1QNMA

Human manganese superoxide dismutase mutant q143n
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNNDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Probing the active site of human manganese superoxide dismutase: the role of glutamine 143.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 69
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1qnmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1qnmA02
1KKCA 3KKYA 1WB8A 2RCVA 1XREA 1XUQA 4BR6A 1P7GA 1EM1A 1VEWA 1AP5A 1LUWA 2AW9A 5A9GA 3EVKA 3DC6A 3C3SA 1LUVA 4JYYA 2ADQB 1IDSA 1MMMA 1EN4A 3AK2A 3IC9A 1GN4A 1GN3A 1IX9A 4F6EA 1JA8A 1AVMA 2QKAA 4JZGA 1EN6A 1N0JA 3AK1A 1XDCA 2QKCA 3C3TA 4GUNA 1MSDA 1AR5A 3DC5A 1JR9A 1AR4A 1ZLZA 1PM9A 2CE4A 2CDYA 3AK3A 3OT7A 1QNMA 4X9QA 1BT8A 1BSMA 3LSUA 1ZSPA 3TJTA 1ZUQA 2ADPA 1ZTEA 5AG2A 1Y67A 3QVNA 4E4EA 4YIPA 1EN5A 1XILA 4JZ2A 3CEIA 2P4KA 1I08A 1WB7A 1IXBA 1I0HA 1N0NA 1B06A 3MDSA 3BFRA 4YIOA 1BS3A 3K9SA 1MNGA 4FFKA 4C7UA 1PL4A 1VARA 2GDSA 1SZXA 1GN2A 1D5NA 3RN4A 1AP6A 1MA1A 1GN6A
chains in the Genus database with same CATH superfamily
4UV9A 3RFRA 3AG2C 2AGAA 3FB7C 2CUGA 1ZL8A 4ZOLB 4LF6B 1XREA 1FXKB 5LGTA 4KFMA 3ZMVA 5C93A 5B1AB 1Q5OA 4G2KA 3D8CA 1GKFA 4DV4B 3TXSA 4X1KA 5HFMA 3B2EE 1FFXB 2ATKC 4LFCO 2DOSA 2YIBA 4LF8B 1HNWB 1K92A 5KMGB 4J9ZB 2EIJB 5BY1A 3ZN0A 2ZXWB 2L35A 2P06A 3G6EV 1M93A 2A3QA 4ZKIA 2WSSG 3LNNA 4X64B 3IC7A 3W7XA 1RSOA 2WLIB 2BSKA 4TUYB 3ABTA 2LO1A 2X0LA 4UCOA 1KECA 4JTCB 4J7ZA 4KL1A 3WU2Z 3K0GA 4PELA 1B6QA 1YCIA 5B1OA 2Q9LA 1VP7A 2LJ2A 1K97A 3HKBA 2UXCB 3JD1A 4GT1A 4JTAB 4FIPC 1PPJH 3JARA 5BMVA 2JJ2G 3R65A 5CBHA 5FL7G 5A2QN 3KG2A 5B1BB 1NR1A 1L8DA 1IBKB 4WFBV 3ASNC 1YDXA 5IYZA 2P4KA 4RAIA 3K9AA 4JI3B 1MZEA 4LFAO 3BFRA 3E86A 2OTJV 1BL8A 2X6CA 4FLWA 3OTOB 3T4ZA 1HDJA 4YY3O 1FXKA 4MTXA 4O4LB 1SZXA 3ABLC 2A06H 1Z2GA 2YICA 3IJ4A 4JV5B 1D5AA 1N8RW 1QQCA 1FFXA 4DR1B 5L3GA 1P7GA 2FKXA 1PD3A 3FX7A 4JI0O 5KMGA 5LMNO 2V7QG 3AG1C 2RJZA 1I5XA 1N32O 2AXTZ 4JYYA 2EIKC 5KHIA 2JGDB 4DR6O 1JNBA 1H5WA 3CRAA 1IBLO 3K04A 2M7WA 2WLIA 1CEZA 4TUYA 5B66Z 4JF3A 3TK1A 2V1DA 2QKAA 3ZRXA 1GK9A 3OE7G 1HNZB 4GZRB 1IBMO 4DV0B 2QTOA 3L72H 4LFBO 3AG4B 3BCCH 1HNXO 1AR4A 4AQYB 3A0RA 1VQ9V 4JPRA 2X6BA 4X66O 3OR6C 4JI8O 2UXNA 3NR7A 4DR2B 4J9YB 2AHZA 2IJKA 3SYPA 1DF4A 1SQXH 3DXRB 4CH4A 2EJ7A 2NR5A 1Q86W 3SYOA 4JI1B 4TV8B 1Q81W 3NXSA 3JAWB 2UUBB 1PKXA 2Y4UA 2ZE8A 3QO5A 1K7DA 2BE3A 2ZD9A 5CA0B 1KD1W 4O4LA 4X62B 4DW0A 2IH3C 4DR7B 2DYSC 1NS1A 1GRJA 4I50B 3OM3B 4KHPB 2PGGA 2PF4E 2ZKOA 2QWRB 2Q7HA 1TA8A 2GDSA 4AI8A 3M8AA 1XMOB 1F7YA 3K5MA 3ZMZA 3KDRA 3J80N 3L9DA 4JI4O 3A0HZ 1XUQA 2JGDA 1N34O 4GCZA 4FMTA 1AB3A 3B8MA 4U7NA 2QTSA 5EBWC 1YSCA 4D6TH 2JS3A 4PA9A 4FM0A 2HFEC 3SJQC 3SGIA 1IJGA 4H33A 4JAUA 1WAZA 2YXYA 5CB4A 1GM7A 1MMMA 5FPOA 1JJOA 2EJRA 1VF6A 5EYPB 2D2CB 1EBOA 4FJCC 4JI7O 2WLHA 2CH7B 3CXHF 2DQ0A 4UV8A 3SDLA 3ZS8C 1AJNA 3CRQA 3CCSV 4OPHA 3U0ZA 1K73W 4LR3A 1SQBH 3DXRA 2CGNA 4PDMA 1IVSA 2BTOA 2D3OW 1GM9A 4TV8A 4KXRA 3JAWA 1W0KG 4GKJB 5DN6G 5CA0A 2PI5A 1SESA 4L87A 3ZHRA 1ZTEA 2VQFO 1FS0G 1SA0B 4BW9A 4I50A 1FXVA 1VF7A 3E2EA 2DN9A 3DGEA 1DTOA 4JASA 3ZRSA 4MTFA 3G71V 1K34A 4QE9A 5H6QA 3J7AU 2HP8A 1SQGA 4DXWA 1JX9A 4RQEA 4YIOA 2HJFC 1BS3A 1FJGB 1FXKC 1N33B 5EZYB 4PA3A 4LH6A 4B08A 3UO3A 5B3SB 4P2ZA 1QHTA 1FOUA 3FB6C 2XNDG 4WFFA 3CB2A 4CZZA 1MA1A 3ZIAG 4NTWA 1KQSU 4W4LA 1JJ2U 1XBLA 1HP8A 4F6RB 2EIJC 4I9WA 2ZXWC 5EYPA 2OIEA 1LUWA 2QA4V 1OCCB 5CA3A 3EVKA 3ZJZA 4LF4B 1K3EA 2Q69A 2CH7A 1LUVA 5IYCO 2XASA 3D3IA 4LF5O 2P7TC 2UXXA 3ASNB 3N2KB 4D7TA 3K57A 1GN4A 4J7JA 4DUZB 3B8NA 4J41A 4B3TB 5LHIA 1XNQO 3E83A 1OCOB 5J2TB 3VQXA 1EN6A 2DYRB 4MVQA 5EIBC 2F93B 5FLXN 2HG5C 2XT9A 3G4SV 2YIDA 3LSQA 1K9MW 1R6NA 3MHSC 1SA0A 1KBHA 1G8MA 3A8TA 4NTYA 4MVMA 3Q4HB 3C90A 2GV9A 4YHHO 4QPJA 5KA6A 2WLMA 3RGBA 3ZHUA 1BHAA 2UXBB 2YDEA 3JSLA 3HKCA 2IJJA 5LA6B 4UFZA 3U10A 2KG7A 3R66A 2PZSA 2ZE6A 1S5LZ 5LP6A 5EZYA 1EN5A 4DV6B 2DE0X 2F4VB 5JVDB 3SPIA 3VBBA 4PD4F 3T1CA 1BHBA 3K9SA 4NR1A 4P9OA 4JAVA 3SYCA 1Z5WA 4LF7O 2Y4TA 2HLDG 3VQVA 3HR0A 1UPGA 4DV1O 2IBZH 2HVJC 4O4JB 1W0JG 1TAEA 3N2GA 3N2KA 