1QNMA

Human manganese superoxide dismutase mutant q143n
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNNDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Probing the active site of human manganese superoxide dismutase: the role of glutamine 143.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 69
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1qnmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1qnmA02
5A9GA 4GUNA 1JA8A 4F6EA 3KKYA 1AR4A 1WB7A 2QKCA 1XREA 1EN6A 1WB8A 1JR9A 3OT7A 4JZGA 1EN4A 3K9SA 1XUQA 1XDCA 1N0NA 1AVMA 3DC5A 2GDSA 1I08A 4JZ2A 5AG2A 1KKCA 2CDYA 1MSDA 1AR5A 1ZUQA 1QNMA 3AK3A 1BT8A 3TJTA 1B06A 2ADPA 1VEWA 4E4EA 1XILA 3QVNA 2ADQB 2QKAA 1GN2A 1I0HA 1P7GA 1IXBA 4YIOA 1GN6A 1IDSA 2P4KA 1Y67A 1PM9A 1GN3A 1MNGA 1VARA 2AW9A 3AK2A 1EN5A 1ZLZA 2RCVA 4JYYA 1LUVA 2CE4A 1ZSPA 3MDSA 1MMMA 3CEIA 1AP5A 1D5NA 3LSUA 1AP6A 4X9QA 1N0JA 1IX9A 4C7UA 1BS3A 1MA1A 3DC6A 3IC9A 3EVKA 1ZTEA 4BR6A 1SZXA 4FFKA 3C3TA 1PL4A 3C3SA 3BFRA 3RN4A 3AK1A 1EM1A 1GN4A 1LUWA 1BSMA 4YIPA
chains in the Genus database with same CATH superfamily
4NTXA 5BMVB 3WFVA 3L74H 2F95B 2ITDC 5IJ9B 3CWBH 2ZQMA 1B6QA 2AZ0A 2IBZH 4LR3A 2CK3G 5KHGA 2B1GA 4DV7B 4JI6O 3ZHUA 3ZRSA 5IWAB 1FFXB 4P9OA 1QU7A 1M56C 1BT8A 1YITV 1I7FA 1VP7A 1YEWA 4GZRB 2QM8A 3JYCA 4MT8A 2KQXA 2Y4TA 3CMEV 4UCUA 2PTMA 1SF9A 2EIMC 4I55B 4MVQA 4J11A 1KB9F 2XAGA 3UCSC 1IBKO 2ILMA 1IBMO 2PYJA 3CCEV 4JV5B 3DXRB 1D2DA 4LF9B 2UXXA 1HNZB 2AW9A 3AK2A 5KA6A 4LWSA 3ZMSA 3K9AA 2P22C 4JI4O 3E22B 5EK0A 1ZSPA 3JALB 1BHBA 1KP2A 1W0KG 5LMNO 3LSUA 4DR1B 2IH1C 2DW4A 1I94B 4DK1A 2YC0A 1JFFB 3EFFK 3TGUH 1R73A 2YIBA 1VF6C 4TSFG 2WLKA 5JJEB 2H94A 4PA9A 2WLMA 2CH7B 4D6TH 2P06A 2D3OW 5LL6Y 3ZCCA 5HFMA 4O4JA 4DV1O 3ASNB 2LGQA 3HPLC 3K5MA 1CP9A 4NKGB 4I0XB 1N4CA 3VQWA 4K0KB 4FIPC 5LGTA 5IJ0B 4LF7O 3AG2B 5LYJB 1S3JA 2EJRA 1FXKC 1P4RA 4JZ2A 2CDYA 3FD9A 1SERA 1IXMA 3UO3A 2WA3A 1G1XB 4B3TB 2X6BA 3JD2A 5EIBC 4NVPA 3LNNA 3E8FA 3D3QA 4J9ZB 5A2QN 4F6RB 3X2QC 1XILA 4DUYO 1GMGA 4BIZA 1K33A 3ZRWA 4DR6B 1NU1H 2BTQB 1TUBA 2KG7A 4B3RO 1OCOC 1SETA 4QJFB 5CBFA 1K34A 1Y67A 4KL1A 4PDRA 4JAVA 4WFAV 2EBOA 4U3JA 1MNGA 2JEXA 5J2UA 1DGSA 2ODMA 1EN5A 5CA3A 2Q5ZA 3LSSA 1W2BU 2RCVA 3JD1A 3OTOB 2JJ2G 1US6A 2UXCB 3MDSA 2CUGA 2WSSG 2VQEO 4FJCC 3AG1C 3T1HO 1N0JA 5K1PA 1TUEB 1QR8A 3CXHF 1Q3EA 4N23A 2ZIOA 4FZ1A 4D7TA 1RSOA 2XNDG 2ZNIA 3ZJZA 1ZL8B 2JK5C 4X62B 4RQFA 4LF8B 1G8MA 3SYCA 3JARA 4GT1A 3K06A 5KMGB 2WAMA 2WLHA 2VWJA 4BW5A 4FLUA 2Q4PA 3ABMB 5B5EZ 1EM1A 3FKSG 2GSMB 3G6BA 5BXZA 1YSCA 2WPDG 4I7ZB 2ZXWC 2QM7A 1TVKA 4RAIA 1JCHA 1Q81W 1Z5VA 3ETDA 2WLIB 3RW0A 3IAYA 3F7VC 4BIOA 2HVKC 3VBBA 2JS3A 1PP9H 1Q8IA 2F4VO 5B3SC 3BY6A 4YY3B 2DQ3A 4PA7A 2GDSA 2QA4V 1ENVA 4FLYA 2YI9A 3K04A 4N21A 3RYHB 3D3IA 1NTZH 2CAZC 2DYSB 4B08A 3H1KH 1VQPV 2L6LA 4MTOA 1YDXA 4NYKA 1PNKA 1H2NA 3QG5A 3QVNA 3ETEA 4CH3A 1XNRB 1NVPD 1CXZB 2F43G 3J81N 2QGNA 3JASB 2UXDB 2Q7EA 5BZBA 3OGIB 5DECA 3B2EE 3FAVB 4Q6GA 3RGBA 1I5XA 4CH6A 3AG3B 4ZI7B 1R3LC 3GVMA 3K58A 2Y69C 4JI3B 1COWG 3W7SA 5LXTA 1VQ8V 1MMMA 4DV0O 1JOYA 1FAFA 1W0JG 4FFBA 1NBMG 2XAHA 2DE0X 4B7EA 4O2BA 3IC9A 2D2CB 5IE9A 4IIJB 2ZM6B 2RNBA 1TUBB 4BR6A 4JAAA 4DR5B 1KP3A 1OZ0A 2O57A 4X66O 3OMNB 1XMOB 3RN4A 4B3SO 1SS3A 1QVGU 4LCUC 3H1HH 4WFEA 5B66Z 4UV9A 1VQOV 3RBZA 2BTOA 4JI0O 1CEZA 5GTHZ 3G67A 1K5QA 5B1OA 4A5UB 3BA8A 3L72H 1GM8A 2OTJV 2EINB 4DV6B 1NT2B 1GK9A 4LF5O 2IM9A 3CCUV 2EX3A 1ZUQA 3W7WA 2QE7G 3QF7A 4X1IA 1M57B 1EZJA 3EXAA 5LA6B 1FJGO 4HBNA 1Q90D 1Q86W 1VQ4V 1PKXA 1TVKB 1GTOA 4LFBO 4EB6A 3ZBHA 2X7RB 1HDJA 2PF4E 3E8HA 1NS1A 5DN6G 4UUJC 2DWDC 3CCQV 3CP1A 2Z5UA 1V54C 1OCZC 1WPXA 1JX9A 2DYRC 5IY5C 1Z5WA 2N04A 2ZKOA 4EFBA 3DTUB 4I4TA 2AXTZ 1JQ0A 2HJDA 4HNAA 3CCSV 4OGQB 1PPJH 4TUYB 1DK1A 3CC2V 3JCUZ 2WLLB 5JVDA 5JJNB 2FKXA 1MABG 2Q67A 2A0LA 3L70H 1J5EB 2E76B 3OW2U 1DF5A 1BS3A 2PGGA 4BW9A 4FPPA 3W7XA 5IDJA 2LQTA 1YJNV 4B7KA 1YCIA 2YI8A 3RYCB 5BMVA 4ZBMA 2HP8A 2JIZG 1FFTB 5IJ9A 3AG4B 4WFHA 4DR7B 3J7AU 5EBLC 3KZIZ 4TQDA 1Q7YW 1M93A 3G80A 4PV1B 1QR9A 3SPCA 4HYOA 2Q9LA 2E5LB 4X89A 1JA8A 4KFMA 1P84F 4PI2A 2ZDIC 2BCCH 3JAKA 3L71H 