IZ3A 1Q43A 1OCCC 1WPXA 2EULA 1FOUA 1CPYA 3K04A 3GWOA 3MDSA 1VARA 5CA3A 1S0VA 4DW0A 4F6RB 4FFBB 1GN4A 1M57B 5LYJA 1PNKA 3K59A 2FTKA 1QBZA 1RP3B 4MS2A 2JEUA 1AJQA 2H94A 4PHZA 3AG4B 4LFCB 3D8CA 1PL0A 4LF8O 2JS3A 4JYBA 5JJEB 1QHTA 5EK0A 4WFEA 2ZE7A 2Q7HA 1XOUA 2QE7G 4JAAA 3K5LA 1M56B 3MHHC 4UCVA 4ZI7B 1AR5A 3UM7A 3ETQA 2OWOA 3OTFA 4WCEV 5B1OA 2X0LA 5KX5B 1H2SB 4DV6B 2LO1A 2ILMA 4LH6A 3DSQA 2DQ3A 1R3IC 3CYOA 5EBMC 5LMUB 1VQMV 1ZSPA 4PA9A 3EHBB 4MVMA 3ETDA 4CC6A 3JD3A 4AQYO 4GZRB 4MVOA 3AG1C 4X88A 3K5MA 1XNRB 2YICA 5KHGA 3SPCA 4UB6Z 1HNXO 3I5DA 4MW3A 4PA7A 4BW5A 2GDSA 3CMEV 4FM0A 2ZT9B 5IJ0B 2UU9O 5CB4A 3K03A 3ML0A 4JI0O 2QGNA 1NR7A 3CCSV 4YJ2A 1VF6A 2UXDB 4DV5O 3J81N 1BCCH 1DGSA 3E2EA 2LW1A 2A06H 3SPIA 3K06A 2DN9A 3IGAC 4UVBA 2YI9A 4G28B 4ZOLA 1Q6UA 5E1AC 2PI4A 2YDEA 3WU2Z 1Y76B 3R66A 3UCSC 2L35A 3OUSA 2GUZB 1Q82W 1R6KA 3K0GA 5LA6A 5IYDO 3ZX6A 4J9ZB 3JAKA 3LDDA 3AG2C 1MNGA 4BIZA 1L0LH 1K3EA 3N2GB 3ASNC 3D36C 4DK0A 4YIPA 3ZN1A 1ZX3A 3DXRA 1VQLV 4K8XA 3JATA 3DC6A 4FZ0A 1W59A 1BT8A 4GT1A 4X64B 1OCOC 3ABKC 2EBOA 4GCZA 1XEQA 5KLVH 2HFEC 4XDLA 1Y6XA 5B1BC 4GKKO 1B3QA 4PA3A 4MW8A 1GM9A 1SZTA 1I5XA 4KP4A 4F6RA 4Z2WA 4FFBA 2ZR2A 3OE7G 1IBLO 1K97A 4W4KA 2ZM6O 4EEQA 2ZNIA 2N04A 1UJWB 2XAGA 4DR1B 5IJ9B 5LHGA 1MOFA 1I0HA 2F4VB 3B4SA 4LCUC 1NU1H 4I9WA 1JX9A 3FYIB 1FFTB 1AB3A 1LNQA 4LFBB 2A0LA 1H8HG 2HVJC 5KX5A 1SETA 1K92A 2ITCC 4FMTA 1KP2A 5IY5B 1TGOA 2YXHA 2W0XA 1H2LA 4R50A 2GTAA 4DV7B 2GBOA 2F1MA 4DV3B 2JVDA 1SF9A 2AZ2A 1P49A 2P22C 1EBOA 5KMGB 4PD4F 4PELA 3OGIB 4B3SB 3B2EE 3LUTB 1R3JC 4MVZA 2Q5ZA 3SGIA 5CA1A 1E79G 3ZHUA 1V54C 3S3XA 5IJ0A 1GK9A 4KL1A 1PNLA 3H9VA 1VQOV 3OT7A 3DGEA 3PN1A 1BS3A 1J5EO 2E74B 3Q4HB 1H2NA 1SQVH 3W7UA 5L3BA 4DV1B 5AG2A 3JD4A 5LMNO 3SYOA 1JA8A 5EZYB 1F51A 1XNQO 4AILC 1D5NA 1TAEA 1PNMA 1TUBB 4I0XB 1Y76A 4MVRA 1DF4A 2EILB 2GUZA 1WP8A 4LWSB 4LFAO 4R8CA 1U96A 3THOA 1BE3H 3N2GA 4I55B 2ITDC 4TSFG 2EINB 1SQBH 2PYJA 1XMOB 3ZBHA 1SERA 4LF6B 2QDOA 3L72H 3RGBA 2MW2B 4X1KB 3CMAV 2RN9A 4X89A 3OAAG 3ZN0A 3BPZA 3E8HA 3K9AA 3QG5A 4FIPC 1OZ0A 5CBGA 2PF4E 4OPHA 3L73H 1XILA 3E86A 2UUAO 1GRJA 3QO5A 4DV2B 2ARHA 1K73W 3HB3B 4YXWG 3F7VC 2CDYA 4DR6B 4MTFA 5KUMA 5IJ9A 3OM3B 2M6YA 3ZHQA 2RCVA 5LL6Y 2QWNB 2ZDIC 5IWAO 2HHHB 1FXVA 1QLEC 1AI5A 4OXSA 3BRCA 3H1JH 2UXBB 3RN4A 3TGUH 1N32O 4MTXA 1JCHA 2DW4A 4KHPB 3CCVV 1IX9A 1SESA 1OCZB 4OX9O 4JASA 2WLMA 3TCUA 2MK3A 5KMGA 2IM9A 4MTOA 3SPJA 4IIJB 1EZJA 3CJHB 1K8AW 4K0KO 1DF5A 4MVQA 1B06A 4I50B 4LR3A 4EFBA 3L70H 1YTFB 5LBQA 3KZIZ 5IDJA 2WLKA 3ABUA 2XTAA 1J95A 4JI7O 3JALB 2O57A 4JI6B 1HNZO 4U3FH 3Q4HA 3BCCH 2UXCO 1V9PA 4X66O 2LGQA 3AG3C 4J41A 2HEPA 4B3TB 2Y0PA 1L8DA 2CTWA 4LBEC 4DR2B 2YIBA 5JJNB 5EZYA 1UFIA 1NTMH 1TUBA 4I0XA 5C8YA 3GWKC 1GM7A 4J10A 3FB7C 5KAIZ 1K4CC 1WNSA 4LWSA 4I5SA 3L75H 1YHQV 4O4HB 2N74A 2NN4A 3L71H 1PPJH 4I55A 4PDMA 2AHYA 2Q6AA 1F7YA 3A2FA 3ZHVA 3O9OA 1Q90D 4PDVA 4RAIA 1VQ6V 1H2GA 1FXKB 2YUAA 3CHXA 2JRIA 2WLHA 1KB9F 1PP9H 4L87A 2Z0AA 4X62B 3FAVB 2BSKB 1WJZA 3BA9A 4X65B 1RM1C 1M9NA 3EVKA 1S5LZ 1XHXA 4DV6O 2K1EA 3K57A 5EIBC 2IBZH 4LH7A 5LMUO 2ZD9A 2UUCB 4JI2B 2EIJB 3CWBH 1S3JA 2QKCA 1AVMA 3TETA 1O9HA 4JPRA 2AXTZ 1XNRO 1NS1A 2ZE5A 1M90W 1NR1A 1NKDA 3UQ8A 4WFGA 1GTOA 4U7OA 4AI8A 1URFA 1QNMA 1GM8A 2ZXWB 