3ASOB 4ZI7B 3BRCA 1N36B 1AI4A 2GUZB 1HR0O 2IU0A 1AI6A 5J2TA 3ZMUA 3TXQA 3L73H 2L6LA 1VF6C 2X7RB 3UQ8A 3AG4C 1VQ8V 1GTOA 2QSAA 1RFYA 2ZDIA 2WLNA 3TGUH 1DK1A 4HYOA 3ML0A 1SQPH 1FD9A 1AROP 1I7FA 3F7VC 1US6A 3AK1A 3P3PA 2BCCH 2QKCA 3I55V 3Q4HA 4K3AA 2OCHA 3CX5F 1K5QA 4PDLA 1ENVA 3SPCA 4CH5A 1TVKB 5LA6A 3LDEA 1GAXA 4TV9B 4DV3B 5EK0A 1BT8A 4DR5B 2RN9A 2LGQA 4GKKB 4CC6A 2QKSA 5JVDA 5J9PC 4O2AB 1NTKH 3CD6V 1V9PA 1F4NA 4ASUG 1VIBA 1G1XB 1T5EA 3K0DA 2KKWA 4NXMB 2B5UA 5L3DA 3RWRD 1XILA 2KB1A 2WA4A 2UUAB 2BOCC 1YEWA 1H38A 1NVPD 1R6TA 2IJHA 4UVBA 5KHHA 1IXMA 1N0NA 3ABMC 4WFHA 1VQOV 3ZCCA 3MDSA 4X65B 2JVDA 2IU3A 4O4JA 4JI5O 2N74A 1Q8IA 4LF9B 2VQEO 4ZI7A 4K0KB 4BW5A 2PYLA 3G67A 5DECA 1FKAO 2LGWA 4B3SO 2GUZA 4PDVA 1O9HA 4EFEA 1MSWD 1VQNV 2Q73A 1ROPA 2YC0A 2Z0AA 3ZX6A 3EHBB 4TQDA 4PV1B 3MHHC 1M1KW 1XL4A 2Q8VA 2V4DA 5A9GA 5IWAO 4DK0A 3CCQV 4DUYB 1WNSA 1KB9F 2IM9A 4AILC 3CMAV 2X6AA 3IC9A 4ZIBA 2FTKA 1GN3A 3CRCA 4FLYA 4U3JB 2VRZA 4TQFA 4Z1VA 4RWUA 1K5SA 1TVKA 2ZNIA 5LMUO 1N0JA 4TV9A 1NBMG 1YIJV 3SYQA 1COWG 5IT9N 2B1GA 4DRXB 2NLJC 5KLVH 1JR9A 4O2AA 3I5DA 1OHHG 3HB3B 1HW7A 4DV4O 4DV2B 4XDKA 2H3OA 4PJ0Z 1YJ9V 4DW1A 4X8AA 1GH6A 1WPBA 2OYQA 1V54B 3K59A 3PJSK 3JAMN 3HPLC 1K8AW 3WB0A 3QG5A 5LP6C 5IYBO 5LHHA 3H01A 3E22A 5B3SC 5L3FA 1QLNA 4X64O 2E75B 3CCUV 1I0HA 4UCSA 2JEXA 2YUAA 3S3WA 3EXAA 3CJHB 3DSQA 3LDCA 1WN7A 2OT5A 3A2FA 1H2GA 2IW5A 3H1LH 3RYIA 1OCCC 3LNMB 4DO2A 1XL6A 1EFRG 1G4YB 1GN2A 1KP2A 2O57A 2Q7GA 1YI2V 3OMIB 3RYCB 3STLC 4QIWF 2OIGA 2Q0AA 1XEQA 5JJNB 1IBKO 3T1YB 1F51A 1OCOC 4U3JA 4MVOA 4QGPA 2DYRC 3N27A 3OEEG 1URFA 3S3XA 2ZDIC 3APOA 3OTOO 1EN4A 3E89A 4DRXA 2QWNB 2F66C 4H44B 2LW1A 1JA8A 2Y48A 5BR8O 1H2KA 4DR1O 3C3TA 2E5LO 2OWOA 4YJ3B 2XUMA 4LBEC 2WAMA 5EBMC 3ZHVA 1PL0A 5F2VO 1G6UA 1YVWA 2B1IA 3RBZA 4JI0B 3SJBC 2ZE5A 4OXSA 1U97A 3B40A 1SERA 2ARHA 3LSUA 1NVPB 1EZVH 4DR6B 5CB4B 1YITV 5B1NA 2UU9B 1IBLB 1XNRB 3CJHA 3BA9A 2EIMB 2Z3YA 3CP1A 1HNZO 2Q6AA 4DV0O 4R8CA 4RUEA 2LFRA 3CEIA 1CP9A 1YXBA 1IBMB 2C2AA 3KZIZ 4AQYO 1VQMV 1Y66A 2F43G 2AHYA 3RYCA 4LFBB 4NB5A 4FLVA 2A9HA 4UCTA 2P4VA 3ASOC 4B7EA 2Y0PA 1M4UA 1AJPA 1K4CC 1GO3F 4Z2WA 4JYCA 5IJ9B 1S72V 5C8YA 1AP6A 3E8FA 2HEPA 5LBQA 2ZM6B 2ZQMA 2UUBO 4JYAB 3EFFK 3STZC 4X20B 4R7CA 3UT5B 4OX9B 2DJVA 3AEIA 3ETQA 1WP7A 2GTSA 2Q4PA 2QGNA 3ZMSA 1U96A 4KHPO 4YJ3A 2YSUB 1AI7A 3ABMB 1XMOO 3D36A 3L75H 4WBNA 3ZRVA 5LXTB 4DK1A 4U3FH 2F1MA 2EZOA 3AG3B 3SJCC 3BVOA 1MSDA 1NKDA 4O4HB 1QR9A 4JI4B 4P9PA 4EKWA 4DV5O 2DWDC 1ZLZA 3OW2U 2H8PC 3DTUB 1Q82W 1QVFU 3F5TA 1YHQV 2OTLV 2F23A 2ILMA 2HHHB 3APQA 1VF5B 3RYHB 1SQQH 3MAQA 4TSFG 1QLEB 2QE7G 4D7SA 2A79B 1ZUQA 2P22C 4Q20A 2KSDA 3JYCA 2ITCC 5LGNA 4MVSA 5FPRA 5K1XA 1TUEB 1SQFA 4OPAA 4JI7B 3OD4A 3CMEV 5IJ9A 5JWPA 3L74H 5LL6Y 5IE9A 3X2QB 1IZ3A 2ZT9B 2N04A 4MVRA 4B3RB 4IYIA 3VQYA 1S3JA 2VS0A 4Q6GA 1SETA 2XAGA 4E2LA 4X20A 3UT5A 2BOBC 3RN4A 4QNHB 4KP4A 4JI2B 3QO8A 2RMKB 2UXDO 3FB8C 5DM6V 3ICXA 3HKCB 3M99B 2KG7B 2VQFB 2A0LA 1AP5A 1JFFB 3QF7A 2HJDA 5LP6B 1SZTA 4Z1MG 1EZJA 2PUSA 3DC6A 1SRYA 4P30A 1RPOA 1FJGO 4JI6O 5LXTA 1Y6XA 1DLBA 1W59A 1Y74B 3OUSA 3CS5A 5JJEB 1Y4MA 3AK2A 5JJJB 4O4HA 2FB5A 1VQ4V 2WLKA 4O2BB 2QM4A 1BZKA 1RP3B 2CTPA 3HKEA 1OV9A 1Q3EA 1V54C 4UB8Z 1XDCA 3OUFA 1P7BA 1XQ8A 4YXWG 1F4MA 1YZBA 3SPHA 3RYHA 4I0XB 3CC2V 4BIZA 5IY5B 3U11A 4B3MB 2W0FC 4LF4O 2JJ1G 4MTOA 3N2GB 2CTQA 2Q67A 4EEQA 5GONB 3TCUA 3RT3C 3CCEV 3JD4A 3E35A 4QPKA 5LGUA 4PA6A 1ZSPA 4DUZO 1I94O 4F4LA 4DV7B 4LF5B 4B3TO 5JH7B 4CS4A 2LP7A 1XNQB 4X1IB 2IH1C 1S5JA 1QU7A 2YXLA 3ZN1A 4CS2A 2IJIA 4TWKA 1AR1B 1YJNV 1KU9A 4K8XA 5CA1B 3FKSG 4GLXA 2FYUH 4FFKA 2ETNA 3CWBH 1RM1B 1R73A 1JFFA 1VARA 2JEUA 3RVYA 3OTFA 5H5NA 5CBFA 1Y74A 2WPDG 4WFGA 4I55B 1FYJA 4QE7A 2F4VO 3PN1A 4ICGA 4MW8A 3FFQA 1AI5A 4O2BA 2QEXV 4J80A 4DR3O 4EB6B 1SF9A 3M7MX 3CYOA 3GB7C 1XMQO 4PA7A 3D36C 2ZE7A 4I0XA 2ZNJA 3RYFB 2EULA 1L0NH 1H2MA 3E8BA 5DEDA 4UVAA 5GONA 4HZ3A 1WA8B 4FFBB 5E79Z 1M57B 4DV1B 2EZPA 5HFLA 5KX5B 1NI8A 3T1HO 3T2MA 2EIMC 3RW0A 3WFVA 5JH7A 5H6RA 4DR4O 2CDYA 4YJ2B 2JK5C 2EX3A 2M6YA 1P84F 4X1IA 2ZCEA 4G27B 4NXNB 5GW7A 4ZHQB 2HVKC 3BHPA 1L0LH 4J42A 3FAVA 