3BHPA 4JTCB 1FFXA 4CS3A 1XL4A 4B3MO 5B1AC 3OE7G 5CMUA 4DR4O 3B4SA 1FKAO 3M7MX 1AROP 1SRYA 1XDCA 4IGGA 3P3PA 3D8CA 5TISZ 5DM6V 4YJ3B 1THZA 4LFCO 1MG1A 1WLEA 4J7ZA 5CA1B 3L73H 4DR3B 1KBHA 3P30A 4I55A 3JAWB 1SQVH 1F23A 4U7NA 1R6KA 3DXRA 2ITCC 2QKAA 3S3WA 1JVMA 1L8DA 3E8GA 4PD4F 4LNUB 4GCZA 4DV5O 4UVAA 2EULA 3D36A 2QR4A 5KAFZ 4FLXA 2HEPA 3E22A 5LHHA 4GX5A 1R6NA 2PI4A 4ZHQB 1M1KW 1N32B 1MOFA 2R70A 3ASNC 1MSWD 1NQTA 3ZHRA 1URFA 5L3EA 5CB4B 3S3XA 3SYPA 2IU0A 4L87A 3AG2C 1JFFA 5LMUO 3CCRV 2ZIMA 1KU9A 2GV9A 5BR8O 4MS2A 2YDEA 1Y6XA 4Z1VA 5F2VO 5KHIA 2VWKA 2X0LA 4KXRA 2DOSA 2CH7A 1GO3F 3I56V 1HNXO 3DSQA 3TXQA 2XAJA 2FMLA 4JYBA 3G4SV 4NR1A 2JGDB 4LF6B 1KD1W 3CD6V 1KUQA 1VIBA 4I4TB 1NJIW 3K3WA 4OPAA 1BMFG 2EILC 4I0XA 4JV5O 4JI1B 2ETNA 5A9GA 3F7YC 5IJ0A 1SA0B 5FPOA 5LYJA 3K59A 4LF9O 3JSNA 4LF4O 2F1MA 4CC5A 2GTAA 4LC1A 4H33A 3OT7A 4K8XA 3OUSA 1MZEA 2UUCO 2F93B 1PNLA 4ZOLB 4LFAO 4D7SA 3ABUA 4JYAO 2YEVB 1Y4MA 2ZE5A 3CRAA 4ZKIA 1FD9A 4I5SA 1I94O 4DXWA 2UUAB 2YIAA 3L9DA 1QNMA 1XNQB 3T1YB 4MVZA 4DUZB 3STLC 1XMQO 4G28B 3ML0A 2BTQA 4X64O 1AI6A 3LUTB 3KDRA 1GN2A 2V4DA 4NXMB 3JAKB 1RM1B 3HKCB 2ZR2A 3K0GA 2H3OA 4DW1A 1HNWO 3JSLA 1IBLB 2LGWA 4JI2B 1HR0B 4F4LA 4JI7B 1VARA 2Q0OC 1AB3A 4W4KA 2KB1A 4J9YB 4LP8A 3JAMN 2W6JG 4UCTA 3B8MA 3W7TA 1AP5A 1ZL8A 3UT5A 2RJZA 4H13B 3ZX6A 4OXSA 5EC1C 5KMGA 4B3TO 2Y48A 1XEQA 1OCRC 2UXNA 3CS5A 2YUAA 2Q69A 3IC7A 4FLZA 3CHXA 4BIUA 3LSQA 2WLIA 5EYPB 3R65A 5JQGB 4FK5C 2PYLA 1NTKH 2V1DA 3PJSK 4YHHO 3ABKB 2QTSA 1JMKC 4JI8B 2EIKC 1XREA 4DV2O 3RYIB 1X59A 3P32A 2R9IA 2Q68A 3AG3C 3PN1A 3RYHA 2E3CA 4FLWA 3ASOB 2LW1A 1QLEB 3APOA 1SQXH 2PZSA 1UJWB 3WB1A 3T4ZA 5FNVB 1M90W 5CBGA 3ZHVA 2CTWA 1R3IC 2V7QG 3HR0A 1B06A 1BHAA 2FL4A 4X20B 1N34O 3JASA 5DEDA 1H2LA 2OWOA 4AQYO 4GX0A 4LF8O 2YIBD 3BVOA 2OCCB 4AHCA 4JI6B 1K73W 3FB6C 3A2FA 3FAVA 4GYCB 1VQKV 1ZX3A 4ZI7A 1GKFA 3ZN1A 3H1LH 1IDSA 4J7JA 5D5QA 4FM1A 3CB2A 4GKKO 4LH6A 4IYIA 3OM3B 3TETA 4DV3O 3SDLA 4JI5O 4IL6Z 2HHHO 4I50B 4IIJA 1IBKB 1VF6A 5KA5A 3CX5F 3RFRA 1HP8A 4DK0A 1V55B 3APQA 1H2GA 3JCZA 5B1BC 3ETGA 3C3SA 3ABLC 1OV9A 5J2TA 2EIJC 3F5WC 3CRQA 3JATB 4UCVA 4WFBV 2P7TC 3ZEDA 4GUNA 2XAFA 2OCHA 2Y0IA 4P2ZA 3OTFA 1YF2A 5EZYB 3QO8A 4JI3O 4U7OA 4JTAB 3UT5B 1XL6A 4CS4A 1QLNA 2RQ6A 5LBQA 3P3NA 5LA6A 2VS0A 4XDLA 3M99B 1NZ6A 1Y74B 5LP6B 2WLJA 1GAXA 1H8EG 2AHZA 1BL8A 2DMXA 3AK3A 2M6YA 5JCOA 1NH2D 4DV1B 2QSAA 5LOVA 4XDJA 1QHTA 4EKWA 1H2SB 4LF7B 2UXBO 5EIBD 3K5LA 2UU9B 1BQ0A 1I0HA 4PDLA 1P7GA 4IHJB 1M56B 4TUYA 2QDOA 1V9PA 2WLLA 5GTIZ 4R8CA 4P9PA 2RDCA 2M7WA 1R6TA 4DR2O 4I9QA 3A0RA 1G6UA 4DUYB 3ZMZA 4L8JA 3MHSC 2EIMB 3U0ZA 4MTFA 3CPWU 1CPYA 1FXVA 3A8TA 3OEEG 5CA0B 3E86A 1G4YB 2G38A 5KHJA 3RYCA 3HKEB 2CTRA 3NR7A 1H2MA 4MW8A 4YJ2B 2ATKC 2Q7GA 2JEUA 2NN4A 2RMKB 1OCCC 2HR3A 3CRCA 3L75H 3AG7A 4H44B 4K3AA 3ZRXA 4QGPA 3AK1A 3SR2C 2VQEB 1UPGA 3T1HB 1RPOA 4JAUA 1YXBA 4FZ0A 3WB2A 2LW7A 4F6EA 3HKBB 3G71V 4W4LA 1AR4A 2HFEC 4YJ3A 3OUFA 2A79B 5CA1A 1N0NA 3GB7C 2PY5A 1T5EA 2ZR3A 4UB6Z 4HAMA 3DC5A 3JAWA 4MW3A 1AI7A 4JTDB 4QPKA 2HG5C 4PELA 5H6QA 3RYFB 3SJAC 2CTQA 1F7YA 3JD0A 3ZMTA 1UFIA 1KYOF 1TAEA 3WG7C 5J2TB 4LNUA 2OTLV 3CC4V 2F4VB 5JJJB 3E8BA 4ZHQA 1E1QG 1NH2B 2DQ0A 3OEHG 5EC2C 1XHXA 1Q5OA 5CB4A 4R7CA 2X6AA 4HZ3A 1IZ3A 2GTSA 4MVSA 1GN3A 2YIDA 5KHHA 3X2QB 1ZLZA 2B5UA 5D5PA 3SYAA 5H6RA 3JD4A 3SJBC 1LUVA 3QO5A 1FYJA 2GHYA 2GBOA 1AJPA 4U3FH 4UCOA 5LOVB 5KAIZ 1OCOB 2JDIG 1VQ6V 4C7UA 4MVRA 1S76D 4GKJO 2JGDA 4DR3O 2GUZB 2VRZA 1YJWV 2CTPA 3E83A 1SA0A 3AG1B 4DV0B 1LNQA 4OX9B 1LUWA 4ZOLA 3H9VA 1N32O 1PD3A 1O9HA 2YEVA 3RT3C 4QPJA 3UM7A 1WAZA 2A3QA 5ITZB 1SC5B 3R66A 4X66B 2MK3A 1JJ2U 4O2AA 1VF5B 2ZXWB 5L3CA 1JJOA 5KX5B 4UV8A 3ZRVA 3CCMV 4RQEA 1MSDA 1N36B 2E75B 2R9AA 4JI0B 1Q43A 1EFRG 3FYEB 3HKCA 1S72V 5B3SB 2Q6AA 3BCCH 3D36C 1NI8A 4TV8B 4DV4O 4RUEA 4QE7A 4QNHB 2JS5A 4Z1MG 2Q7HA 1BCCH 1YTFB 3VQXA 3UO2A 3EHBB 4JF3A 4ZIBA 1N8RW 3T2MA 3KCYA 1N33O 3HB3B 1KC8W 1W59A 2XUMA 3ZIAG 1D5AA 2OT5A 1NR1A 4PHZA 3Q4HA 4WFGA 2UUAO 2EJ7A 3TK1A 3DC6A 5EYPA 5JQGA 2Y69B 1JNBA 2LP7A 4H0LB 3CYOA 4DV7O 4NB5A 5E79Z 4TT3G 4O4LA 4RUFA 3RYIA 3MAQA 1A32A 5IWAO 2VQFB 