3RWRD 5BMVB 1FFXB 4NXMB 4GKJB 1K4DC 5FLXN 1N0NA 2KG7B 1KC8W 3AG7A 3CCJV 1N4CA 4O4JA 2K9PA 3JSLA 3X2QB 2UXDO 4DR7O 4JI3B 4I50A 3MAQA 4MVUA 1Y67A 1KBHA 3APOA 3TK1A 3JALA 3O65A 5CBFA 1MABG 2ZE8A 4PV1B 2EIMB 2YIAA 2R9RB 1VQ4V 2HVKC 2OIEA 5B66Z 5HFMA 2QKSA 1BZKA 4DYLA 5CB4B 2GHYA 2XUMA 4Z1MG 2PGGA 3AK1A 1VQ9V 4DR3B 1LUWA 5LP6B 4IGGA 1KUQA 3LSSA 5JCOA 4CH6A 3U10A 3QF7A 2LFRA 4X64O 3OMNB 2VWJA 1JR9A 3SPHA 3ZMVA 4AHCA 4O4HA 3W7XA 4BR6A 4DO2A 4ZOLB 1LR1A 3H1LH 4XDKA 3HKBB 1HW7A 4J11A 3G71V 2W6IG 1Q6IA 3C3SA 4PDLA 3SYCA 2XOKG 4MSWC 3BAAA 2Y69C 1JOYA 1THZA 4JI1O 5H9CA 1FXKA 4DR1O 1AR1B 2F4VO 1FXHA 2FMLA 3G4SV 4FLTA 3WB0A 1YVWA 3FAVA 4CBCA 4J42A 1R6NA 4YIOA 3C90A 3SJCC 1Y74B 2QM8A 2YXLA 3A0BZ 5B1AC 3OR7C 3E8GA 3CXHF 1XHZA 1JFFB 1ENVA 4DR5B 3FFQA 1EN6A 1VQPV 3B77A 5CA0B 3OEHG 5K1PA 4DV7O 4DV3O 5H2FZ 1ZAUA 5LGNA 2X7RB 2OCHA 2BOBC 2BTQA 1ZTEA 4B3SO 4RQFA 2E3CA 4PA6A 3D3IA 3WFVA 1U97A 4KXRA 2Q0OC 3RVZA 1YTFD 1P7BA 2JGDB 5BMVA 2Q8VA 1ZL8B 1FFXA 1AI4A 3JD0A 4O4LB 4TWKA 2QWPB 2XAHA 2KG7A 4DRXB 2IJIA 4JYAB 3ZS8C 1PL4A 4RQEA 2EZPA 1B04A 5TISZ 2E5LB 3CE2A 1IURA 3OD4A 1W2BU 2VQEB 1I94B 2F93B 3ABMB 5CA1B 1YEWA 3APQA 2L6LA 1YZBA 4FLYA 4UCSA 3S3WA 4PJ0Z 3JCUZ 3CS5A 3WG7B 1V55C 3VQVA 2PI5A 3ZHSA 2WA4A 3OEEG 1P7GA 1R1BA 1ORQC 1E1QG 2JK5C 4IYHA 5KHHA 1EN4A 2QM4A 1XMOO 2CTRA 5LP6A 2AW9A 4LF6O 3NXSA 3RYCB 3JD2A 1XL4A 2YIDA 1GAXA 5LHIA 4NXNB 4NR1A 2DWDC 1GO3F 3LNMB 2M7WA 4H0LB 2F23A 5GTIZ 2AGAA 3ZHTA 3HKBA 1JMKC 4NTWA 4ZHQB 3OFNG 5LHHA 5JJJB 4DV2O 2XHBA 3JAWB 4QPJA 3OR6C 3JASB 4D6TH 1P84F 4L8JA 1BMFG 2CTPA 5A9GA 1TA8A 4DR6O 4FLXA 4JV5B 4UCRA 3UO3A 1XI1A 1MMMA 2EJRA 1IJGA 1EM1A 4I9QA 1Y74A 4I7ZB 2R9AA 1AP5A 5ITZB 2UXBO 2P4VA 3KCXA 1JFFA 3M99B 3VOUA 3ASOC 2P06A 1IBMB 1JVMA 4QNHB 3I55V 4KHPO 3J80N 2IU3A 4FLUA 5CA0A 2YEVB 2P5OA 2H3OA 1SRYA 3ETGA 2WLNA 3WB1A 2RNBA 3CCQV 1AI6A 3MD0A 4FLZA 3CP1A 4QPKA 3RBZA 5FNVB 1OCRC 2V4DA 4DK1A 4B7KA 4CH3A 2QKAA 2JGDA 1ZL8A 1NT2B 4K3AA 4LNUB 4B3RB 3ZRXA 4O4LA 4CS4A 4JI6O 4DRXA 3CCMV 2IJJA 4RUEA 1QVFU 1SKVA 2Y0IA 1OJHA 4B3TO 3P30A 4DR2O 2QTSA 3W7WA 4CS3A 1HR0B 2B9ZA 3G67A 4FVMA 3OGCC 4PI2A 4YJ3B 5KHJA 4R6ZA 2R70A 4GUNA 1DLBA 1WB8A 4J9YB 4RWUA 2EIKB 3RYFB 3FB8C 5KUKA 1EFRG 1YDXA 2IU0A 2QA4V 1NTZH 2OTLV 1AJPA 2XASA 5J9PC 2HKOA 4O2AB 3M7MX 4LF8B 4I4TA 2DYRB 1XUQA 3RYCA 4G27B 5D5PA 1PD3A 1AJNA 2B5UA 1HNWB 2QWRB 2ZDIA 5GTHZ 5C8YB 1XDCA 1M57C 4CS2A 4ZHQA 3CC2V 2ZCEA 1WA8B 4O4IA 2IJHA 3RT3C 3AG4C 3P32A 3JAWA 3E22B 2LFSA 4X65O 3JASA 1VQKV 4AQYB 5D5QA 4IHJB 3K5OA 1BHAA 1YJWV 1M56C 1SQPH 4DUYB 3DTUB 1VQNV 4KUMA 1ZUQA 2NR5A 2HJFC 4XBFA 5B1NA 1YF2A 4C7UA 1NJIW 5ITZA 4JYCA 1K5QA 4N23A 4NKGB 2OCCB 3AK2A 2UU9B 1M4UA
chains in the Genus database with same CATH topology
3IC9A 1GN3A 4BR6A 1SZXA 1AP6A 3RN4A 1ZLZA 1XREA 4X9QA 3EVKA 1P7GA 3C3SA 1IX9A 3OT7A 1BS3A 1EN5A 3MDSA 1EN4A 1VARA 3KKYA 1MA1A 2AW9A 1GN4A 1MNGA 2P4KA 2QKCA 4YIPA 1AVMA 1IXBA 4GUNA 5AG2A 1WB8A 1I08A 1LUVA 1JA8A 1B06A 3DC6A 1D5NA 3C3TA 4YIOA 1BSMA 1BT8A 1WB7A 1QNMA 1AR5A 5A9GA 1IDSA 1EN6A 1N0NA 1XUQA 1PM9A 1MMMA 1GN6A 1MSDA 4F6EA 1ZSPA 3BFRA 4JZ2A 4JZGA 1EM1A 1I0HA 1XDCA 1ZTEA 1Y67A 1AP5A 1N0JA 2ADQB 4E4EA 3LSUA 1GN2A 1XILA 3TJTA 3KDRA 2GDSA 1AR4A 3K9SA 2CE4A 3QVNA 1ZUQA 2ADPA 2CDYA 3DC5A 4JYYA 1PL4A 