4I9QA 3P30A 3IAYA 1TUBB 5CA1A 2R72A 1H2SB 3T4DA 4JZ2A 4CBCA 4MVUA 3K06A 1WB7A 1IXBA 1R3LC 2Y69B 2DW4A 1JCHA 1E79G 2ZIOA 3H9VA 3FB5C 3WB1A 4DV3O 2ZINA 3CSXA 4I55A 4GKKO 3CXCU 2UUCB 3ETDA 3SJAC 1O9GA 2ZIMA 4LWSB 1CXZB 1ORQC 1VQPV 3W7TA 4EB6A 3ABKB 3L71H 2P90A 3OGIB 1F23A 3H1IH 4BWAA 2UUAO 2N05A 5KUMA 3RYFA 2QWQB 3E22B 3E8HA 5CN0A 1NZ6A 3ZEDA 3QTCA 4X65O 5LOVB 3AG3C 4PI2A 1NTZH 1WA8A 4FFBA 2A7WA 1NT2B 4LCUC 3THOA 3K5NA 4LF9O 4HAMA 2GHYA 4K0KO 4JI5B 5KX5A 3K03A 4F6EA 4PA4A 2Q68A 1KMIZ 3RYIB 4YJ2A 2H94A 2MK3A 3JAKB 1AJQA 1QLEC 4IYHA 2YI9A 2CAZC 4ZHQA 1WJZA 1J95A 5TISZ 3AG7A 3HKDB 3UO2A 1TUBA 1J5EB 2DMXA 1KUQA 1QNMA 3SR2C 4GX2A 2EILC 4IHJB 5KUKA 4WFAV 5ITZB 1VQ5V 1V55B 3X2QC 3WB2A 4LF6O 4NVPA 3CCJV 5CBGA 2W0XA 3JATA 1X4TA 4YIPA 4N21A 1Q90D 1R1BA 2R9RB 4IGGA 5LMUB 1VQ6V 3ZBHA 2PTMA 2R9IA 4MSWC 5H9CA 1BQ0A 2YEVB 5B5EZ 1NJIW 3JCZA 4J7KA 4LF8O 1OCRB 1HNWO 4LWSA 1YTFB 4DV2O 2JS5A 4N23A 2CGOA 4L8JA 5KHJA 4LFCB 5D5PA 2RNBA 1TGOA 1P49A 3OMNB 1VQLV 2XAJA 1VQKV 4B7KA 5LOVA 3JD0A 5KAIZ 2RCVA 4R50A 5JCOA 4UCRA 4QJFB 1QR8A 1WP8A 4JYBA 2AW9A 1MG1A 3A0BZ 3LUTB 3C3SA 5K1PA 1X59A 2UXCO 1IDSA 1M90W 1UFIA 2K1EA 4IIJB 3ZRWA 3JAKA 5IY5C 4NTXA 2XAQA 4GX1A 5H2FZ 1SKVA 3HKDA 4UXNA 4HNAB 3K5LA 3MD0A 3JCUZ 5C8YB 4JI3O 4DYLA 4IHJA 3T1YO 5ITZA 2CTWA 1K4DC 2QM7A 3OFNG 3I56V 3F5WC 2CE4A 4LFAB 2HR3A 3AK3A 1AILA 1XOUA 4UCUA 4YY3B 4JV5O 3JALB 2YI8A 4ZOLA 2YEVA 3G6BA 1BMFG 1WPXA 2EINB 1Y67A 4ABMA 4CH6A 1RM1C 5GTHZ 4FVMA 3OGCC 5BR8B 4A5UB 5LMNB 3VQWA 3O65A 4WBNB 2E5LB 3QO7A 3OEHG 2ITDC 4X1YB 1OCZB 1N32B 3CPWU 2R9AA 2QJ1A 2CTRA 4CS3A 2Z5UA 3CHXA 2WLLB 5IJ0B 3K5OA 5JQGB 2UU9O 1GN6A 2RDCA 3P3NA 1XNRO 3KKYA 4EFBA 1WB8A 1Q6HA 2MW2B 4IIJA 3K79A 1EM1A 3BPZA 3GVMA 5KHKA 1Q7YW 1FPOA 1HNXB 3CCMV 4I4TB 2VWJA 2W6JG 3H1JH 4X88A 4HNAA 4DR2O 1S77D 4XDJA 1M57C 3K3WA 1LR1A 4X66B 4UUJC 4FLUA 4I5SA 3E8GA 4JI8B 1MABG 1QBZA 1R6KA 4JI1O 1NR7A 2OCCB 2E3CA 1S76D 5FNVB 4H37A 2Q0OC 1A32A 4FLXA 1JPXA 1UJWB 4ZBMA 2WA3A 4J11A 4JZGA 2FMLA 3WG7B 1S5HC 2ZM6O 1H8EG 4X62O 1Q43A 4GUNA 4JYAO 3TETA 1THZA 3JALA 1NH2D 4DR7O 4OX9O 1B3QA 4UB6Z 1JOYA 4UVCA 4XBFA 3F7YC 2JIZG 2B9ZA 1H8HG 2KQXA 2Y69C 5KAFZ 3K58A 1KKDA 2NNUA 3H1KH 1M56B 3CC4V 3IFXA 2K9PA 4X1YA 1M9NA 1JMKC 4LNUB 5KA5A 5AG2A 1MZFA 1VMGA 2P67A 4FZ1A 4XDLA 4FM1A 1N34B 5D5QA 4JAAA 3ZMTA 3HKEB 4BIOA 4PDRA 1NTMH 2WLLA 5IJ0A 5JQGA 3ABUA 2DQ3A 2PI4A 3ABKC 1FAFA 2QWOB 1GM8A 3LDDA 4DV5B 3BA8A 2HHHO 2FL4A 3B4SA 1VQ7V 1MNGA 3SYAA 4FZ0A 4HBNA 1FFTB 1E1QG 4I4TA 2E74B 1D2DA 1KKCA 4FK5C 1BCCH 5JCOC 2EILB 3KCXA 4IL6Z 4PI0A 4JGSA 1LNQA 2QWPB 2PY5A 5L3BA 5FNVA 3CRRA 4GKJO 4BIUA 3CCRV 1PP9H 4RQFA 5LYJB 2ADQB 4B3RO 3FD9A 2PYJA 4FLTA 2QDOA 3AG2B 4AHCA 4H0LB 2WWWA 1QVGU 3JD2A 1DGSA 1IX9A 4JI2O 3O9OA 2XOKG 1JQ0A 1V55C 2UXDB 3CCLV 3B77A 3L70H 4WCEV 4H13B 1N33O 1ZAUA 5BZBA 2XAHA 1PNKA 4FM2A 4NYKA 3B09A 4CH3A 4LNUA 3OT7A 4RO2A 3UKMA 5LHGA 1B04A 2YIBD 3ETEA 4JI6B 2WLJA 1OCRC 4MS2A 5B1AC 3UM7A 1NQTA 1GMGA 3J81N 2Y0IA 1M5IA 1HWYA 3QVNA 3BEHA 4E4EA 5J2UB 5EBLC 1BQZA 5EC1C 3W7SA 3D3QA 4MVZA 4K35A 1JVMA 4B3MO 3BAAA 4O4IB 4BAYA 3ZHTA 2LQTA 3IGAC 3G80A 1S0VA 2XHBA 1H2LA 1Y76B 4DV7O 1I94B 5LYJA 3JSNA 2XAFA 1KYOF 2JDIG 3FAVB 4U7OA 2P5OA 4BR6A 1SC5B 3JASB 1R3JC 1YJWV 4GX0A 4LP8A 1FXHA 1PV0A 1MOFA 1K33A 3SPJA 1CPYA 3ABLB 4FPPA 1I5YA 4YHHB 2UXBO 5B1BC 1L1FA 1BGYH 1IURA 1NH2B 2ODMA 1YTFD 2G38A 1Z5VA 2NN4A 1AVMA 5KHGA 1XHZA 4DV6O 3AG1B 3ETGA 5EC2C 3ZHSA 1KC8W 3W7UA 4G28B 3RVZA 2EIKB 1KP3A 2RQ6A 4J10A 2EINC 1E1RG 1PM9A 3GWOA 3LSSA 2GSMB 5J2UA 2JRIA 2E76B 3OMAB 1BSMA 4DR3B 2VWKA 1OCZC 4FLZA 4F6RA 4LF7B 2ADPA 1XMQB 3K08A 1N4CA 1WLEA 4KUMA 4O4IA 3BY6A 1N36O 2EBOA 5CMUA 2W6IG 2YIAA 2Q5ZA 3OAAG 5EIBD 2CK3G 1OZ0A 1Y76A 2BTQB 3ZHQA 3OR7C 1HR0B 1B06A 3BABA 3CC7V 2JGUA 3T1HB 1P4RA 4WF9V 3QNEA 4PHZA 4DR4B 1QCEA 3JASA 1PL4A 4NXNO 1Q6IA 1DF5A 4NKGB 1ZX3A 2F95B 2P6JA 4R6ZA 2DWEC 3CCVV 5GTIZ 5IYDO 2OCCC 2DYSB 4I7ZB 4CC5A 1VEWA 1R3IC 1PNMA 4X89A 2GTAA 1R3KC 4TT3G 3JATB 4LH7A 3WG7C 4DR5O 4MT8A 1ZL8B 4UCVA 2ZR3A 4WFEA 2QM8A 2UUCO 1XHXA 1YF2A 4MW3A 4NXMO 3P32A 3W7WA 2Q7EA 4X1KB 4W4KA 1Q6UA 3VOUA 2QR4A 4GX5A 1SS3A 4K8ZA 1NU1H 1M56C 1SQVH 2HKOA 3JD3A 2YS8A 4LC1A 4TOIA 1AR5A 3DC5A 4RUFA 3CE2A 1W2BU 4X9QA 1PNLA 5IDJA 5E1AC 5BXZA 4OGQB 3TJTA 2VQEB 1BE3H 1RSOB 1H2NA 4IT5A 2BSKB 3CRMA 2BTQA 4B3SB 3ZRWB 2R70A 3UCSC 2AZ2A 2AZ0A 2YXHA 2XTAA 3HKBB 4GYCB 1ZWIC 1OJHA 1I08A 4JTDB 4DUYO 3JARB 5BMVB 5IWAB 3FYIB 2ZR2A 4MTGA 1J5EO 2GBOA 3SPGA 3KCYA 3FYEB 1RPRA 1XI1A 3H1HH 2LFSA 2LW7A 4C7UA 5L3CA 5IYZB 1D5NA 3GWKC 5L3EA