3FYIB 1HR0O 2N05A 4KHPB 2QEXV 2ZE6A 5FNVA 1WB8A 2PI5A 3QO7A 3E89A 1FXHA 4CBCA 1VQLV 2C2AA 1E79G 4RO2A 1XUQA 1OHHG 4JASA 4FVMA 1FS0G 4X20A 4K8ZA 3SPHA 2AHYA 3I5DA 5KUMA 1IVSA 1I08A 2ZNJA 3CCVV 1K4CC 1YHQV 1DLBA 4AI8A 4MSWC 1PNMA 4UCRA 5KUKA 5JH7B 1HNZO 1VEWA 3K03A 4E4EA 4B3MB 5C93A 4O4IB 5LGNA 4DR4B 4IT5A 4TOIA 3B8NA 2QWNB 4DR1O 1WPBA 2QWPB 4LFCB 2OIEA 1Q6HA 1JPXA 1KMIZ 1PM9A 2JVDA 4JI8O 4O2AB 4KP4A 2YXYA 5EBMC 4I50A 2E74B 3N2KB 2QWRB 4X1KB 1XHZA 1P7BA 5B1NA 1YVWA 1V54B 3ABMC 3ZHQA 3CCLV 4X9QA 1L0NH 1OCZB 2DYRB 5IY5B 5L3BA 1U96A 2XHBA 1K4DC 3SGIA 2QWQB 1S0VA 1M4UA 3ZMUA 2UUBB 4BWAA 3CMAV 3JATA 5H9CA 1BZKA 1ZAUA 2JJ1G 1YZBA 1H8HG 1Y66A 4K0KO 4O4HB 3BFRA 5IYDO 4NXNB 5LMUB 3BEHA 3OMAB 2YSUB 1AR1B 3OFNG 2XAQA 5EZYA 5BR8B 3ZS8C 3LDDA 3VQVA 2P6JA 2DYSC 4K35A 1XBLA 2ZE8A 1PV0A 1Y74A 5LP6A 2B1IA 5LGUA 1HNXB 1OJHA 3Q4HB 1EN4A 3ZHSA 5L3FA 3SYOA 4DR6O 1WJZA 4TQFA 3CC7V 3HKDB 5AG2A 1P49A 2RN9A 1BQZA 1XQ8A 2L35A 1K3EA 4UB8Z 5J9PC 1K92A 3CJHB 4LF4B 4UVCA 3G6EV 1X4TA 2ZINA 4O4LB 1S5HC 3H1JH 3QTCA 4IHJA 4GLXA 2UUCB 5B1AB 4LFAB 2ADQB 3ETQA 4JYAB 1R3JC 3OTOO 2FTKA 2UXCO 4X65B 1Y76B 4P30A 2EZPA 2Q8VA 1AILA 1XMQB 3OR7C 2IU3A 1Q82W 1F4MA 4X64B 4CS2A 5CA0A 4X62O 5FL7G 1IURA 3HKEA 4TV9A 4PDMA 4YJ2A 5C8YB 2EZOA 4CZZA 1B3QA 3H1IH 1HNWB 4IYHA 1WA8B 3A0BZ 3SPJA 1VQMV 2Y0PA 4CH4A 3TCUA 1EZVH 1E1RG 2FYUH 3FB8C 2UU9O 4G27B 1L1FA 2N74A 3HKBA 2F23A 4J42A 1TGOA 4YY3O 1GN4A 1AJNA 5GONB 2EINC 2W0FC 1K7DA 1IBMB 4LBEC 1KECA 1WN7A 4FLVA 1M57C 1K8AW 4DYLA 2IJKA 1L0LH 2B9ZA 4JZGA 4WBNB 1RPRA 1GH6A 1GRJA 3RYFA 3B77A 4JI4B 1XNRO 3STZC 1SQGA 1H38A 3MD0A 4GX2A 2EILB 3VQYA 5JCOC 1K9MW 5LMNB 3SJCC 2UXDO 1AR5A 4YHHB 3TJTA 1VQ5V 1FXKA 2ADPA 4DV2B 2BSKA 5LHIA 3BPZA 2YICA 3CCJV 1YIJV 4DRXA 1H5WA 4E2LA 4YIOA 4JGSA 3OR6C 1B04A 4PI0A 4X1YA 4ABMA 4R6ZA 4NTYA 1N34B 1VQ7V 3QNEA 1QVFU 2R9RB 2IJHA 4UVBA 2HKOA 2ZM6O 4AQYB 5KHKA 5IT9N 3BAAA 3T1CA 1DTOA 4DR5O 2LFRA 2CE4A 2BOBC 1GM9A 3ICXA 2F66C 2GUZA 1XMOO 3CEIA 4J10A 3AG4C 1BGYH 4LWSB 1GM7A 3SYQA 2LJ2A 4JPRA 4EEQA 4BAYA 5CBHA 1NR7A 1KKDA 3EVKA 3B09A 4GKKB 3CE2A 1SZXA 2ZD9A 4DV3B 3J80N 4JI5B 2LO1A 2HHHB 4DV6O 4FMTA 2P5OA 3K5NA 5ITZA 4B3RB 1OCRB 2XTAA 3ZHTA 3KKYA 2YXHA 4TV9B 4PA6A 1WB7A 3W7UA 4DO2A 1WP8A 1ZWIC 5KX5A 5GW7A 1JR9A 4WCEV 2Q73A 1RFYA 3O65A 2ZT9B 3FX7A 4FM2A 4O4JB 3U10A 1S77D 3SPIA 2WA4A 2ZE7A 1KKCA 2KKWA 3A0HZ 4PDVA 5BY1A 3CXCU 2EIKB 4TV8A 3H01A 3ABTA 1U97A 1WNSA 3KCXA 2P90A 4JYCA 1SESA 2ZCEA 5L3DA 3LDEA 4X88A 2W6IG 3UKMA 1VF7A 3CRMA 2XASA 2QM4A 4OX9O 1F51A 1J5EO 3I55V 5IYCO 3ZRWB 4PJ0Z 2A06H 4XBFA 2KG7B 2LFSA 1YTFD 4JYYA 1Q6UA 3WB0A 2UXBB 3LNMB 2KSDA 1FXKB 1R1BA 4U3JB 4DR7O 2BSKB 5J2UB 1DF4A 4NTWA 5FPRA 1N36O 4QE9A 4GX1A 3NXSA 2E5LO 1MA1A 1SQBH 2HVJC 2IH3C 1K5SA 4H37A 4DRXB 2JRIA 4DR2B 3CRRA 4FFKA 2JGUA 3KG2A 1F4NA 4J80A 1QQCA 4PA4A 1RSOB 4X1YB 3T4DA 4XDKA 4WFFA 3E2EA 1BE3H 3ZMVA 2AGAA 2QTOA 4AILC 1MZFA 3K57A 3JARB 1YI2V 3IFXA 4YXWG 1AJQA 5B1BB 1YJ9V 5H2FZ 2ARHA 4MTGA 3RVYA 3ABLB 3K9SA 1AI4A 2P4VA 1VMGA 2EIJB 1AVMA 4MTXA 4ASUG 3JD3A 5JH7A 5IYZA 3N27A 1EBOA 1RM1C 2NR5A 3TXSA 4RWUA 4OPHA 2OIGA 3MHHC 4O4IA 1NVPB 2XT9A 5H5NA 5K1XA 2R72A 4KUMA 1I5YA 5KLVH 2X6CA 1TA8A 1H2KA 4QIWF 5HFLA 3K79A 4B3SB 3N2GA 2BOCC 3SJQC 1IXBA 3OAAG 4I9WA 3N2KA 4X1KA 2VQFO 1VQNV 3CSXA 4KHPO 2K9PA 5E1AC 3WU2Z 2HJFC 1ROPA 1Q6IA 5IYBO 4MVOA 3M8AA 3K5OA 4LF6O 3ZN0A 4J41A 2CGOA 2Y4UA 3DGEA 4LF5B 2CGNA 1KQSU 3GWOA 1IX9A 4JI1O 3RVZA 4O4HA 2K1EA 5LXTB 3ABKC 1SQPH 1FJGB 4PA3A 4UXNA 2Z0AA 3K08A 4G2KA 4MVUA 4FFBB 1O9GA 1M5IA 4LFBB 3C3TA 4Z2WA 3ASOC 2OYQA 1QLEC 4O2BB 4ICGA 1SQQH 3BA9A 4YIPA 2BE3A 1HWYA 2DWEC 1NTMH 4GKJB 1XNQO 3FFQA 5CN0A 3T1YO 1OCCB 4CC6A 2QKSA 4DUZO 2QKCA 1PL0A 3IGAC 4UCSA 5LHGA 1EN6A 3HKDA 5L3GA 3F5TA 3THOA 3VOUA 2ZDIA 5JWPA 4EFEA 3CJHA 2OCCC 3BABA 4J7KA 4X8AA 2NLJC 2QJ1A 4NXMO 2IW5A 3E35A 1S5JA 1R3KC 1IBLO 2XOKG 3OMIB 3JALA 5FLXN 3LDCA 3B40A 1VQ9V 2DN9A 4JI2O 2AZ2A 2W0XA 3OGCC 3U11A 2UUBO 4JI7O 1K97A 1Y76A 3BRCA 3GWKC 2YXLA 2WLNA 3IJ4A 3RWRD 4X1IB 2Z3YA 4NXNO 1WP7A 4UFZA 4WF9V 4DW0A 4CH5A 4EB6B 1IJGA 1GN6A 2WWWA 2P4KA 3C90A 3OD4A 2IJJA 5EBWC 3WG7B 4FM0A 4FLTA 1SZTA 5C8YA 2DJVA 2Q0AA 1V55C 4LH7A 5IYZB 1XI1A 2IJIA 1SQFA 3AEIA 1AI5A 1Z2GA 3FB7C 1J95A 4TWKA 4DV4B 1WA8A 2PUSA 4HNAB 4R50A 1LR1A 1D5NA 1QCEA 1AP6A 3SPGA 1M9NA 2MW2B 1SKVA 2QWOB 1QBZA 2FB5A 3O9OA 1HW7A 3FB5C 1NKDA 4Q20A 2NNUA 1FPOA 2A9HA 1S5LZ 5JVDB 1ZTEA 3N2GB 5GONA 2P67A 1RP3B 1N33B 1FOUA 2A7WA 3K0DA 1PL4A 1XOUA 4X65O 4MVMA 2HLDG 2H8PC 4DV5B 1BSMA 2YS8A 4F6RA 1ORQC 5LP6C 4WBNA 3UQ8A