1KKCA 3AK1A 3CEIA 2RCVA 1LUWA 1VEWA 4C7UA 3AK3A 2QKAA 3AK2A 4FFKA 1JR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC9 A;  1GN3 A;  4BR6 A;  1SZX A;  1AP6 A;  3RN4 A;  1ZLZ A;  1XRE A;  4X9Q A;  3EVK A;  1P7G A;  3C3S A;  1IX9 A;  3OT7 A;  1BS3 A;  1EN5 A;  3MDS A;  1EN4 A;  1VAR A;  3KKY A;  1MA1 A;  2AW9 A;  1GN4 A;  1MNG A;  2P4K A;  2QKC A;  4YIP A;  1AVM A;  1IXB A;  4GUN A;  5AG2 A;  1WB8 A;  1I08 A;  1LUV A;  1JA8 A;  1B06 A;  3DC6 A;  1D5N A;  3C3T A;  4YIO A;  1BSM A;  1BT8 A;  1WB7 A;  1QNM A;  1AR5 A;  5A9G A;  1IDS A;  1EN6 A;  1N0N A;  1XUQ A;  1PM9 A;  1MMM A;  1GN6 A;  1MSD A;  4F6E A;  1ZSP A;  3BFR A;  4JZ2 A;  4JZG A;  1EM1 A;  1I0H A;  1XDC A;  1ZTE A;  1Y67 A;  1AP5 A;  1N0J A;  2ADQ B;  4E4E A;  3LSU A;  1GN2 A;  1XIL A;  3TJT A;  2GDS A;  1AR4 A;  3K9S A;  2CE4 A;  3QVN A;  1ZUQ A;  2ADP A;  2CDY A;  3DC5 A;  4JYY A;  1PL4 A;  1KKC A;  3AK1 A;  3CEI A;  2RCV A;  1LUW A;  1VEW A;  4C7U A;  3AK3 A;  2QKA A;  3AK2 A;  4FFK A;  1JR9 A; 
#chains in the Genus database with same CATH topology
 4TQF A;  1DK1 A;  1SZX A;  1N34 B;  2WAM A;  2YEV A;  4RO2 A;  4NXM O;  4GKJ O;  2JS5 A;  1Q86 W;  4JTA B;  1Q8I A;  1N36 B;  3CC7 V;  3MHS C;  3OUF A;  3K3W A;  2ZIO A;  1EN5 A;  3ABL B;  2X6C A;  2QR4 A;  5FNV A;  3N27 A;  4UCU A;  2LW7 A;  1QQC A;  4JI3 O;  2DYS B;  3PJS K;  2JDI G;  4QGP A;  2PTM A;  1D5A A;  1FD9 A;  4UVC A;  2GSM B;  4LNU A;  4BW9 A;  3JYC A;  4WF9 V;  3C3T A;  1BGY H;  2BTO A;  1YSC A;  4UVA A;  3FD9 A;  3ETE A;  3A0R A;  2ZIN A;  1NTK H;  4YJ3 A;  4O2B B;  1QVG U;  1S76 D;  3CC4 V;  1M5I A;  4O4J B;  2HP8 A;  4DR3 O;  4FM2 A;  5H6R A;  1HDJ A;  3RYF A;  5IYB O;  1WPB A;  5B3S B;  1IVS A;  1IBL B;  2B1G A;  2ETN A;  4HAM A;  5L3F A;  3ZJZ A;  4O2A A;  3TJT A;  1OCC B;  1M1K W;  2KQX A;  2V1D A;  1Q7Y W;  3SPG A;  3STL C;  4DV0 B;  3SYQ A;  5BR8 O;  2ATK C;  4HZ3 A;  3CSX A;  3JAR A;  1XMQ B;  1GH6 A;  4DUZ B;  1WA8 A;  4PDR A;  4BAY A;  1ZWI C;  4MVS A;  3I56 V;  1G6U A;  2DOS A;  3E22 A;  4B3M B;  3SR2 C;  2Q69 A;  3QO8 A;  3L9D A;  4IHJ A;  1PV0 A;  1G8M A;  4DR5 O;  2ZQM A;  2IH1 C;  3RYI B;  2NLJ C;  3H1H H;  3IAY A;  3LNN A;  5EYP B;  3K5N A;  2LP7 A;  1VIB A;  2WPD G;  5IY5 C;  4LFC O;  5H6Q A;  1WAZ A;  3AG1 B;  3T2M A;  3SJA C;  3ZRW B;  2C2A A;  1NVP B;  1F23 A;  3FYE B;  2CK3 G;  4JAV A;  2PUS A;  3KG2 A;  1XNQ B;  4E2L A;  4QIW F;  4UV9 A;  4JYA O;  5IYC O;  2V7Q G;  4Q6G A;  1CXZ B;  2E5L O;  4OPA A;  3RFR A;  1IBK B;  4X1Y B;  1FJG B;  2DE0 X;  2IW5 A;  3B8N A;  2BTQ B;  3BFR A;  4JZG A;  2UUB B;  5LOV B;  1RPR A;  2Z5U A;  2VQE O;  4J80 A;  1I94 O;  1QR8 A;  3JAM N;  2QWQ B;  4J7Z A;  1R6T A;  4B08 A;  4UUJ C;  5L3E A;  4O2B A;  5JH7 B;  2EIL C;  4UCO A;  2RJZ A;  1AR4 A;  2WLI B;  3AG2 B;  1HWY A;  3TXS A;  3J7A U;  2ADP A;  3ASN B;  5F2V O;  3B8M A;  3ZMS A;  2YIB D;  2H8P C;  1F4M A;  2EIN C;  2LGW A;  3LDC A;  4ZIB A;  4R7C A;  3ZIA G;  3F7Y C;  1OCO B;  1FYJ A;  3FB5 C;  3ABK B;  1VQ8 V;  1VQ7 V;  1KMI Z;  4EB6 B;  1AP6 A;  3UT5 B;  2WA3 A;  4TOI A;  5B1B B;  2QWO B;  4JI4 B;  4NVP A;  3CPW U;  4NTY A;  4JV5 O;  4JGS A;  2R9I A;  2E75 B;  5E79 Z;  4P2Z A;  2WLL B;  2Q9L A;  2A9H A;  5J2T