chains in the Genus database with same CATH topology
1KKCA 3KKYA 3KDRA 1WB8A 2RCVA 1XREA 1XUQA 4BR6A 1P7GA 1EM1A 1VEWA 1AP5A 1LUWA 2AW9A 5A9GA 3EVKA 3DC6A 3C3SA 1LUVA 4JYYA 2ADQB 1IDSA 1MMMA 1EN4A 3AK2A 3IC9A 1GN4A 1GN3A 1IX9A 4F6EA 1JA8A 1AVMA 2QKAA 4JZGA 1EN6A 1N0JA 3AK1A 1XDCA 2QKCA 3C3TA 4GUNA 1MSDA 1AR5A 3DC5A 1JR9A 1AR4A 1ZLZA 1PM9A 2CE4A 2CDYA 3AK3A 3OT7A 1QNMA 4X9QA 1BT8A 1BSMA 3LSUA 1ZSPA 3TJTA 1ZUQA 2ADPA 1ZTEA 5AG2A 1Y67A 3QVNA 4E4EA 4YIPA 1EN5A 1XILA 4JZ2A 3CEIA 2P4KA 1I08A 1WB7A 1IXBA 1I0HA 1N0NA 1B06A 3MDSA 3BFRA 4YIOA 1BS3A 3K9SA 1MNGA 4FFKA 4C7UA 1PL4A 1VARA 2GDSA 1SZXA 1GN2A 1D5NA 3RN4A 1AP6A 1MA1A 1GN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKC A;  3KKY A;  1WB8 A;  2RCV A;  1XRE A;  1XUQ A;  4BR6 A;  1P7G A;  1EM1 A;  1VEW A;  1AP5 A;  1LUW A;  2AW9 A;  5A9G A;  3EVK A;  3DC6 A;  3C3S A;  1LUV A;  4JYY A;  2ADQ B;  1IDS A;  1MMM A;  1EN4 A;  3AK2 A;  3IC9 A;  1GN4 A;  1GN3 A;  1IX9 A;  4F6E A;  1JA8 A;  1AVM A;  2QKA A;  4JZG A;  1EN6 A;  1N0J A;  3AK1 A;  1XDC A;  2QKC A;  3C3T A;  4GUN A;  1MSD A;  1AR5 A;  3DC5 A;  1JR9 A;  1AR4 A;  1ZLZ A;  1PM9 A;  2CE4 A;  2CDY A;  3AK3 A;  3OT7 A;  1QNM A;  4X9Q A;  1BT8 A;  1BSM A;  3LSU A;  1ZSP A;  3TJT A;  1ZUQ A;  2ADP A;  1ZTE A;  5AG2 A;  1Y67 A;  3QVN A;  4E4E A;  4YIP A;  1EN5 A;  1XIL A;  4JZ2 A;  3CEI A;  2P4K A;  1I08 A;  1WB7 A;  1IXB A;  1I0H A;  1N0N A;  1B06 A;  3MDS A;  3BFR A;  4YIO A;  1BS3 A;  3K9S A;  1MNG A;  4FFK A;  4C7U A;  1PL4 A;  1VAR A;  2GDS A;  1SZX A;  1GN2 A;  1D5N A;  3RN4 A;  1AP6 A;  1MA1 A;  1GN6 A; 
#chains in the Genus database with same CATH topology
 4UV9 A;  3RFR A;  3AG2 C;  2AGA A;  3FB7 C;  2CUG A;  1ZL8 A;  4ZOL B;  4LF6 B;  1XRE A;  1FXK B;  5LGT A;  4KFM A;  3ZMV A;  5C93 A;  5B1A B;  1Q5O A;  4G2K A;  3D8C A;  1GKF A;  4DV4 B;  3TXS A;  4X1K A;  5HFM A;  3B2E E;  1FFX B;  2ATK C;  4LFC O;  2DOS A;  2YIB A;  4LF8 B;  1HNW B;  1K92 A;  5KMG B;  4J9Z B;  2EIJ B;  5BY1 A;  3ZN0 A;  2ZXW B;  2L35 A;  2P06 A;  3G6E V;  1M93 A;  2A3Q A;  4ZKI A;  2WSS G;  3LNN A;  4X64 B;  3IC7 A;  3W7X A;  1RSO A;  2WLI B;  2BSK A;  4TUY B;  3ABT A;  2LO1 A;  2X0L A;  4UCO A;  1KEC A;  4JTC B;  4J7Z A;  4KL1 A;  3WU2 Z;  3K0G A;  4PEL A;  1B6Q A;  1YCI A;  5B1O A;  2Q9L A;  1VP7 A;  2LJ2 A;  1K97 A;  3HKB A;  2UXC B;  3JD1 A;  4GT1 A;  4JTA B;  4FIP C;  1PPJ H;  3JAR A;  5BMV A;  2JJ2 G;  3R65 A;  5CBH A;  5FL7 G;  5A2Q N;  3KG2 A;  5B1B B;  1NR1 A;  1L8D A;  1IBK B;  4WFB V;  3ASN C;  1YDX A;  5IYZ A;  2P4K A;  4RAI A;  3K9A A;  4JI3 B;  1MZE A;  4LFA O;  3BFR A;  3E86 A;  2OTJ V;  1BL8 A;  2X6C A;  4FLW A;  3OTO B;  3T4Z A;  1HDJ A;  4YY3 O;  1FXK A;  4MTX A;  4O4L B;  1SZX A;  3ABL C;  2A06 H;  1Z2G A;  2YIC A;  3IJ4 A;  4JV5 B;  1D5A A;  1N8R W;  1QQC A;  1FFX A;  4DR1 B;  5L3G A;  1P7G A;  2FKX A;  1PD3 A;  3FX7 A;  4JI0 O;  5KMG A;  5LMN O;  2V7Q G;  3AG1 C;  2RJZ A;  1I5X A;  1N32 O;  2AXT Z;  4JYY A;  2EIK C;  5KHI A;  2JGD B;  4DR6 O;  1JNB A;  1H5W A;  3CRA A;  1IBL O;  3K04 A;  2M7W A;  2WLI A;  1CEZ A;  4TUY A;  5B66 Z;  4JF3 A;  3TK1 A;  2V1D A;  2QKA A;  3ZRX A;  1GK9 A;  3OE7 G;  1HNZ B;  4GZR B;  1IBM O;  4DV0 B;  2QTO A;  3L72 H;  4LFB O;  3AG4 B;  3BCC H;  1HNX O;  1AR4 A;  4AQY B;  3A0R A;  1VQ9 V;  4JPR A;  2X6B A;  4X66 O;  3OR6 C;  4JI8 O;  2UXN A;  3NR7 A;  4DR2 B;  4J9Y B;  2AHZ A;  2IJK A;  3SYP A;  1DF4 A;  1SQX H;  3DXR B;  4CH4 A;  2EJ7 A;  2NR5 A;  1Q86 W;  3SYO A;  4JI1 B;  4TV8 B;  1Q81 W;  3NXS A;  3JAW B;  2UUB B;  1PKX A;  2Y4U A;  2ZE8 A;  3QO5 A;  1K7D A;  2BE3 A;  2ZD9 A;  5CA0 B;  1KD1 W;  4O4L A;  4X62 B;  4DW0 A;  