chains in the Genus database with same CATH topology
5A9GA 4GUNA 1JA8A 4F6EA 3KKYA 1AR4A 1WB7A 2QKCA 1XREA 1EN6A 1WB8A 1JR9A 3OT7A 4JZGA 1EN4A 3K9SA 1XUQA 1XDCA 1N0NA 1AVMA 3DC5A 2GDSA 1I08A 4JZ2A 5AG2A 1KKCA 2CDYA 1MSDA 1AR5A 1ZUQA 1QNMA 3AK3A 1BT8A 3TJTA 1B06A 2ADPA 1VEWA 4E4EA 1XILA 3QVNA 2ADQB 2QKAA 3KDRA 1GN2A 1I0HA 1P7GA 1IXBA 4YIOA 1GN6A 1IDSA 2P4KA 1Y67A 1PM9A 1GN3A 1MNGA 1VARA 2AW9A 3AK2A 1EN5A 1ZLZA 2RCVA 4JYYA 1LUVA 2CE4A 1ZSPA 3MDSA 1MMMA 3CEIA 1AP5A 1D5NA 3LSUA 1AP6A 4X9QA 1N0JA 1IX9A 4C7UA 1BS3A 1MA1A 3DC6A 3IC9A 3EVKA 1ZTEA 4BR6A 1SZXA 4FFKA 3C3TA 1PL4A 3C3SA 3BFRA 3RN4A 3AK1A 1EM1A 1GN4A 1LUWA 1BSMA 4YIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A9G A;  4GUN A;  1JA8 A;  4F6E A;  3KKY A;  1AR4 A;  1WB7 A;  2QKC A;  1XRE A;  1EN6 A;  1WB8 A;  1JR9 A;  3OT7 A;  4JZG A;  1EN4 A;  3K9S A;  1XUQ A;  1XDC A;  1N0N A;  1AVM A;  3DC5 A;  2GDS A;  1I08 A;  4JZ2 A;  5AG2 A;  1KKC A;  2CDY A;  1MSD A;  1AR5 A;  1ZUQ A;  1QNM A;  3AK3 A;  1BT8 A;  3TJT A;  1B06 A;  2ADP A;  1VEW A;  4E4E A;  1XIL A;  3QVN A;  2ADQ B;  2QKA A;  1GN2 A;  1I0H A;  1P7G A;  1IXB A;  4YIO A;  1GN6 A;  1IDS A;  2P4K A;  1Y67 A;  1PM9 A;  1GN3 A;  1MNG A;  1VAR A;  2AW9 A;  3AK2 A;  1EN5 A;  1ZLZ A;  2RCV A;  4JYY A;  1LUV A;  2CE4 A;  1ZSP A;  3MDS A;  1MMM A;  3CEI A;  1AP5 A;  1D5N A;  3LSU A;  1AP6 A;  4X9Q A;  1N0J A;  1IX9 A;  4C7U A;  1BS3 A;  1MA1 A;  3DC6 A;  3IC9 A;  3EVK A;  1ZTE A;  4BR6 A;  1SZX A;  4FFK A;  3C3T A;  1PL4 A;  3C3S A;  3BFR A;  3RN4 A;  3AK1 A;  1EM1 A;  1GN4 A;  1LUW A;  1BSM A;  4YIP A; 
#chains in the Genus database with same CATH topology
 4NTX A;  5BMV B;  3WFV A;  3L74 H;  2F95 B;  2ITD C;  5IJ9 B;  3CWB H;  2ZQM A;  1B6Q A;  2AZ0 A;  2IBZ H;  4LR3 A;  2CK3 G;  5KHG A;  2B1G A;  4DV7 B;  4JI6 O;  3ZHU A;  3ZRS A;  5IWA B;  1FFX B;  4P9O A;  1QU7 A;  1M56 C;  1BT8 A;  1YIT V;  1I7F A;  1VP7 A;  1YEW A;  4GZR B;  2QM8 A;  3JYC A;  4MT8 A;  2KQX A;  2Y4T A;  3CME V;  4UCU A;  2PTM A;  1SF9 A;  2EIM C;  4I55 B;  4MVQ A;  4J11 A;  1KB9 F;  2XAG A;  3UCS C;  1IBK O;  2ILM A;  1IBM O;  2PYJ A;  3CCE V;  4JV5 B;  3DXR B;  1D2D A;  4LF9 B;  2UXX A;  1HNZ B;  2AW9 A;  3AK2 A;  5KA6 A;  4LWS A;  3ZMS A;  3K9A A;  2P22 C;  4JI4 O;  3E22 B;  5EK0 A;  1ZSP A;  3JAL B;  1BHB A;  1KP2 A;  1W0K G;  5LMN O;  3LSU A;  4DR1 B;  2IH1 C;  2DW4 A;  1I94 B;  4DK1 A;  2YC0 A;  1JFF B;  3EFF K;  3TGU H;  1R73 A;  2YIB A;  1VF6 C;  4TSF G;  2WLK A;  5JJE B;  2H94 A;  4PA9 A;  2WLM A;  2CH7 B;  4D6T H;  2P06 A;  2D3O W;  5LL6 Y;  3ZCC A;  5HFM A;  4O4J A;  4DV1 O;  3ASN B;  2LGQ A;  3HPL C;  3K5M A;  1CP9 A;  4NKG B;  4I0X B;  1N4C A;  3VQW A;  4K0K B;  4FIP C;  5LGT A;  5IJ0 B;  4LF7 O;  3AG2 B;  5LYJ B;  1S3J A;  2EJR A;  1FXK C;  1P4R A;  4JZ2 A;  2CDY A;  3FD9 A;  1SER A;  1IXM A;  3UO3 A;  2WA3 A;  1G1X B;  4B3T B;  2X6B A;  3JD2 A;  5EIB C;  4NVP A;  3LNN A;  3E8F A;  3D3Q A;  4J9Z B;  5A2Q N;  4F6R B;  3X2Q C;  1XIL A;  4DUY O;  1GMG A;  4BIZ A;  1K33 A;  3ZRW A;  4DR6 B;  1NU1 H;  2BTQ B;  1TUB A;  2KG7 A;  4B3R O;  1OCO C;  1SET A;  4QJF B;  5CBF A;  1K34 A;  1Y67 A;  4KL1 A;  4PDR A;  4JAV A;  4WFA V;  2EBO A;  4U3J A;  1MNG A;  2JEX A;  5J2U A;  1DGS A;  2ODM A;  1EN5 A;  5CA3 A;  2Q5Z A;  3LSS A;  1W2B U;  2RCV A;  3JD1 A;  3OTO B;  2JJ2 G;  1US6 A;  2UXC B;  3MDS A;  2CUG A;  2WSS G;  2VQE O;  4FJC C;  3AG1 C;  3T1H O;  1N0J A;  5K1P A;  1TUE B;  1QR8 A;  3CXH F;  1Q3E A;  4N23 A;  2ZIO A;  4FZ1 A;  4D7T A;  1RSO A;  2XND G;  2ZNI A;  3ZJZ A;  1ZL8 B;  2JK5 C;  4X62 B;  4RQF A;  4LF8 B;  1G8M A;  3SYC A;  3JAR A;  4GT1 A;  3K06 A;  5KMG B;  