B;  2OYQ A;  1CP9 A;  1MA1 A;  3T1Y B;  3CRR A;  2P4K A;  3ZHR A;  2LJ2 A;  4FPP A;  2QM7 A;  2A7W A;  1I08 A;  3BAB A;  3U0Z A;  5IT9 N;  1WP7 A;  5HFL A;  1TVK B;  2D3O W;  4DR4 B;  4ZBM A;  4LF9 B;  4D7T A;  4TV9 B;  2RQ6 A;  1CEZ A;  4JTC B;  3RYI A;  4K0K B;  4DV4 B;  2UXX A;  5EYP A;  1R3L C;  2X6B A;  1IXM A;  5K1X A;  1N8R W;  4IYI A;  4EKW A;  4J7K A;  4F4L A;  1QLN A;  2YC0 A;  1PM9 A;  2XAF A;  1KQS U;  1PKX A;  1SC5 B;  2BOC C;  1OCZ C;  4JI8 B;  1WN7 A;  2UXC B;  3ZRW A;  4MTG A;  3RYH B;  1SQF A;  4B7E A;  3JCZ A;  4LFB O;  4B3R O;  1YJ9 V;  3RVY A;  2JEX A;  1V54 B;  2KKW A;  5IYZ B;  1X59 A;  1SQG A;  5JVD B;  1ROP A;  1DTO A;  1MG1 A;  1HR0 O;  3ZRS A;  3BVO A;  1MSW D;  4X1Y A;  3AEI A;  4DXW A;  3D3Q A;  4FLW A;  3HPL C;  5BXZ A;  1Y66 A;  5LOV A;  4P9O A;  4GX1 A;  2A79 B;  3CEI A;  3CCR V;  1OV9 A;  1Q81 W;  4FFK A;  2F66 C;  4LF7 B;  2DJV A;  1NH2 B;  5JH7 A;  5JCO C;  2YS8 A;  4NTX A;  4WFF A;  2WLI A;  1BHB A;  4LF4 B;  1FS0 G;  4K35 A;  2VQF B;  1KKD A;  3D36 A;  1JPX A;  4DV1 O;  2BCC H;  4U3J B;  4J7J A;  1AIL A;  5A2Q N;  3VQW A;  1A32 A;  1HNW O;  5FL7 G;  3G80 A;  4H33 A;  1L0N H;  3W7T A;  5H5N A;  1FXK C;  4EB6 A;  3UT5 A;  2JJ2 G;  1BSM A;  3GB7 C;  1N33 B;  3QTC A;  4LF5 B;  3FX7 A;  1H2K A;  2QEX V;  3E35 A;  2YXY A;  4DUY O;  1Q6H A;  4H44 B;  4NB5 A;  2WLL A;  4I4T B;  5J2T A;  1XQ8 A;  5KAF Z;  4ICG A;  5CMU A;  2KB1 A;  1H2M A;  2WWW A;  4CC5 A;  5JQG A;  1KEC A;  1K5S A;  1MSD A;  3B40 A;  4FZ1 A;  1TVK A;  3HKD A;  4JF3 A;  2EIJ C;  1YJN V;  1RFY A;  3OMI B;  3E89 A;  1RSO B;  1QLE B;  2Y4U A;  4TV9 A;  4O4I B;  4DW1 A;  1N34 O;  3IC7 A;  4CH4 A;  2YSU B;  4A5U B;  4DR7 B;  2FKX A;  2LQT A;  1N36 O;  1NVP D;  5DEC A;  2CH7 B;  2ZIM A;  2BE3 A;  1BQ0 A;  3K9S A;  4ASU G;  3SDL A;  2ZXW C;  4TUY B;  3LSQ A;  1US6 A;  2P6J A;  1O9G A;  4X8A A;  4JI5 B;  3T1H B;  4TQD A;  2F95 B;  3ABT A;  2HHH O;  3RYH A;  2CGO A;  1E1R G;  2P67 A;  4FK5 C;  3CCU V;  2VRZ A;  3NR7 A;  5DED A;  3T4D A;  1VP7 A;  5DN6 G;  3X2Q C;  4W4L A;  1VF7 A;  1VF5 B;  4NYK A;  4X20 A;  5IYZ A;  5JVD A;  2XAQ A;  4YY3 B;  1YIT V;  4KFM A;  3FKS G;  3SJB C;  2ZR3 A;  1ZLZ A;  4EFE A;  3H1I H;  2OTJ V;  3AG3 B;  1W0K G;  2EIM C;  3OMA B;  1K7D A;  2GTS A;  3KKY A;  4D7S A;  4HBN A;  2Z3Y A;  4YHH B;  1IXB A;  2Q68 A;  4JI1 B;  2HJD A;  1VF6 C;  5LP6 C;  3OTO B;  3A0H Z;  2FB5 A;  1X4T A;  2FYU H;  3K0D A;  3KCY A;  3LDE A;  5KA5 A;  3K08 A;  3ZCC A;  3GVM A;  4DV0 O;  1XBL A;  2G38 A;  4U3J A;  1XMQ O;  4ZI7 A;  1IDS A;  3ZMZ A;  3WB2 A;  4DUZ O;  1SA0 B;  2GV9 A;  2NNU A;  3G6E V;  3CB2 A;  4JZ2 A;  2VS0 A;  4B3M O;  4HYO A;  1H38 A;  2Y4T A;  3T1C A;  2P90 A;  1JQ0 A;  2IJK A;  2JGU A;  1RM1 B;  1JJ2 U;  1GMG A;  5J2U B;  1GN2 A;  3HKC B;  1FKA O;  5EBW C;  3KDR A;  3ICX A;  4FJC C;  1M93 A;  2EX3 A;  5EBL C;  3EXA A;  4TV8 B;  3CD6 V;  2HR3 A;  5KHI A;  3JAR B;  2W0F C;  4PI0 A;  4WFA V;  4MT8 A;  3ZRV A;  3DC5 A;  3BHP A;  1BL8 A;  3H01 A;  1FAF A;  3BA8 A;  4BIO A;  1RSO A;  3HR0 A;  4X62 O;  2JIZ G;  1KKC A;  1NQT A;  3HKE B;  1R73 A;  3CXC U;  5BY1 A;  5IE9 A;  1FPO A;  3F5W C;  3UO2 A;  4UCT A;  2CH7 A;  3CRC A;  2UUC O;  4JI2 O;  