2IH3 C;  4DR7 B;  2DYS C;  1NS1 A;  1GRJ A;  4I50 B;  3OM3 B;  4KHP B;  2PGG A;  2PF4 E;  2ZKO A;  2QWR B;  2Q7H A;  1TA8 A;  2GDS A;  4AI8 A;  3M8A A;  1XMO B;  1F7Y A;  3K5M A;  3ZMZ A;  3KDR A;  3J80 N;  3L9D A;  4JI4 O;  3A0H Z;  1XUQ A;  2JGD A;  1N34 O;  4GCZ A;  4FMT A;  1AB3 A;  3B8M A;  4U7N A;  2QTS A;  5EBW C;  1YSC A;  4D6T H;  2JS3 A;  4PA9 A;  4FM0 A;  2HFE C;  3SJQ C;  3SGI A;  1IJG A;  4H33 A;  4JAU A;  1WAZ A;  2YXY A;  5CB4 A;  1GM7 A;  1MMM A;  5FPO A;  1JJO A;  2EJR A;  1VF6 A;  5EYP B;  2D2C B;  1EBO A;  4FJC C;  4JI7 O;  2WLH A;  2CH7 B;  3CXH F;  2DQ0 A;  4UV8 A;  3SDL A;  3ZS8 C;  1AJN A;  3CRQ A;  3CCS V;  4OPH A;  3U0Z A;  1K73 W;  4LR3 A;  1SQB H;  3DXR A;  2CGN A;  4PDM A;  1IVS A;  2BTO A;  2D3O W;  1GM9 A;  4TV8 A;  4KXR A;  3JAW A;  1W0K G;  4GKJ B;  5DN6 G;  5CA0 A;  2PI5 A;  1SES A;  4L87 A;  3ZHR A;  1ZTE A;  2VQF O;  1FS0 G;  1SA0 B;  4BW9 A;  4I50 A;  1FXV A;  1VF7 A;  3E2E A;  2DN9 A;  3DGE A;  1DTO A;  4JAS A;  3ZRS A;  4MTF A;  3G71 V;  1K34 A;  4QE9 A;  5H6Q A;  3J7A U;  2HP8 A;  1SQG A;  4DXW A;  1JX9 A;  4RQE A;  4YIO A;  2HJF C;  1BS3 A;  1FJG B;  1FXK C;  1N33 B;  5EZY B;  4PA3 A;  4LH6 A;  4B08 A;  3UO3 A;  5B3S B;  4P2Z A;  1QHT A;  1FOU A;  3FB6 C;  2XND G;  4WFF A;  3CB2 A;  4CZZ A;  1MA1 A;  3ZIA G;  4NTW A;  1KQS U;  4W4L A;  1JJ2 U;  1XBL A;  1HP8 A;  4F6R B;  2EIJ C;  4I9W A;  2ZXW C;  5EYP A;  2OIE A;  1LUW A;  2QA4 V;  1OCC B;  5CA3 A;  3EVK A;  3ZJZ A;  4LF4 B;  1K3E A;  2Q69 A;  2CH7 A;  1LUV A;  5IYC O;  2XAS A;  3D3I A;  4LF5 O;  2P7T C;  2UXX A;  3ASN B;  3N2K B;  4D7T A;  3K57 A;  1GN4 A;  4J7J A;  4DUZ B;  3B8N A;  4J41 A;  4B3T B;  5LHI A;  1XNQ O;  3E83 A;  1OCO B;  5J2T B;  3VQX A;  1EN6 A;  2DYR B;  4MVQ A;  5EIB C;  2F93 B;  5FLX N;  2HG5 C;  2XT9 A;  3G4S V;  2YID A;  3LSQ A;  1K9M W;  1R6N A;  3MHS C;  1SA0 A;  1KBH A;  1G8M A;  3A8T A;  4NTY A;  4MVM A;  3Q4H B;  3C90 A;  2GV9 A;  4YHH O;  4QPJ A;  5KA6 A;  2WLM A;  3RGB A;  3ZHU A;  1BHA A;  2UXB B;  2YDE A;  3JSL A;  3HKC A;  2IJJ A;  5LA6 B;  4UFZ A;  3U10 A;  2KG7 A;  3R66 A;  2PZS A;  2ZE6 A;  1S5L Z;  5LP6 A;  5EZY A;  1EN5 A;  4DV6 B;  2DE0 X;  2F4V B;  5JVD B;  3SPI A;  3VBB A;  4PD4 F;  3T1C A;  1BHB A;  3K9S A;  4NR1 A;  4P9O A;  4JAV A;  3SYC A;  1Z5W A;  4LF7 O;  2Y4T A;  2HLD G;  3VQV A;  3HR0 A;  1UPG A;  4DV1 O;  2IBZ H;  2HVJ C;  4O4J B;  1W0J G;  1TAE A;  3N2G A;  3N2K A;  3ASO B;  4ZI7 B;  3BRC A;  1N36 B;  1AI4 A;  2GUZ B;  1HR0 O;  2IU0 A;  1AI6 A;  5J2T A;  3ZMU A;  3TXQ A;  3L73 H;  2L6L A;  1VF6 C;  2X7R B;  3UQ8 A;  3AG4 C;  1VQ8 V;  1GTO A;  2QSA A;  1RFY A;  2ZDI A;  2WLN A;  3TGU H;  1DK1 A;  4HYO A;  3ML0 A;  1SQP H;  1FD9 A;  1ARO P;  1I7F A;  3F7V C;  1US6 A;  3AK1 A;  3P3P A;  2BCC H;  2QKC A;  3I55 V;  3Q4H A;  4K3A A;  2OCH A;  3CX5 F;  1K5Q A;  4PDL A;  1ENV A;  3SPC A;  4CH5 A;  1TVK B;  5LA6 A;  3LDE A;  1GAX A;  4TV9 B;  4DV3 B;  5EK0 A;  1BT8 A;  4DR5 B;  2RN9 A;  2LGQ A;  4GKK B;  4CC6 A;  2QKS A;  5JVD A;  5J9P C;  4O2A B;  1NTK H;  3CD6 V;  1V9P A;  1F4N A;  4ASU G;  1VIB A;  1G1X B;  1T5E A;  3K0D A;  2KKW A;  4NXM B;  2B5U A;  5L3D A;  3RWR D;  1XIL A;  2KB1 A;  2WA4 A;  2UUA B;  2BOC C;  1YEW A;  1H38 A;  1NVP D;  1R6T A;  2IJH A;  4UVB A;  5KHH A;  1IXM A;  1N0N A;  3ABM C;  4WFH A;  1VQO V;  3ZCC A;  3MDS A;  4X65 B;  2JVD A;  2IU3 A;  4O4J A;  4JI5 O;  2N74 A;  1Q8I A;  4LF9 B;  2VQE O;  4ZI7 A;  4K0K B;  4BW5 A;  2PYL A;  3G67 A;  5DEC A;  1FKA O;  2LGW A;  4B3S O;  2GUZ A;  4PDV A;  1O9H A;  4EFE A;  1MSW D;  1VQN V;  2Q73 A;  1ROP A;  2YC0 A;  2Z0A A;  3ZX6 A;  3EHB B;  4TQD A;  4PV1 B;  3MHH C;  1M1K W;  1XL4 A;  2Q8V A;  2V4D A;  5A9G A;  5IWA O;  4DK0 A;  3CCQ V;  4DUY B;  1WNS A;  1KB9 F;  2IM9 A;  4AIL C;  3CMA V;  2X6A A;  3IC9 A;  4ZIB A;  2FTK A;  1GN3 A;  3CRC A;  4FLY A;  4U3J B;  2VRZ A;  4TQF A;  4Z1V A;  4RWU A;  1K5S A;  1TVK A;  2ZNI A;  5LMU O;  1N0J A;  4TV9 A;  1NBM G;  1YIJ V;  3SYQ A;  1COW G;  5IT9 N;  2B1G A;  4DRX B;  2NLJ C;  5KLV H;  1JR9 A;  