2WAM A;  2WLH A;  2VWJ A;  4BW5 A;  4FLU A;  2Q4P A;  3ABM B;  5B5E Z;  1EM1 A;  3FKS G;  2GSM B;  3G6B A;  5BXZ A;  1YSC A;  2WPD G;  4I7Z B;  2ZXW C;  2QM7 A;  1TVK A;  4RAI A;  1JCH A;  1Q81 W;  1Z5V A;  3ETD A;  2WLI B;  3RW0 A;  3IAY A;  3F7V C;  4BIO A;  2HVK C;  3VBB A;  2JS3 A;  1PP9 H;  1Q8I A;  2F4V O;  5B3S C;  3BY6 A;  4YY3 B;  2DQ3 A;  4PA7 A;  2GDS A;  2QA4 V;  1ENV A;  4FLY A;  2YI9 A;  3K04 A;  4N21 A;  3RYH B;  3D3I A;  1NTZ H;  2CAZ C;  2DYS B;  4B08 A;  3H1K H;  1VQP V;  2L6L A;  4MTO A;  1YDX A;  4NYK A;  1PNK A;  1H2N A;  3QG5 A;  3QVN A;  3ETE A;  4CH3 A;  1XNR B;  1NVP D;  1CXZ B;  2F43 G;  3J81 N;  2QGN A;  3JAS B;  2UXD B;  2Q7E A;  5BZB A;  3OGI B;  5DEC A;  3B2E E;  3FAV B;  4Q6G A;  3RGB A;  1I5X A;  4CH6 A;  3AG3 B;  4ZI7 B;  1R3L C;  3GVM A;  3K58 A;  2Y69 C;  4JI3 B;  1COW G;  3W7S A;  5LXT A;  1VQ8 V;  1MMM A;  4DV0 O;  1JOY A;  1FAF A;  1W0J G;  4FFB A;  1NBM G;  2XAH A;  2DE0 X;  4B7E A;  4O2B A;  3IC9 A;  2D2C B;  5IE9 A;  4IIJ B;  2ZM6 B;  2RNB A;  1TUB B;  4BR6 A;  4JAA A;  4DR5 B;  1KP3 A;  1OZ0 A;  2O57 A;  4X66 O;  3OMN B;  1XMO B;  3RN4 A;  4B3S O;  1SS3 A;  1QVG U;  4LCU C;  3H1H H;  4WFE A;  5B66 Z;  4UV9 A;  1VQO V;  3RBZ A;  2BTO A;  4JI0 O;  1CEZ A;  5GTH Z;  3G67 A;  1K5Q A;  5B1O A;  4A5U B;  3BA8 A;  3L72 H;  1GM8 A;  2OTJ V;  2EIN B;  4DV6 B;  1NT2 B;  1GK9 A;  4LF5 O;  2IM9 A;  3CCU V;  2EX3 A;  1ZUQ A;  3W7W A;  2QE7 G;  3QF7 A;  4X1I A;  1M57 B;  1EZJ A;  3EXA A;  5LA6 B;  1FJG O;  4HBN A;  1Q90 D;  1Q86 W;  1VQ4 V;  1PKX A;  1TVK B;  1GTO A;  4LFB O;  4EB6 A;  3ZBH A;  2X7R B;  1HDJ A;  2PF4 E;  3E8H A;  1NS1 A;  5DN6 G;  4UUJ C;  2DWD C;  3CCQ V;  3CP1 A;  2Z5U A;  1V54 C;  1OCZ C;  1WPX A;  1JX9 A;  2DYR C;  5IY5 C;  1Z5W A;  2N04 A;  2ZKO A;  4EFB A;  3DTU B;  4I4T A;  2AXT Z;  1JQ0 A;  2HJD A;  4HNA A;  3CCS V;  4OGQ B;  1PPJ H;  4TUY B;  1DK1 A;  3CC2 V;  3JCU Z;  2WLL B;  5JVD A;  5JJN B;  2FKX A;  1MAB G;  2Q67 A;  2A0L A;  3L70 H;  1J5E B;  2E76 B;  3OW2 U;  1DF5 A;  1BS3 A;  2PGG A;  4BW9 A;  4FPP A;  3W7X A;  5IDJ A;  2LQT A;  1YJN V;  4B7K A;  1YCI A;  2YI8 A;  3RYC B;  5BMV A;  4ZBM A;  2HP8 A;  2JIZ G;  1FFT B;  5IJ9 A;  3AG4 B;  4WFH A;  4DR7 B;  3J7A U;  5EBL C;  3KZI Z;  4TQD A;  1Q7Y W;  1M93 A;  3G80 A;  4PV1 B;  1QR9 A;  3SPC A;  4HYO A;  2Q9L A;  2E5L B;  4X89 A;  1JA8 A;  4KFM A;  1P84 F;  4PI2 A;  2ZDI C;  2BCC H;  3JAK A;  3L71 H;  3BHP A;  4JTC B;  1FFX A;  4CS3 A;  1XL4 A;  4B3M O;  5B1A C;  3OE7 G;  5CMU A;  4DR4 O;  3B4S A;  1FKA O;  3M7M X;  1ARO P;  1SRY A;  1XDC A;  4IGG A;  3P3P A;  3D8C A;  5TIS Z;  5DM6 V;  4YJ3 B;  1THZ A;  4LFC O;  1MG1 A;  1WLE A;  4J7Z A;  5CA1 B;  3L73 H;  4DR3 B;  1KBH A;  3P30 A;  4I55 A;  3JAW B;  1SQV H;  1F23 A;  4U7N A;  1R6K A;  3DXR A;  2ITC C;  2QKA A;  3S3W A;  1JVM A;  1L8D A;  3E8G A;  4PD4 F;  4LNU B;  4GCZ A;  4DV5 O;  4UVA A;  2EUL A;  3D36 A;  2QR4 A;  5KAF Z;  4FLX A;  2HEP A;  3E22 A;  5LHH A;  4GX5 A;  1R6N A;  2PI4 A;  4ZHQ B;  1M1K W;  1N32 B;  1MOF A;  2R70 A;  3ASN C;  1MSW D;  1NQT A;  3ZHR A;  1URF A;  5L3E A;  5CB4 B;  3S3X A;  3SYP A;  2IU0 A;  4L87 A;  3AG2 C;  1JFF A;  5LMU O;  3CCR V;  2ZIM A;  1KU9 A;  2GV9 A;  5BR8 O;  4MS2 A;  2YDE A;  1Y6X A;  4Z1V A;  5F2V O;  5KHI A;  2VWK A;  2X0L A;  4KXR A;  2DOS A;  2CH7 A;  1GO3 F;  3I56 V;  1HNX O;  3DSQ A;  3TXQ A;  2XAJ A;  2FML A;  4JYB A;  3G4S V;  4NR1 A;  2JGD B;  4LF6 B;  1KD1 W;  3CD6 V;  1KUQ A;  1VIB A;  4I4T B;  1NJI W;  3K3W A;  4OPA A;  1BMF G;  2EIL C;  4I0X A;  4JV5 O;  4JI1 B;  2ETN A;  5A9G A;  3F7Y C;  5IJ0 A;  1SA0 B;  5FPO A;  5LYJ A;  3K59 A;  4LF9 O;  3JSN A;  4LF4 O;  2F1M A;  4CC5 A;  2GTA A;  4LC1 A;  4H33 A;  3OT7 A;  4K8X A;  3OUS A;  1MZE A;  2UUC O;  2F93 B;  1PNL A;  4ZOL B;  4LFA O;  4D7S A;  3ABU A;  4JYA O;  2YEV B;  1Y4M A;  2ZE5 A;  3CRA A;  4ZKI A;  1FD9 A;  4I5S A;  1I94 O;  4DXW A;  2UUA B;  2YIA A;  3L9D A;  1QNM A;  1XNQ B;  3T1Y B;  4MVZ A;  4DUZ B;  3STL C;  1XMQ O;  4G28 B;  3ML0 A;  2BTQ A;  4X64 O;  1AI6 A;  3LUT B;  3KDR A;  1GN2 A;  2V4D A;  4NXM B;  3JAK B;  1RM1 B;  3HKC B;  2ZR2 A;  3K0G A;  2H3O A;  4DW1 A;  1HNW O;  3JSL A;  1IBL B;  2LGW A;  4JI2 B;  1HR0 B;  4F4L A;  4JI7 B;  1VAR A;  2Q0O C;  1AB3 A;  4W4K A;  2KB1 A;  4J9Y B;  4LP8 A;  3JAM N;  2W6J G;  4UCT A;  3B8M A;  3W7T A;  1AP5 A;  1ZL8 A;  3UT5 A;  2RJZ A;  4H13 B;  3ZX6 A;  4OXS A;  5EC1 C;  5KMG A;  4B3T O;  2Y48 A;  1XEQ A;  1OCR C;  2UXN A;  3CS5 A;  2YUA A;  2Q69 A;  3IC7 A;  4FLZ A;  3CHX A;  4BIU A;  3LSQ A;  2WLI A;  5EYP B;  3R65 A;  5JQG B;  4FK5 C;  2PYL A;  1NTK H;  2V1D A;  3PJS K;  4YHH O;  3ABK B;  2QTS A;  1JMK C;  4JI8 B;  2EIK C;  1XRE A;  4DV2 O;  3RYI B;  1X59 A;  3P32 A;  2R9I A;  2Q68 A;  3AG3 C;  3PN1 A;  3RYH A;  2E3C A;  4FLW A;  3ASO B;  2LW1 A;  1QLE B;  3APO A;  1SQX H;  2PZS A;  1UJW B;  3WB1 A;  3T4Z A;  5FNV B;  1M90 W;  5CBG A;  3ZHV A;  2CTW A;  1R3I C;  2V7Q G;  3HR0 A;  1B06 A;  1BHA A;  2FL4 A;  4X20 B;  1N34 O;  3JAS A;  5DED A;  1H2L A;  2OWO A;  4AQY O;  4GX0 A;  4LF8 O;  2YIB D;  3BVO A;  2OCC B;  4AHC A;  4JI6 B;  1K73 W;  3FB6 C;  3A2F A;  3FAV A;  4GYC B;  1VQK V;  1ZX3 A;  4ZI7 A;  1GKF A;  3ZN1 A;  3H1L H;  1IDS A;  4J7J A;  5D5Q A;  4FM1 A;  3CB2 A;  4GKK O;  4LH6 A;  4IYI A;  3OM3 B;  3TET A;  4DV3 O;  3SDL A;  4JI5 O;  4IL6 Z;  2HHH O;  4I50 B;  4IIJ A;  1IBK B;  1VF6 A;  5KA5 A;  3CX5 F;  3RFR A;  1HP8 A;  4DK0 A;  1V55 B;  3APQ A;  1H2G A;  3JCZ A;  5B1B C;  3ETG A;  3C3S A;  3ABL C;  1OV9 A;  5J2T A;  2EIJ C;  3F5W C;  3CRQ A;  3JAT B;  4UCV A;  4WFB V;  2P7T C;  3ZED A;  4GUN A;  2XAF A;  2OCH A;  2Y0I A;  4P2Z A;  3OTF A;  1YF2 A;  5EZY B;  3QO8 A;  4JI3 O;  4U7O A;  4JTA B;  3UT5 B;  1XL6 A;  4CS4 A;  1QLN A;  2RQ6 A;  5LBQ A;  3P3N A;  5LA6 A;  2VS0 A;  4XDL A;  3M99 B;  1NZ6 A;  1Y74 B;  5LP6 B;  2WLJ A;  1GAX A;  1H8E G;  2AHZ A;  1BL8 A;  2DMX A;  3AK3 A;  2M6Y A;  5JCO A;  1NH2 D;  4DV1 B;  2QSA A;  5LOV A;  4XDJ A;  1QHT A;  4EKW A;  1H2S B;  4LF7 B;  2UXB O;  5EIB D;  3K5L A;  2UU9 B;  1BQ0 A;  1I0H A;  4PDL A;  1P7G A;  4IHJ B;  1M56 B;  4TUY A;  2QDO A;  1V9P A;  2WLL A;  5GTI Z;  4R8C A;  4P9P A;  2RDC A;  2M7W A;  1R6T A;  4DR2 O;  4I9Q A;  3A0R A;  1G6U A;  4DUY B;  3ZMZ A;  4L8J A;  3MHS C;  2EIM B;  3U0Z A;  4MTF A;  3CPW U;  1CPY A;  1FXV A;  3A8T A;  3OEE G;  5CA0 B;  3E86 A;  1G4Y B;  2G38 A;  5KHJ A;  3RYC A;  3HKE B;  2CTR A;  3NR7 A;  1H2M A;  4MW8 A;  4YJ2 B;  2ATK C;  2Q7G A;  2JEU A;  2NN4 A;  2RMK B;  1OCC C;  2HR3 A;  3CRC A;  3L75 H;  3AG7 A;  4H44 B;  4K3A A;  3ZRX A;  4QGP A;  3AK1 A;  3SR2 C;  2VQE B;  1UPG A;  3T1H B;  1RPO A;  4JAU A;  1YXB A;  4FZ0 A;  3WB2 A;  2LW7 A;  4F6E A;  3HKB B;  3G71 V;  4W4L A;  1AR4 A;  2HFE C;  4YJ3 A;  3OUF A;  2A79 B;  5CA1 A;  1N0N A;  3GB7 C;  2PY5 A;  1T5E A;  2ZR3 A;  4UB6 Z;  4HAM A;  3DC5 A;  3JAW A;  4MW3 A;  1AI7 A;  4JTD B;  4QPK A;  2HG5 C;  4PEL A;  5H6Q A;  3RYF B;  3SJA C;  2CTQ A;  1F7Y A;  3JD0 A;  3ZMT A;  1UFI A;  1KYO F;  1TAE A;  3WG7 C;  5J2T B;  4LNU A;  2OTL V;  3CC4 V;  2F4V B;  5JJJ B;  3E8B A;  4ZHQ A;  1E1Q G;  1NH2 B;  2DQ0 A;  3OEH G;  5EC2 C;  1XHX A;  1Q5O A;  5CB4 A;  4R7C A;  2X6A A;  4HZ3 A;  1IZ3 A;  2GTS A;  4MVS A;  1GN3 A;  2YID A;  5KHH A;  3X2Q B;  1ZLZ A;  2B5U A;  5D5P A;  3SYA A;  5H6R A;  3JD4 A;  3SJB C;  1LUV A;  3QO5 A;  1FYJ A;  2GHY A;  2GBO A;  1AJP A;  4U3F H;  4UCO A;  5LOV B;  5KAI Z;  1OCO B;  2JDI G;  1VQ6 V;  4C7U A;  4MVR A;  1S76 D;  4GKJ O;  2JGD A;  4DR3 O;  2GUZ B;  2VRZ A;  1YJW V;  2CTP A;  3E83 A;  1SA0 A;  3AG1 B;  4DV0 B;  1LNQ A;  4OX9 B;  1LUW A;  4ZOL A;  3H9V A;  1N32 O;  1PD3 A;  1O9H A;  2YEV A;  3RT3 C;  4QPJ A;  3UM7 A;  1WAZ A;  2A3Q A;  5ITZ B;  1SC5 B;  3R66 A;  4X66 B;  2MK3 A;  1JJ2 U;  4O2A A;  1VF5 B;  2ZXW B;  5L3C A;  1JJO A;  5KX5 B;  4UV8 A;  3ZRV A;  3CCM V;  4RQE A;  1MSD A;  1N36 B;  2E75 B;  2R9A A;  4JI0 B;  1Q43 A;  1EFR G;  3FYE B;  3HKC A;  1S72 V;  5B3S B;  2Q6A A;  3BCC H;  3D36 C;  1NI8 A;  4TV8 B;  4DV4 O;  4RUE A;  4QE7 A;  4QNH B;  2JS5 A;  4Z1M G;  2Q7H A;  1BCC