1HNX B;  2CTQ A;  4TUY A;  1OHH G;  3QO7 A;  2KSD A;  2A3Q A;  2Q4P A;  1IBK O;  1FJG O;  2CAZ C;  3P3N A;  2UUB O;  3BEH A;  1TUE B;  2DMX A;  2Q0A A;  3BY6 A;  2WSS G;  5KHK A;  4JI0 B;  1Q5O A;  5LXT B;  4DV5 B;  1NBM G;  1S77 D;  4PA4 A;  1NH2 D;  3OW2 U;  5KA6 A;  3ABM C;  3K58 A;  4WFB V;  2PY5 A;  1VMG A;  1NI8 A;  4LP8 A;  3T4Z A;  2EZO A;  1WLE A;  3WG7 C;  1VQ5 V;  1K9M W;  2D2C B;  4GX0 A;  1Z5W A;  1UPG A;  3P3P A;  1SQQ H;  2VWK A;  3M8A A;  2QSA A;  3CRM A;  1JJO A;  4LC1 A;  2EJ7 A;  4BIU A;  2ODM A;  2RMK B;  1K34 A;  1KU9 A;  3CCL V;  2DQ0 A;  4JI4 O;  1Y4M A;  1G4Y B;  3H1K H;  4UV8 A;  4JAU A;  1RPO A;  2ZKO A;  1S72 V;  5GON B;  2Y69 B;  4IT5 A;  1SA0 A;  4OGQ B;  4GKK B;  4Z1V A;  2CE4 A;  5BZB A;  3T1Y O;  3G6B A;  2AHZ A;  2FL4 A;  5FPR A;  4JYY A;  1Z5V A;  2ZM6 B;  3ZMT A;  2X6A A;  4DR4 O;  5FPO A;  1I7F A;  3F5T A;  5B1A B;  4LF9 O;  5J2U A;  3ZMU A;  3HKC A;  4HNA B;  1Q3E A;  3CX5 F;  2AZ0 A;  3TXQ A;  2HLD G;  3EFF K;  4TV8 A;  1MZF A;  4DV4 O;  2Q7G A;  3CRQ A;  4X9Q A;  2Y48 A;  1MZE A;  2RDC A;  3E83 A;  3IFX A;  1G1X B;  2B1I A;  2Q67 A;  4WBN B;  1Z2G A;  2QTO A;  2F43 G;  5EC1 C;  4QJF B;  3HKE A;  1YI2 V;  4JI8 O;  5CN0 A;  1S5J A;  1QU7 A;  2JJ1 G;  4WFH A;  5GW7 A;  1H5W A;  5CBH A;  2UXN A;  1T5E A;  2Q7E A;  3B09 A;  1BQZ A;  3E8F A;  4UXN A;  2ZE6 A;  3N2K B;  1QR9 A;  4CH5 A;  3U11 A;  1KP3 A;  4BWA A;  2XT9 A;  2N05 A;  1W0J G;  1J5E B;  1GN6 A;  2E76 B;  2XAJ A;  2HG5 C;  1COW G;  5LXT A;  5C93 A;  4X1K A;  3STZ C;  4LF7 O;  4GYC B;  5LMN B;  3RW0 A;  2QJ1 A;  2EIK C;  1N0J A;  2P7T C;  1H8E G;  2ADQ B;  4UFZ A;  4E4E A;  1V55 B;  4LF4 O;  4GX5 A;  2DWE C;  2VQF O;  1YXB A;  3VQY A;  1P4R A;  3L74 H;  4X1I B;  4LFA B;  4ZKI A;  3QVN A;  1QCE A;  5L3G A;  3E8B A;  1KYO F;  2DYR C;  1KD1 W;  5LGU A;  1S5H C;  1EZV H;  2PZS A;  5JWP A;  4GX2 A;  5LYJ B;  2R72 A;  1N33 O;  4H37 A;  1HP8 A;  3W7S A;  4LF5 O;  5L3D A;  4QE9 A;  1ARO P;  1YCI A;  5GON A;  3R65 A;  1B6Q A;  1R3K C;  3JSN A;  2UUA B;  5EIB D;  3SYP A;  4JTD B;  4NXN O;  4Q20 A;  4QE7 A;  5B5E Z;  1SQX H;  2W6J G;  4G2K A;  3CCE V;  1K33 A;  1LUV A;  2OIG A;  4HNA A;  4IIJ A;  3FB6 C;  3CJH A;  4K8Z A;  5EC2 C;  2CUG A;  3ASO B;  4ABM A;  4GLX A;  5IWA B;  1XL6 A;  2OCC C;  2YI8 A;  1WB7 A;  2OT5 A;  1JNB A;  1N32 B;  4WBN A;  1NZ6 A;  4P30 A;  4CZZ A;  4H13 B;  4JI5 O;  4TT3 G;  5L3C A;  3T1H O;  3JD1 A;  1OCR B;  5JQG B;  1F4N A;  2IH3 C;  3ABL C;  4F6E A;  1D2D A;  3HKD B;  3K79 A;  4OX9 B;  2WLJ A;  2DYS C;  1IBM O;  4FLV A;  1SS3 A;  3SJQ C;  4YJ2 B;  4YY3 O;  2CGN A;  4XDJ A;  4FM1 A;  2XND G;  3LSU A;  3N2K A;  4JI7 B;  1I5Y A;  1HNZ B;  1L1F A;  4X66 B;  3VBB A;  5LGT A;  3VQX A;  4YHH O;  3CRA A;  5LA6 B;  4N21 A;  3JAK B;  2PYL A;  5BR8 B;  1VEW A;  3OTO O;  3UKM A;  3AK3 A;  4X20 B;  3SYA A;  4P9P A;  3IJ4 A;  5B3S C;  1YIJ V;  3DXR B;  3ZED A;  3A8T A;  3IC9 A;  3JAT B;  5DM6 V;  1GN3 A;  4UB8 Z;  4IL6 Z;  1GKF A;  2BSK A;  1XRE A;  3QNE A;  4X1I A;  4RUF A;  4U7N A;  2ZNJ A;  1AI7 A;  2Q73 A;  1IZ3 A;  1Q43 A;  1OCC C;  1WPX A;  2EUL A;  1FOU A;  1CPY A;  3K04 A;  3GWO A;  3MDS A;  1VAR A;  5CA3 A;  1S0V A;  4DW0 A;  4F6R B;  