4O2A A;  3I5D A;  1OHH G;  3HB3 B;  1HW7 A;  4DV4 O;  4DV2 B;  4XDK A;  2H3O A;  4PJ0 Z;  1YJ9 V;  4DW1 A;  4X8A A;  1GH6 A;  1WPB A;  2OYQ A;  1V54 B;  3K59 A;  3PJS K;  3JAM N;  3HPL C;  1K8A W;  3WB0 A;  3QG5 A;  5LP6 C;  5IYB O;  5LHH A;  3H01 A;  3E22 A;  5B3S C;  5L3F A;  1QLN A;  4X64 O;  2E75 B;  3CCU V;  1I0H A;  4UCS A;  2JEX A;  2YUA A;  3S3W A;  3EXA A;  3CJH B;  3DSQ A;  3LDC A;  1WN7 A;  2OT5 A;  3A2F A;  1H2G A;  2IW5 A;  3H1L H;  3RYI A;  1OCC C;  3LNM B;  4DO2 A;  1XL6 A;  1EFR G;  1G4Y B;  1GN2 A;  1KP2 A;  2O57 A;  2Q7G A;  1YI2 V;  3OMI B;  3RYC B;  3STL C;  4QIW F;  2OIG A;  2Q0A A;  1XEQ A;  5JJN B;  1IBK O;  3T1Y B;  1F51 A;  1OCO C;  4U3J A;  4MVO A;  4QGP A;  2DYR C;  3N27 A;  3OEE G;  1URF A;  3S3X A;  2ZDI C;  3APO A;  3OTO O;  1EN4 A;  3E89 A;  4DRX A;  2QWN B;  2F66 C;  4H44 B;  2LW1 A;  1JA8 A;  2Y48 A;  5BR8 O;  1H2K A;  4DR1 O;  3C3T A;  2E5L O;  2OWO A;  4YJ3 B;  2XUM A;  4LBE C;  2WAM A;  5EBM C;  3ZHV A;  1PL0 A;  5F2V O;  1G6U A;  1YVW A;  2B1I A;  3RBZ A;  4JI0 B;  3SJB C;  2ZE5 A;  4OXS A;  1U97 A;  3B40 A;  1SER A;  2ARH A;  3LSU A;  1NVP B;  1EZV H;  4DR6 B;  5CB4 B;  1YIT V;  5B1N A;  2UU9 B;  1IBL B;  1XNR B;  3CJH A;  3BA9 A;  2EIM B;  2Z3Y A;  3CP1 A;  1HNZ O;  2Q6A A;  4DV0 O;  4R8C A;  4RUE A;  2LFR A;  3CEI A;  1CP9 A;  1YXB A;  1IBM B;  2C2A A;  3KZI Z;  4AQY O;  1VQM V;  1Y66 A;  2F43 G;  2AHY A;  3RYC A;  4LFB B;  4NB5 A;  4FLV A;  2A9H A;  4UCT A;  2P4V A;  3ASO C;  4B7E A;  2Y0P A;  1M4U A;  1AJP A;  1K4C C;  1GO3 F;  4Z2W A;  4JYC A;  5IJ9 B;  1S72 V;  5C8Y A;  1AP6 A;  3E8F A;  2HEP A;  5LBQ A;  2ZM6 B;  2ZQM A;  2UUB O;  4JYA B;  3EFF K;  3STZ C;  4X20 B;  4R7C A;  3UT5 B;  4OX9 B;  2DJV A;  3AEI A;  3ETQ A;  1WP7 A;  2GTS A;  2Q4P A;  2QGN A;  3ZMS A;  1U96 A;  4KHP O;  4YJ3 A;  2YSU B;  1AI7 A;  3ABM B;  1XMO O;  3D36 A;  3L75 H;  4WBN A;  3ZRV A;  5LXT B;  4DK1 A;  4U3F H;  2F1M A;  2EZO A;  3AG3 B;  3SJC C;  3BVO A;  1MSD A;  1NKD A;  4O4H B;  1QR9 A;  4JI4 B;  4P9P A;  4EKW A;  4DV5 O;  2DWD C;  1ZLZ A;  3OW2 U;  2H8P C;  3DTU B;  1Q82 W;  1QVF U;  3F5T A;  1YHQ V;  2OTL V;  2F23 A;  2ILM A;  2HHH B;  3APQ A;  1VF5 B;  3RYH B;  1SQQ H;  3MAQ A;  4TSF G;  1QLE B;  2QE7 G;  4D7S A;  2A79 B;  1ZUQ A;  2P22 C;  4Q20 A;  2KSD A;  3JYC A;  2ITC C;  5LGN A;  4MVS A;  5FPR A;  5K1X A;  1TUE B;  1SQF A;  4OPA A;  4JI7 B;  3OD4 A;  3CME V;  5IJ9 A;  5JWP A;  3L74 H;  5LL6 Y;  5IE9 A;  3X2Q B;  1IZ3 A;  2ZT9 B;  2N04 A;  4MVR A;  4B3R B;  4IYI A;  3VQY A;  1S3J A;  2VS0 A;  4Q6G A;  1SET A;  2XAG A;  4E2L A;  4X20 A;  3UT5 A;  2BOB C;  3RN4 A;  4QNH B;  4KP4 A;  4JI2 B;  3QO8 A;  2RMK B;  2UXD O;  3FB8 C;  5DM6 V;  3ICX A;  3HKC B;  3M99 B;  2KG7 B;  2VQF B;  2A0L A;  1AP5 A;  1JFF B;  3QF7 A;  2HJD A;  5LP6 B;  1SZT A;  4Z1M G;  1EZJ A;  2PUS A;  3DC6 A;  1SRY A;  4P30 A;  1RPO A;  1FJG O;  4JI6 O;  5LXT A;  1Y6X A;  1DLB A;  1W59 A;  1Y74 B;  3OUS A;  3CS5 A;  5JJE B;  1Y4M A;  3AK2 A;  5JJJ B;  4O4H A;  2FB5 A;  1VQ4 V;  2WLK A;  4O2B B;  2QM4 A;  1BZK A;  1RP3 B;  2CTP A;  3HKE A;  1OV9 A;  1Q3E A;  1V54 C;  4UB8 Z;  1XDC A;  3OUF A;  1P7B A;  1XQ8 A;  4YXW G;  1F4M A;  1YZB A;  3SPH A;  3RYH A;  4I0X B;  3CC2 V;  4BIZ A;  5IY5 B;  3U11 A;  4B3M B;  2W0F C;  4LF4 O;  2JJ1 G;  4MTO A;  3N2G B;  2CTQ A;  2Q67 A;  4EEQ A;  5GON B;  3TCU A;  3RT3 C;  3CCE V;  3JD4 A;  3E35 A;  4QPK A;  5LGU A;  4PA6 A;  1ZSP A;  4DUZ O;  1I94 O;  4F4L A;  4DV7 B;  4LF5 B;  4B3T O;  5JH7 B;  4CS4 A;  2LP7 A;  1XNQ B;  4X1I B;  2IH1 C;  1S5J A;  1QU7 A;  2YXL A;  3ZN1 A;  4CS2 A;  2IJI A;  4TWK A;  1AR1 B;  1YJN V;  1KU9 A;  4K8X A;  5CA1 B;  3FKS G;  4GLX A;  2FYU H;  4FFK A;  2ETN A;  3CWB H;  1RM1 B;  1R73 A;  1JFF A;  1VAR A;  2JEU A;  3RVY A;  3OTF A;  5H5N A;  5CBF A;  1Y74 A;  2WPD G;  4WFG A;  4I55 B;  1FYJ A;  4QE7 A;  2F4V O;  3PN1 A;  4ICG A;  4MW8 A;  3FFQ A;  1AI5 A;  4O2B A;  2QEX V;  4J80 A;  4DR3 O;  4EB6 B;  1SF9 A;  3M7M X;  3CYO A;  3GB7 C;  1XMQ O;  4PA7 A;  3D36 C;  2ZE7 A;  4I0X A;  2ZNJ A;  3RYF B;  2EUL A;  1L0N H;  1H2M A;  3E8B A;  5DED A;  4UVA A;  5GON A;  4HZ3 A;  1WA8 B;  4FFB B;  5E79 Z;  1M57 B;  4DV1 B;  2EZP A;  5HFL A;  5KX5 B;  1NI8 A;  3T1H O;  3T2M A;  2EIM C;  3RW0 A;  3WFV A;  5JH7 A;  5H6R A;  4DR4 O;  2CDY A;  4YJ2 B;  2JK5 C;  2EX3 A;  2M6Y A;  1P84 F;  4X1I A;  2ZCE A;  4G27 B;  4NXN B;  5GW7 A;  4ZHQ B;  2HVK C;  3BHP A;  1L0L H;  4J42 A;  3FAV A;  4I9Q A;  3P30 A;  3IAY A;  1TUB B;  5CA1 A;  2R72 A;  1H2S B;  3T4D A;  4JZ2 A;  4CBC A;  4MVU A;  3K06 A;  1WB7 A;  1IXB A;  1R3L C;  2Y69 B;  2DW4 A;  1JCH A;  1E79 G;  2ZIO A;  3H9V A;  3FB5 C;  3WB1 A;  4DV3 O;  2ZIN A;  3CSX A;  4I55 A;  4GKK O;  3CXC U;  2UUC B;  3ETD A;  3SJA C;  1O9G A;  2ZIM A;  4LWS B;  1CXZ B;  1ORQ C;  1VQP V;  3W7T A;  4EB6 A;  3ABK B;  3L71 H;  2P90 A;  3OGI B;  1F23 A;  3H1I H;  4BWA A;  2UUA O;  2N05 A;  5KUM A;  3RYF A;  2QWQ B;  3E22 B;  3E8H A;  5CN0 A;  1NZ6 A;  3ZED A;  3QTC A;  4X65 O;  5LOV B;  3AG3 C;  4PI2 A;  1NTZ H;  1WA8 A;  4FFB A;  2A7W A;  1NT2 B;  4LCU C;  3THO A;  3K5N A;  4LF9 O;  4HAM A;  2GHY A;  4K0K O;  4JI5 B;  5KX5 A;  3K03 A;  4F6E A;  4PA4 A;  2Q68 A;  1KMI Z;  3RYI B;  4YJ2 A;  2H94 A;  2MK3 A;  3JAK B;  1AJQ A;  1QLE C;  4IYH A;  2YI9 A;  2CAZ C;  4ZHQ A;  1WJZ A;  1J95 A;  5TIS Z;  3AG7 A;  3HKD B;  3UO2 A;  1TUB A;  1J5E B;  2DMX A;  1KUQ A;  1QNM A;  3SR2 C;  4GX2 A;  2EIL C;  4IHJ B;  5KUK A;  4WFA V;  5ITZ B;  1VQ5 V;  1V55 B;  3X2Q C;  3WB2 A;  4LF6 O;  4NVP A;  3CCJ V;  5CBG A;  2W0X A;  3JAT A;  1X4T A;  4YIP A;  4N21 A;  1Q90 D;  1R1B A;  2R9R B;  4IGG A;  5LMU B;  1VQ6 V;  3ZBH A;  2PTM A;  2R9I A;  4MSW C;  5H9C A;  1BQ0 A;  2YEV B;  5B5E Z;  1NJI W;  3JCZ A;  4J7K A;  4LF8 O;  1OCR B;  1HNW O;  4LWS A;  1YTF B;  4DV2 O;  2JS5 A;  4N23 A;  2CGO A;  4L8J A;  5KHJ A;  4LFC B;  5D5P A;  2RNB A;  1TGO A;  1P49 A;  3OMN B;  1VQL V;  2XAJ A;  1VQK V;  4B7K A;  5LOV A;  3JD0 A;  5KAI Z;  2RCV A;  4R50 A;  5JCO A;  4UCR A;  4QJF B;  1QR8 A;  1WP8 A;  4JYB A;  2AW9 A;  1MG1 A;  3A0B Z;  3LUT B;  3C3S A;  5K1P A;  1X59 A;  2UXC O;  1IDS A;  1M90 W;  1UFI A;  2K1E A;  4IIJ B;  3ZRW A;  3JAK A;  5IY5 C;  4NTX A;  2XAQ A;  4GX1 A;  5H2F Z;  1SKV A;  3HKD A;  4UXN A;  4HNA B;  3K5L A;  3MD0 A;  3JCU Z;  5C8Y B;  4JI3 O;  4DYL A;  4IHJ A;  3T1Y O;  5ITZ A;  2CTW A;  1K4D C;  2QM7 A;  3OFN G;  3I56 V;  3F5W C;  2CE4 A;  4LFA B;  2HR3 A;  3AK3 A;  1AIL A;  1XOU A;  4UCU A;  4YY3 B;  4JV5 O;  3JAL B;  2YI8 A;  4ZOL A;  2YEV A;  3G6B A;  1BMF G;  1WPX A;  2EIN B;  1Y67 A;  4ABM A;  4CH6 A;  1RM1 C;  5GTH Z;  4FVM A;  3OGC C;  5BR8 B;  4A5U B;  5LMN B;  3VQW A;  3O65 A;  4WBN B;  2E5L B;  3QO7 A;  3OEH G;  2ITD C;  4X1Y B;  1OCZ B;  1N32 B;  3CPW U;  2R9A A;  2QJ1 A;  2CTR A;  4CS3 A;  2Z5U A;  3CHX A;  2WLL B;  5IJ0 B;  3K5O A;  5JQG B;  2UU9 O;  1GN6 A;  2RDC A;  3P3N A;  1XNR O;  3KKY A;  4EFB A;  1WB8 A;  1Q6H A;  2MW2 B;  4IIJ A;  3K79 A;  1EM1 A;  3BPZ A;  3GVM A;  5KHK A;  1Q7Y W;  1FPO A;  1HNX B;  3CCM V;  4I4T B;  2VWJ A;  2W6J G;  3H1J H;  4X88 A;  4HNA A;  4DR2 O;  1S77 D;  4XDJ A;  1M57 C;  3K3W A;  1LR1 A;  4X66 B;  4UUJ C;  4FLU A;  4I5S A;  3E8G A;  4JI8 B;  1MAB G;  1QBZ A;  1R6K A;  4JI1 O;  1NR7 A;  2OCC B;  2E3C A;  1S76 D;  5FNV B;  4H37 A;  2Q0O C;  1A32 A;  4FLX A;  1JPX A;  1UJW B;  4ZBM A;  2WA3 A;  4J11 A;  4JZG A;  2FML A;  3WG7 B;  1S5H C;  2ZM6 O;  1H8E G;  4X62 O;  1Q43 A;  4GUN A;  4JYA O;  3TET A;  1THZ A;  3JAL A;  1NH2 D;  4DR7 O;  4OX9 O;  1B3Q A;  4UB6 Z;  1JOY A;  4UVC A;  4XBF A;  3F7Y C;  2JIZ G;  2B9Z A;  1H8H G;  2KQX A;  2Y69 C;  5KAF Z;  3K58 A;  1KKD A;  2NNU A;  3H1K H;  1M56 B;  3CC4 V;  3IFX A;  2K9P A;  4X1Y A;  1M9N A;  1JMK C;  4LNU B;  5KA5 A;  5AG2 A;  1MZF A;  1VMG A;  2P67 A;  4FZ1 A;  4XDL A;  4FM1 A;  1N34 B;  5D5Q A;  4JAA A;  3ZMT A;  3HKE B;  4BIO A;  4PDR A;  1NTM H;  2WLL A;  5IJ0 A;  5JQG A;  3ABU A;  2DQ3 A;  2PI4 A;  3ABK C;  1FAF A;  2QWO B;  1GM8 A;  3LDD A;  4DV5 B;  3BA8 A;  2HHH O;  2FL4 A;  3B4S A;  1VQ7 V;  1MNG A;  3SYA A;  4FZ0 