H;  1YTF B;  3VQX A;  3UO2 A;  3EHB B;  4JF3 A;  4ZIB A;  1N8R W;  3T2M A;  3KCY A;  1N33 O;  3HB3 B;  1KC8 W;  1W59 A;  2XUM A;  3ZIA G;  1D5A A;  2OT5 A;  1NR1 A;  4PHZ A;  3Q4H A;  4WFG A;  2UUA O;  2EJ7 A;  3TK1 A;  3DC6 A;  5EYP A;  5JQG A;  2Y69 B;  1JNB A;  2LP7 A;  4H0L B;  3CYO A;  4DV7 O;  4NB5 A;  5E79 Z;  4TT3 G;  4O4L A;  4RUF A;  3RYI A;  3MAQ A;  1A32 A;  5IWA O;  2VQF B;  3FYI B;  1HR0 O;  2N05 A;  4KHP B;  2QEX V;  2ZE6 A;  5FNV A;  1WB8 A;  2PI5 A;  3QO7 A;  3E89 A;  1FXH A;  4CBC A;  1VQL V;  2C2A A;  1E79 G;  4RO2 A;  1XUQ A;  1OHH G;  4JAS A;  4FVM A;  1FS0 G;  4X20 A;  4K8Z A;  3SPH A;  2AHY A;  3I5D A;  5KUM A;  1IVS A;  1I08 A;  2ZNJ A;  3CCV V;  1K4C C;  1YHQ V;  1DLB A;  4AI8 A;  4MSW C;  1PNM A;  4UCR A;  5KUK A;  5JH7 B;  1HNZ O;  1VEW A;  3K03 A;  4E4E A;  4B3M B;  5C93 A;  4O4I B;  5LGN A;  4DR4 B;  4IT5 A;  4TOI A;  3B8N A;  2QWN B;  4DR1 O;  1WPB A;  2QWP B;  4LFC B;  2OIE A;  1Q6H A;  1JPX A;  1KMI Z;  1PM9 A;  2JVD A;  4JI8 O;  4O2A B;  4KP4 A;  2YXY A;  5EBM C;  4I50 A;  2E74 B;  3N2K B;  2QWR B;  4X1K B;  1XHZ A;  1P7B A;  5B1N A;  1YVW A;  1V54 B;  3ABM C;  3ZHQ A;  3CCL V;  4X9Q A;  1L0N H;  1OCZ B;  2DYR B;  5IY5 B;  5L3B A;  1U96 A;  2XHB A;  1K4D C;  3SGI A;  2QWQ B;  1S0V A;  1M4U A;  3ZMU A;  2UUB B;  4BWA A;  3CMA V;  3JAT A;  5H9C A;  1BZK A;  1ZAU A;  2JJ1 G;  1YZB A;  1H8H G;  1Y66 A;  4K0K O;  4O4H B;  3BFR A;  5IYD O;  4NXN B;  5LMU B;  3BEH A;  3OMA B;  2YSU B;  1AR1 B;  3OFN G;  2XAQ A;  5EZY A;  5BR8 B;  3ZS8 C;  3LDD A;  3VQV A;  2P6J A;  2DYS C;  4K35 A;  1XBL A;  2ZE8 A;  1PV0 A;  1Y74 A;  5LP6 A;  2B1I A;  5LGU A;  1HNX B;  1OJH A;  3Q4H B;  1EN4 A;  3ZHS A;  5L3F A;  3SYO A;  4DR6 O;  1WJZ A;  4TQF A;  3CC7 V;  3HKD B;  5AG2 A;  1P49 A;  2RN9 A;  1BQZ A;  1XQ8 A;  2L35 A;  1K3E A;  4UB8 Z;  5J9P C;  1K92 A;  3CJH B;  4LF4 B;  4UVC A;  3G6E V;  1X4T A;  2ZIN A;  4O4L B;  1S5H C;  3H1J H;  3QTC A;  4IHJ A;  4GLX A;  2UUC B;  5B1A B;  4LFA B;  2ADQ B;  3ETQ A;  4JYA B;  1R3J C;  3OTO O;  2FTK A;  2UXC O;  4X65 B;  1Y76 B;  4P30 A;  2EZP A;  2Q8V A;  1AIL A;  1XMQ B;  3OR7 C;  2IU3 A;  1Q82 W;  1F4M A;  4X64 B;  4CS2 A;  5CA0 A;  4X62 O;  5FL7 G;  1IUR A;  3HKE A;  4TV9 A;  4PDM A;  4YJ2 A;  5C8Y B;  2EZO A;  4CZZ A;  1B3Q A;  3H1I H;  1HNW B;  4IYH A;  1WA8 B;  3A0B Z;  3SPJ A;  1VQM V;  2Y0P A;  4CH4 A;  3TCU A;  1EZV H;  1E1R G;  2FYU H;  3FB8 C;  2UU9 O;  4G27 B;  1L1F A;  2N74 A;  3HKB A;  2F23 A;  4J42 A;  1TGO A;  4YY3 O;  1GN4 A;  1AJN A;  5GON B;  2EIN C;  2W0F C;  1K7D A;  1IBM B;  4LBE C;  1KEC A;  1WN7 A;  4FLV A;  1M57 C;  1K8A W;  4DYL A;  2IJK A;  1L0L H;  2B9Z A;  4JZG A;  4WBN B;  1RPR A;  1GH6 A;  1GRJ A;  3RYF A;  3B77 A;  4JI4 B;  1XNR O;  3STZ C;  1SQG A;  1H38 A;  3MD0 A;  4GX2 A;  2EIL B;  3VQY A;  5JCO C;  1K9M W;  5LMN B;  3SJC C;  2UXD O;  1AR5 A;  4YHH B;  3TJT A;  1VQ5 V;  1FXK A;  2ADP A;  4DV2 B;  2BSK A;  5LHI A;  3BPZ A;  2YIC A;  3CCJ V;  1YIJ V;  4DRX A;  1H5W A;  4E2L A;  4YIO A;  4JGS A;  3OR6 C;  1B04 A;  4PI0 A;  4X1Y A;  4ABM A;  4R6Z A;  4NTY A;  1N34 B;  1VQ7 V;  3QNE A;  1QVF U;  2R9R B;  2IJH A;  4UVB A;  2HKO A;  2ZM6 O;  4AQY B;  5KHK A;  5IT9 N;  3BAA A;  3T1C A;  1DTO A;  4DR5 O;  2LFR A;  2CE4 A;  2BOB C;  1GM9 A;  3ICX A;  2F66 C;  2GUZ A;  1XMO O;  3CEI A;  4J10 A;  3AG4 C;  1BGY H;  4LWS B;  1GM7 A;  3SYQ A;  2LJ2 A;  4JPR A;  4EEQ A;  4BAY A;  5CBH A;  1NR7 A;  1KKD A;  3EVK A;  3B09 A;  4GKK B;  3CE2 A;  1SZX A;  2ZD9 A;  4DV3 B;  3J80 N;  4JI5 B;  2LO1 A;  2HHH B;  4DV6 O;  4FMT A;  2P5O A;  3K5N A;  5ITZ A;  4B3R B;  1OCR B;  2XTA A;  3ZHT A;  3KKY A;  2YXH A;  4TV9 B;  4PA6 A;  1WB7 A;  3W7U A;  4DO2 A;  1WP8 A;  1ZWI C;  5KX5 A;  5GW7 A;  1JR9 A;  4WCE V;  2Q73 A;  1RFY A;  3O65 A;  2ZT9 B;  3FX7 A;  4FM2 A;  4O4J B;  3U10 A;  1S77 D;  3SPI A;  2WA4 A;  2ZE7 A;  1KKC A;  2KKW A;  3A0H Z;  4PDV A;  5BY1 A;  3CXC U;  2EIK B;  4TV8 A;  3H01 A;  3ABT A;  1U97 A;  1WNS A;  3KCX A;  2P90 A;  4JYC A;  1SES A;  2ZCE A;  5L3D A;  3LDE