4FFB B;  1GN4 A;  1M57 B;  5LYJ A;  1PNK A;  3K59 A;  2FTK A;  1QBZ A;  1RP3 B;  4MS2 A;  2JEU A;  1AJQ A;  2H94 A;  4PHZ A;  3AG4 B;  4LFC B;  3D8C A;  1PL0 A;  4LF8 O;  2JS3 A;  4JYB A;  5JJE B;  1QHT A;  5EK0 A;  4WFE A;  2ZE7 A;  2Q7H A;  1XOU A;  2QE7 G;  4JAA A;  3K5L A;  1M56 B;  3MHH C;  4UCV A;  4ZI7 B;  1AR5 A;  3UM7 A;  3ETQ A;  2OWO A;  3OTF A;  4WCE V;  5B1O A;  2X0L A;  5KX5 B;  1H2S B;  4DV6 B;  2LO1 A;  2ILM A;  4LH6 A;  3DSQ A;  2DQ3 A;  1R3I C;  3CYO A;  5EBM C;  5LMU B;  1VQM V;  1ZSP A;  4PA9 A;  3EHB B;  4MVM A;  3ETD A;  4CC6 A;  3JD3 A;  4AQY O;  4GZR B;  4MVO A;  3AG1 C;  4X88 A;  3K5M A;  1XNR B;  2YIC A;  5KHG A;  3SPC A;  4UB6 Z;  1HNX O;  3I5D A;  4MW3 A;  4PA7 A;  4BW5 A;  2GDS A;  3CME V;  4FM0 A;  2ZT9 B;  5IJ0 B;  2UU9 O;  5CB4 A;  3K03 A;  3ML0 A;  4JI0 O;  2QGN A;  1NR7 A;  3CCS V;  4YJ2 A;  1VF6 A;  2UXD B;  4DV5 O;  3J81 N;  1BCC H;  1DGS A;  3E2E A;  2LW1 A;  2A06 H;  3SPI A;  3K06 A;  2DN9 A;  3IGA C;  4UVB A;  2YI9 A;  4G28 B;  4ZOL A;  1Q6U A;  5E1A C;  2PI4 A;  2YDE A;  3WU2 Z;  1Y76 B;  3R66 A;  3UCS C;  2L35 A;  3OUS A;  2GUZ B;  1Q82 W;  1R6K A;  3K0G A;  5LA6 A;  5IYD O;  3ZX6 A;  4J9Z B;  3JAK A;  3LDD A;  3AG2 C;  1MNG A;  4BIZ A;  1L0L H;  1K3E A;  3N2G B;  3ASN C;  3D36 C;  4DK0 A;  4YIP A;  3ZN1 A;  1ZX3 A;  3DXR A;  1VQL V;  4K8X A;  3JAT A;  3DC6 A;  4FZ0 A;  1W59 A;  1BT8 A;  4GT1 A;  4X64 B;  1OCO C;  3ABK C;  2EBO A;  4GCZ A;  1XEQ A;  5KLV H;  2HFE C;  4XDL A;  1Y6X A;  5B1B C;  4GKK O;  1B3Q A;  4PA3 A;  4MW8 A;  1GM9 A;  1SZT A;  1I5X A;  4KP4 A;  4F6R A;  4Z2W A;  4FFB A;  2ZR2 A;  3OE7 G;  1IBL O;  1K97 A;  4W4K A;  2ZM6 O;  4EEQ A;  2ZNI A;  2N04 A;  1UJW B;  2XAG A;  4DR1 B;  5IJ9 B;  5LHG A;  1MOF A;  1I0H A;  2F4V B;  3B4S A;  4LCU C;  1NU1 H;  4I9W A;  1JX9 A;  3FYI B;  1FFT B;  1AB3 A;  1LNQ A;  4LFB B;  2A0L A;  1H8H G;  2HVJ C;  5KX5 A;  1SET A;  1K92 A;  2ITC C;  4FMT A;  1KP2 A;  5IY5 B;  1TGO A;  2YXH A;  2W0X A;  1H2L A;  4R50 A;  2GTA A;  4DV7 B;  2GBO A;  2F1M A;  4DV3 B;  2JVD A;  1SF9 A;  2AZ2 A;  1P49 A;  2P22 C;  1EBO A;  5KMG B;  4PD4 F;  4PEL A;  3OGI B;  4B3S B;  3B2E E;  3LUT B;  1R3J C;  4MVZ A;  2Q5Z A;  3SGI A;  5CA1 A;  1E79 G;  3ZHU A;  1V54 C;  3S3X A;  5IJ0 A;  1GK9 A;  4KL1 A;  1PNL A;  3H9V A;  1VQO V;  3OT7 A;  3DGE A;  3PN1 A;  1BS3 A;  1J5E O;  2E74 B;  3Q4H B;  1H2N A;  1SQV H;  3W7U A;  5L3B A;  4DV1 B;  5AG2 A;  3JD4 A;  5LMN O;  3SYO A;  1JA8 A;  5EZY B;  1F51 A;  1XNQ O;  4AIL C;  1D5N A;  1TAE A;  1PNM A;  1TUB B;  4I0X B;  1Y76 A;  4MVR A;  1DF4 A;  2EIL B;  2GUZ A;  1WP8 A;  4LWS B;  4LFA O;  4R8C A;  1U96 A;  3THO A;  1BE3 H;  3N2G A;  4I55 B;  2ITD C;  4TSF G;  2EIN B;  1SQB H;  2PYJ A;  1XMO B;  3ZBH A;  1SER A;  4LF6 B;  2QDO A;  3L72 H;  3RGB A;  2MW2 B;  4X1K B;  3CMA V;  2RN9 A;  4X89 A;  3OAA G;  3ZN0 A;  3BPZ A;  3E8H A;  3K9A A;  3QG5 A;  4FIP C;  1OZ0 A;  5CBG A;  2PF4 E;  4OPH A;  3L73 H;  1XIL A;  3E86 A;  2UUA O;  1GRJ A;  3QO5 A;  4DV2 B;  2ARH A;  1K73 W;  3HB3 B;  4YXW G;  3F7V C;  2CDY A;  4DR6 B;  4MTF A;  5KUM A;  5IJ9 A;  3OM3 B;  2M6Y A;  3ZHQ A;  2RCV A;  5LL6 Y;  2QWN B;  2ZDI C;  5IWA O;  2HHH B;  1FXV A;  1QLE C;  