A;  4HBN A;  1FFT B;  1E1Q G;  4I4T A;  2E74 B;  1D2D A;  1KKC A;  4FK5 C;  1BCC H;  5JCO C;  2EIL B;  3KCX A;  4IL6 Z;  4PI0 A;  4JGS A;  1LNQ A;  2QWP B;  2PY5 A;  5L3B A;  5FNV A;  3CRR A;  4GKJ O;  4BIU A;  3CCR V;  1PP9 H;  4RQF A;  5LYJ B;  2ADQ B;  4B3R O;  3FD9 A;  2PYJ A;  4FLT A;  2QDO A;  3AG2 B;  4AHC A;  4H0L B;  2WWW A;  1QVG U;  3JD2 A;  1DGS A;  1IX9 A;  4JI2 O;  3O9O A;  2XOK G;  1JQ0 A;  1V55 C;  2UXD B;  3CCL V;  3B77 A;  3L70 H;  4WCE V;  4H13 B;  1N33 O;  1ZAU A;  5BZB A;  2XAH A;  1PNK A;  4FM2 A;  4NYK A;  3B09 A;  4CH3 A;  4LNU A;  3OT7 A;  4RO2 A;  3UKM A;  5LHG A;  1B04 A;  2YIB D;  3ETE A;  4JI6 B;  2WLJ A;  1OCR C;  4MS2 A;  5B1A C;  3UM7 A;  1NQT A;  1GMG A;  3J81 N;  2Y0I A;  1M5I A;  1HWY A;  3QVN A;  3BEH A;  4E4E A;  5J2U B;  5EBL C;  1BQZ A;  5EC1 C;  3W7S A;  3D3Q A;  4MVZ A;  4K35 A;  1JVM A;  4B3M O;  3BAA A;  4O4I B;  4BAY A;  3ZHT A;  2LQT A;  3IGA C;  3G80 A;  1S0V A;  2XHB A;  1H2L A;  1Y76 B;  4DV7 O;  1I94 B;  5LYJ A;  3JSN A;  2XAF A;  1KYO F;  2JDI G;  3FAV B;  4U7O A;  2P5O A;  4BR6 A;  1SC5 B;  3JAS B;  1R3J C;  1YJW V;  4GX0 A;  4LP8 A;  1FXH A;  1PV0 A;  1MOF A;  1K33 A;  3SPJ A;  1CPY A;  3ABL B;  4FPP A;  1I5Y A;  4YHH B;  2UXB O;  5B1B C;  1L1F A;  1BGY H;  1IUR A;  1NH2 B;  2ODM A;  1YTF D;  2G38 A;  1Z5V A;  2NN4 A;  1AVM A;  5KHG A;  1XHZ A;  4DV6 O;  3AG1 B;  3ETG A;  5EC2 C;  3ZHS A;  1KC8 W;  3W7U A;  4G28 B;  3RVZ A;  2EIK B;  1KP3 A;  2RQ6 A;  4J10 A;  2EIN C;  1E1R G;  1PM9 A;  3GWO A;  3LSS A;  2GSM B;  5J2U A;  2JRI A;  2E76 B;  3OMA B;  1BSM A;  4DR3 B;  2VWK A;  1OCZ C;  4FLZ A;  4F6R A;  4LF7 B;  2ADP A;  1XMQ B;  3K08 A;  1N4C A;  1WLE A;  4KUM A;  4O4I A;  3BY6 A;  1N36 O;  2EBO A;  5CMU A;  2W6I G;  2YIA A;  2Q5Z A;  3OAA G;  5EIB D;  2CK3 G;  1OZ0 A;  1Y76 A;  2BTQ B;  3ZHQ A;  3OR7 C;  1HR0 B;  1B06 A;  3BAB A;  3CC7 V;  2JGU A;  3T1H B;  1P4R A;  4WF9 V;  3QNE A;  4PHZ A;  4DR4 B;  1QCE A;  3JAS A;  1PL4 A;  4NXN O;  1Q6I A;  1DF5 A;  4NKG B;  1ZX3 A;  2F95 B;  2P6J A;  4R6Z A;  2DWE C;  3CCV V;  5GTI Z;  5IYD O;  2OCC C;  2DYS B;  4I7Z B;  4CC5 A;  1VEW A;  1R3I C;  1PNM A;  4X89 A;  2GTA A;  1R3K C;  4TT3 G;  3JAT B;  4LH7 A;  3WG7 C;  4DR5 O;  4MT8 A;  1ZL8 B;  4UCV A;  2ZR3 A;  4WFE A;  2QM8 A;  2UUC O;  1XHX A;  1YF2 A;  4MW3 A;  4NXM O;  3P32 A;  3W7W A;  2Q7E A;  4X1K B;  4W4K A;  1Q6U A;  3VOU A;  2QR4 A;  4GX5 A;  1SS3 A;  4K8Z A;  1NU1 H;  1M56 C;  1SQV H;  2HKO A;  3JD3 A;  2YS8 A;  4LC1 A;  4TOI A;  1AR5 A;  3DC5 A;  4RUF A;  3CE2 A;  1W2B U;  4X9Q A;  1PNL A;  5IDJ A;  5E1A C;  5BXZ A;  4OGQ B;  3TJT A;  2VQE B;  1BE3 H;  1RSO B;  1H2N A;  4IT5 A;  2BSK B;  3CRM A;  2BTQ A;  4B3S B;  3ZRW B;  2R70 A;  3UCS C;  2AZ2 A;  2AZ0 A;  2YXH A;  2XTA A;  3HKB B;  4GYC B;  1ZWI C;  1OJH A;  1I08 A;  4JTD B;  4DUY O;  3JAR B;  5BMV B;  5IWA B;  3FYI B;  2ZR2 A;  4MTG A;  1J5E O;  2GBO A;  3SPG A;  3KCY A;  3FYE B;  1RPR A;  1XI1 A;  3H1H H;  2LFS A;  2LW7 A;  4C7U A;  5L3C A;  5IYZ B;  1D5N A;  3GWK C;  5L3E A; 
#chains in the Genus database with same CATH homology
 1KKC A;  3KKY A;  3KDR A;  1WB8 A;  2RCV A;  1XRE A;  1XUQ A;  4BR6 A;  1P7G A;  1EM1 A;  1VEW A;  1AP5 A;  1LUW A;  2AW9 A;  5A9G A;  3EVK A;  3DC6 A;  3C3S A;  1LUV A;  4JYY A;  2ADQ B;  1IDS A;  1MMM A;  1EN4 A;  3AK2 A;  3IC9 A;  1GN4 A;  1GN3 A;  1IX9 A;  4F6E A;  1JA8 A;  1AVM A;  2QKA A;  4JZG A;  1EN6 A;  1N0J A;  3AK1 A;  1XDC A;  2QKC A;  3C3T A;  4GUN A;  1MSD A;  1AR5 A;  3DC5 A;  1JR9 A;  1AR4 A;  1ZLZ A;  1PM9 A;  2CE4 A;  2CDY A;  3AK3 A;  3OT7 A;  1QNM A;  4X9Q A;  1BT8 A;  1BSM A;  3LSU A;  1ZSP A;  3TJT A;  1ZUQ A;  2ADP A;  1ZTE A;  5AG2 A;  1Y67 A;  3QVN A;  4E4E A;  4YIP A;  1EN5 A;  1XIL A;  4JZ2 A;  3CEI A;  2P4K A;  1I08 A;  1WB7 A;  1IXB A;  1I0H A;  1N0N A;  1B06 A;  3MDS A;  3BFR A;  4YIO A;  1BS3 A;  3K9S A;  1MNG A;  4FFK A;  4C7U A;  1PL4 A;  1VAR A;  2GDS A;  1SZX A;  1GN2 A;  1D5N A;  3RN4 A;  1AP6 A;  1MA1 A;  1GN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...