A;  4X88 A;  2W6I G;  3UKM A;  1VF7 A;  3CRM A;  2XAS A;  2QM4 A;  4OX9 O;  1F51 A;  1J5E O;  3I55 V;  5IYC O;  3ZRW B;  4PJ0 Z;  2A06 H;  4XBF A;  2KG7 B;  2LFS A;  1YTF D;  4JYY A;  1Q6U A;  3WB0 A;  2UXB B;  3LNM B;  2KSD A;  1FXK B;  1R1B A;  4U3J B;  4DR7 O;  2BSK B;  5J2U B;  1DF4 A;  4NTW A;  5FPR A;  1N36 O;  4QE9 A;  4GX1 A;  3NXS A;  2E5L O;  1MA1 A;  1SQB H;  2HVJ C;  2IH3 C;  1K5S A;  4H37 A;  4DRX B;  2JRI A;  4DR2 B;  3CRR A;  4FFK A;  2JGU A;  3KG2 A;  1F4N A;  4J80 A;  1QQC A;  4PA4 A;  1RSO B;  4X1Y B;  3T4D A;  4XDK A;  4WFF A;  3E2E A;  1BE3 H;  3ZMV A;  2AGA A;  2QTO A;  4AIL C;  1MZF A;  3K57 A;  3JAR B;  1YI2 V;  3IFX A;  4YXW G;  1AJQ A;  5B1B B;  1YJ9 V;  5H2F Z;  2ARH A;  4MTG A;  3RVY A;  3ABL B;  3K9S A;  1AI4 A;  2P4V A;  1VMG A;  2EIJ B;  1AVM A;  4MTX A;  4ASU G;  3JD3 A;  5JH7 A;  5IYZ A;  3N27 A;  1EBO A;  1RM1 C;  2NR5 A;  3TXS A;  4RWU A;  4OPH A;  2OIG A;  3MHH C;  4O4I A;  1NVP B;  2XT9 A;  5H5N A;  5K1X A;  2R72 A;  4KUM A;  1I5Y A;  5KLV H;  2X6C A;  1TA8 A;  1H2K A;  4QIW F;  5HFL A;  3K79 A;  4B3S B;  3N2G A;  2BOC C;  3SJQ C;  1IXB A;  3OAA G;  4I9W A;  3N2K A;  4X1K A;  2VQF O;  1VQN V;  3CSX A;  4KHP O;  2K9P A;  5E1A C;  3WU2 Z;  2HJF C;  1ROP A;  1Q6I A;  5IYB O;  4MVO A;  3M8A A;  3K5O A;  4LF6 O;  3ZN0 A;  4J41 A;  2CGO A;  2Y4U A;  3DGE A;  4LF5 B;  2CGN A;  1KQS U;  3GWO A;  1IX9 A;  4JI1 O;  3RVZ A;  4O4H A;  2K1E A;  5LXT B;  3ABK C;  1SQP H;  1FJG B;  4PA3 A;  4UXN A;  2Z0A A;  3K08 A;  4G2K A;  4MVU A;  4FFB B;  1O9G A;  1M5I A;  4LFB B;  3C3T A;  4Z2W A;  3ASO C;  2OYQ A;  1QLE C;  4O2B B;  4ICG A;  1SQQ H;  3BA9 A;  4YIP A;  2BE3 A;  1HWY A;  2DWE C;  1NTM H;  4GKJ B;  1XNQ O;  3FFQ A;  5CN0 A;  3T1Y O;  1OCC B;  4CC6 A;  2QKS A;  4DUZ O;  2QKC A;  1PL0 A;  3IGA C;  4UCS A;  5LHG A;  1EN6 A;  3HKD A;  5L3G A;  3F5T A;  3THO A;  3VOU A;  2ZDI A;  5JWP A;  4EFE A;  3CJH A;  2OCC C;  3BAB A;  4J7K A;  4X8A A;  2NLJ C;  2QJ1 A;  4NXM O;  2IW5 A;  3E35 A;  1S5J A;  1R3K C;  1IBL O;  2XOK G;  3OMI B;  3JAL A;  5FLX N;  3LDC A;  3B40 A;  1VQ9 V;  2DN9 A;  4JI2 O;  2AZ2 A;  2W0X A;  3OGC C;  3U11 A;  2UUB O;  4JI7 O;  1K97 A;  1Y76 A;  3BRC A;  3GWK C;  2YXL A;  2WLN A;  3IJ4 A;  3RWR D;  4X1I B;  2Z3Y A;  4NXN O;  1WP7 A;  4UFZ A;  4WF9 V;  4DW0 A;  4CH5 A;  4EB6 B;  1IJG A;  1GN6 A;  2WWW A;  2P4K A;  3C90 A;  3OD4 A;  2IJJ A;  5EBW C;  3WG7 B;  4FM0 A;  4FLT A;  1SZT A;  5C8Y A;  2DJV A;  2Q0A A;  1V55 C;  4LH7 A;  5IYZ B;  1XI1 A;  2IJI A;  1SQF A;  3AEI A;  1AI5 A;  1Z2G A;  3FB7 C;  1J95 A;  4TWK A;  4DV4 B;  1WA8 A;  2PUS A;  4HNA B;  4R50 A;  1LR1 A;  1D5N A;  1QCE A;  1AP6 A;  3SPG A;  1M9N A;  2MW2 B;  1SKV A;  2QWO B;  1QBZ A;  2FB5 A;  3O9O A;  1HW7 A;  3FB5 C;  1NKD A;  4Q20 A;  2NNU A;  1FPO A;  2A9H A;  1S5L Z;  5JVD B;  1ZTE A;  3N2G B;  5GON A;  2P67 A;  1RP3 B;  1N33 B;  1FOU A;  2A7W A;  3K0D A;  1PL4 A;  1XOU A;  4X65 O;  4MVM A;  2HLD G;  2H8P C;  4DV5 B;  1BSM A;  2YS8 A;  4F6R A;  1ORQ C;  5LP6 C;  4WBN A;  3UQ8 A; 
#chains in the Genus database with same CATH homology
 5A9G A;  4GUN A;  1JA8 A;  4F6E A;  3KKY A;  1AR4 A;  1WB7 A;  2QKC A;  1XRE A;  1EN6 A;  1WB8 A;  1JR9 A;  3OT7 A;  4JZG A;  1EN4 A;  3K9S A;  1XUQ A;  1XDC A;  1N0N A;  1AVM A;  3DC5 A;  2GDS A;  1I08 A;  4JZ2 A;  5AG2 A;  1KKC A;  2CDY A;  1MSD A;  1AR5 A;  1ZUQ A;  1QNM A;  3AK3 A;  1BT8 A;  3TJT A;  1B06 A;  2ADP A;  1VEW A;  4E4E A;  1XIL A;  3QVN A;  2ADQ B;  2QKA A;  3KDR A;  1GN2 A;  1I0H A;  1P7G A;  1IXB A;  4YIO A;  1GN6 A;  1IDS A;  2P4K A;  1Y67 A;  1PM9 A;  1GN3 A;  1MNG A;  1VAR A;  2AW9 A;  3AK2 A;  1EN5 A;  1ZLZ A;  2RCV A;  4JYY A;  1LUV A;  2CE4 A;  1ZSP A;  3MDS A;  1MMM A;  3CEI A;  1AP5 A;  1D5N A;  3LSU A;  1AP6 A;  4X9Q A;  1N0J A;  1IX9 A;  4C7U A;  1BS3 A;  1MA1 A;  3DC6 A;  3IC9 A;  3EVK A;  1ZTE A;  4BR6 A;  1SZX A;  4FFK A;  3C3T A;  1PL4 A;  3C3S A;  3BFR A;  3RN4 A;  3AK1 A;  1EM1 A;  1GN4 A;  1LUW A;  1BSM A;  4YIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...