1AI5 A;  4OXS A;  3BRC A;  3H1J H;  2UXB B;  3RN4 A;  3TGU H;  1N32 O;  4MTX A;  1JCH A;  2DW4 A;  4KHP B;  3CCV V;  1IX9 A;  1SES A;  1OCZ B;  4OX9 O;  4JAS A;  2WLM A;  3TCU A;  2MK3 A;  5KMG A;  2IM9 A;  4MTO A;  3SPJ A;  4IIJ B;  1EZJ A;  3CJH B;  1K8A W;  4K0K O;  1DF5 A;  4MVQ A;  1B06 A;  4I50 B;  4LR3 A;  4EFB A;  3L70 H;  1YTF B;  5LBQ A;  3KZI Z;  5IDJ A;  2WLK A;  3ABU A;  2XTA A;  1J95 A;  4JI7 O;  3JAL B;  2O57 A;  4JI6 B;  1HNZ O;  4U3F H;  3Q4H A;  3BCC H;  2UXC O;  1V9P A;  4X66 O;  2LGQ A;  3AG3 C;  4J41 A;  2HEP A;  4B3T B;  2Y0P A;  1L8D A;  2CTW A;  4LBE C;  4DR2 B;  2YIB A;  5JJN B;  5EZY A;  1UFI A;  1NTM H;  1TUB A;  4I0X A;  5C8Y A;  3GWK C;  1GM7 A;  4J10 A;  3FB7 C;  5KAI Z;  1K4C C;  1WNS A;  4LWS A;  4I5S A;  3L75 H;  1YHQ V;  4O4H B;  2N74 A;  2NN4 A;  3L71 H;  1PPJ H;  4I55 A;  4PDM A;  2AHY A;  2Q6A A;  1F7Y A;  3A2F A;  3ZHV A;  3O9O A;  1Q90 D;  4PDV A;  4RAI A;  1VQ6 V;  1H2G A;  1FXK B;  2YUA A;  3CHX A;  2JRI A;  2WLH A;  1KB9 F;  1PP9 H;  4L87 A;  2Z0A A;  4X62 B;  3FAV B;  2BSK B;  1WJZ A;  3BA9 A;  4X65 B;  1RM1 C;  1M9N A;  3EVK A;  1S5L Z;  1XHX A;  4DV6 O;  2K1E A;  3K57 A;  5EIB C;  2IBZ H;  4LH7 A;  5LMU O;  2ZD9 A;  2UUC B;  4JI2 B;  2EIJ B;  3CWB H;  1S3J A;  2QKC A;  1AVM A;  3TET A;  1O9H A;  4JPR A;  2AXT Z;  1XNR O;  1NS1 A;  2ZE5 A;  1M90 W;  1NR1 A;  1NKD A;  3UQ8 A;  4WFG A;  1GTO A;  4U7O A;  4AI8 A;  1URF A;  1QNM A;  1GM8 A;  2ZXW B;  3RWR D;  5BMV B;  1FFX B;  4NXM B;  4GKJ B;  1K4D C;  5FLX N;  1N0N A;  2KG7 B;  1KC8 W;  3AG7 A;  3CCJ V;  1N4C A;  4O4J A;  2K9P A;  3JSL A;  3X2Q B;  2UXD O;  4DR7 O;  4JI3 B;  4I50 A;  3MAQ A;  4MVU A;  1Y67 A;  1KBH A;  3APO A;  3TK1 A;  3JAL A;  3O65 A;  5CBF A;  1MAB G;  2ZE8 A;  4PV1 B;  2EIM B;  2YIA A;  2R9R B;  1VQ4 V;  2HVK C;  2OIE A;  5B66 Z;  5HFM A;  2QKS A;  1BZK A;  4DYL A;  5CB4 B;  2GHY A;  2XUM A;  4Z1M G;  2PGG A;  3AK1 A;  1VQ9 V;  4DR3 B;  1LUW A;  5LP6 B;  4IGG A;  1KUQ A;  3LSS A;  5JCO A;  4CH6 A;  3U10 A;  3QF7 A;  2LFR A;  4X64 O;  3OMN B;  2VWJ A;  1JR9 A;  3SPH A;  3ZMV A;  4AHC A;  4O4H A;  3W7X A;  4BR6 A;  4DO2 A;  4ZOL B;  1LR1 A;  3H1L H;  4XDK A;  3HKB B;  1HW7 A;  4J11 A;  3G71 V;  2W6I G;  1Q6I A;  3C3S A;  4PDL A;  3SYC A;  2XOK G;  4MSW C;  3BAA A;  2Y69 C;  1JOY A;  1THZ A;  4JI1 O;  5H9C A;  1FXK A;  4DR1 O;  1AR1 B;  2F4V O;  1FXH A;  2FML A;  3G4S V;  4FLT A;  3WB0 A;  1YVW A;  3FAV A;  4CBC A;  4J42 A;  1R6N A;  4YIO A;  3C90 A;  3SJC C;  1Y74 B;  2QM8 A;  2YXL A;  3A0B Z;  5B1A C;  3OR7 C;  3E8G A;  3CXH F;  1XHZ A;  1JFF B;  1ENV A;  4DR5 B;  3FFQ A;  1EN6 A;  1VQP V;  3B77 A;  5CA0 B;  3OEH G;  5K1P A;  4DV7 O;  4DV3 O;  5H2F Z;  1ZAU A;  5LGN A;  2X7R B;  2OCH A;  2BOB C;  2BTQ A;  1ZTE A;  4B3S O;  4RQF A;  2E3C A;  4PA6 A;  3D3I A;  3WFV A;  1U97 A;  4KXR A;  2Q0O C;  3RVZ A;  1YTF D;  1P7B A;  2JGD B;  5BMV A;  2Q8V A;  1ZL8 B;  1FFX A;  1AI4 A;  3JD0 A;  4O4L B;  4TWK A;  2QWP B;  2XAH A;  2KG7 A;  4DRX B;  2IJI A;  4JYA B;  3ZS8 C;  1PL4 A;  4RQE A;  2EZP A;  1B04 A;  5TIS Z;  2E5L B;  3CE2 A;  1IUR A;  3OD4 A;  1W2B U;  2VQE B;  1I94 B;  2F93 B;  3ABM B;  5CA1 B;  1YEW A;  3APQ A;  2L6L A;  1YZB A;  4FLY A;  4UCS A;  3S3W A;  4PJ0 Z;  3JCU Z;  3CS5 A;  3WG7 B;  1V55 C;  3VQV A;  2PI5 A;  3ZHS A;  2WA4 A;  3OEE G;  1P7G A;  1R1B A;  1ORQ C;  1E1Q G;  2JK5 C;  4IYH A;  5KHH A;  1EN4 A;  2QM4 A;  1XMO O;  2CTR A;  5LP6 A;  2AW9 A;  4LF6 O;  3NXS A;  3RYC B;  3JD2 A;  1XL4 A;  2YID A;  1GAX A;  5LHI A;  4NXN B;  4NR1 A;  2DWD C;  1GO3 F;  3LNM B;  2M7W A;  4H0L B;  2F23 A;  5GTI Z;  2AGA A;  3ZHT A;  3HKB A;  1JMK C;  4NTW A;  4ZHQ B;  3OFN G;  5LHH A;  5JJJ B;  4DV2 O;  2XHB A;  3JAW B;  4QPJ A;  3OR6 C;  3JAS B;  4D6T H;  1P84 F;  4L8J A;  1BMF G;  2CTP A;  5A9G A;  1TA8 A;  4DR6 O;  4FLX A;  4JV5 B;  4UCR A;  3UO3 A;  1XI1 A;  1MMM A;  2EJR A;  1IJG A;  1EM1 A;  4I9Q A;  1Y74 A;  4I7Z B;  2R9A A;  1AP5 A;  5ITZ B;  2UXB O;  2P4V A;  3KCX A;  1JFF A;  3M99 B;  3VOU A;  3ASO C;  2P06 A;  1IBM B;  1JVM A;  4QNH B;  3I55 V;  4KHP O;  3J80 N;  2IU3 A;  4FLU A;  5CA0 A;  2YEV B;  2P5O A;  2H3O A;  1SRY A;  3ETG A;  2WLN A;  3WB1 A;  2RNB A;  3CCQ V;  1AI6 A;  3MD0 A;  4FLZ A;  3CP1 A;  4QPK A;  3RBZ A;  5FNV B;  1OCR C;  2V4D A;  4DK1 A;  4B7K A;  4CH3 A;  2QKA A;  2JGD A;  1ZL8 A;  1NT2 B;  4K3A A;  4LNU B;  4B3R B;  3ZRX A;  4O4L A;  4CS4 A;  4JI6 O;  4DRX A;  3CCM V;  2IJJ A;  4RUE A;  1QVF U;  1SKV A;  2Y0I A;  1OJH A;  4B3T O;  3P30 A;  4DR2 O;  2QTS A;  3W7W A;  4CS3 A;  1HR0 B;  2B9Z A;  3G67 A;  4FVM A;  3OGC C;  4PI2 A;  4YJ3 B;  5KHJ A;  4R6Z A;  2R70 A;  4GUN A;  1DLB A;  1WB8 A;  4J9Y B;  4RWU A;  2EIK B;  3RYF B;  3FB8 C;  5KUK A;  1EFR G;  1YDX A;  2IU0 A;  2QA4 V;  1NTZ H;  2OTL V;  1AJP A;  2XAS A;  5J9P C;  2HKO A;  4O2A B;  3M7M X;  4LF8 B;  4I4T A;  2DYR B;  1XUQ A;  3RYC A;  4G27 B;  5D5P A;  1PD3 A;  1AJN A;  2B5U A;  1HNW B;  2QWR B;  2ZDI A;  5GTH Z;  5C8Y B;  1XDC A;  1M57 C;  4CS2 A;  4ZHQ A;  3CC2 V;  2ZCE A;  1WA8 B;  4O4I A;  2IJH A;  3RT3 C;  3AG4 C;  3P32 A;  3JAW A;  3E22 B;  2LFS A;  4X65 O;  3JAS A;  1VQK V;  4AQY B;  5D5Q A;  4IHJ B;  3K5O A;  1BHA A;  1YJW V;  1M56 C;  1SQP H;  4DUY B;  3DTU B;  1VQN V;  4KUM A;  1ZUQ A;  2NR5 A;  2HJF C;  4XBF A;  5B1N A;  1YF2 A;  4C7U A;  1NJI W;  5ITZ A;  4JYC A;  1K5Q A;  4N23 A;  4NKG B;  2OCC B;  3AK2 A;  2UU9 B;  1M4U A; 
#chains in the Genus database with same CATH homology
 3IC9 A;  1GN3 A;  4BR6 A;  1SZX A;  1AP6 A;  3RN4 A;  1ZLZ A;  1XRE A;  4X9Q A;  3EVK A;  1P7G A;  3C3S A;  1IX9 A;  3OT7 A;  1BS3 A;  1EN5 A;  3MDS A;  1EN4 A;  1VAR A;  3KKY A;  1MA1 A;  2AW9 A;  1GN4 A;  1MNG A;  2P4K A;  2QKC A;  4YIP A;  1AVM A;  1IXB A;  4GUN A;  5AG2 A;  1WB8 A;  1I08 A;  1LUV A;  1JA8 A;  1B06 A;  3DC6 A;  1D5N A;  3C3T A;  4YIO A;  1BSM A;  1BT8 A;  1WB7 A;  1QNM A;  1AR5 A;  5A9G A;  1IDS A;  1EN6 A;  1N0N A;  1XUQ A;  1PM9 A;  1MMM A;  1GN6 A;  1MSD A;  4F6E A;  1ZSP A;  3BFR A;  4JZ2 A;  4JZG A;  1EM1 A;  1I0H A;  1XDC A;  1ZTE A;  1Y67 A;  1AP5 A;  1N0J A;  2ADQ B;  4E4E A;  3LSU A;  1GN2 A;  1XIL A;  3TJT A;  3KDR A;  2GDS A;  1AR4 A;  3K9S A;  2CE4 A;  3QVN A;  1ZUQ A;  2ADP A;  2CDY A;  3DC5 A;  4JYY A;  1PL4 A;  1KKC A;  3AK1 A;  3CEI A;  2RCV A;  1LUW A;  1VEW A;  4C7U A;  3AK3 A;  2QKA A;  3AK2 A;  4FFK A;  1JR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...