1QNMA

Human manganese superoxide dismutase mutant q143n
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNNDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the active site of human manganese superoxide dismutase: the role of glutamine 143.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 69
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1997-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1qnmA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1qnmA02
3C3SA 5A9GA 1XILA 1B06A 1BS3A 1ZUQA 2AW9A 1AP5A 1AVMA 1EN5A 4F6EA 1BSMA 1Y67A 2CE4A 2ADQB 1AR4A 2QKCA 3MDSA 4JYYA 3AK2A 4YIPA 3AK1A 2P4KA 3IC9A 1AP6A 3C3TA 2ADPA 1BT8A 3OT7A 1ZLZA 1D5NA 3KKYA 1EN6A 3TJTA 3QVNA 1VARA 1EN4A 2CDYA 4GUNA 1XUQA 2RCVA 1KKCA 1QNMA 1GN2A 1ZSPA 3DC5A 1MMMA 1PL4A 1ZTEA 3LSUA 4YIOA 1IX9A 1JR9A 1IDSA 3AK3A 4JZ2A 1VEWA 1MSDA 1LUVA 1EM1A 1P7GA 1I0HA 1WB7A 1N0JA 1SZXA 1WB8A 2GDSA 1GN4A 1N0NA 1XDCA 3CEIA 1LUWA 1JA8A 1AR5A 4BR6A 4JZGA 1IXBA 4X9QA 1XREA 3DC6A 5AG2A 2QKAA 1MNGA 1GN6A 1MA1A 3RN4A 3BFRA 1PM9A 1I08A 4E4EA 3EVKA 4C7UA 4FFKA 3K9SA 1GN3A
chains in the Genus database with same CATH superfamily
2BE3A 5CMUA 4QNHB 1UPGA 1SERA 3JATB 5EIBC 3CJHA 3HB3B 3CJHB 2IU3A 1J95A 2CH7B 2ITDC 4G28B 2XAFA 3SJCC 2JVDA 1H2MA 2Q7EA 3VQYA 4LCUC 3GWKC 3C3TA 1AI6A 4IIJA 1JVMA 2ADPA 4CC6A 4NXNB 4F6RB 1XEQA 2YIBA 4DR5O 2MW2B 2OT5A 3TGUH 1S0VA 3NXSA 1UJWB 4DV6O 4LH7A 4NYKA 1HNWB 2PF4E 4DV5B 3EFFK 2OIGA 3E83A 1ZSPA 3P30A 3Q4HA 4YJ2A 1R6NA 2D2CB 3ZN0A 1PKXA 1U96A 2ITCC 3N2GA 1QQCA 1HP8A 1RPOA 3JATA 4R6ZA 2Q73A 3TCUA 4X1IB 1TUBB 3U0ZA 1IXMA 1EM1A 4ICGA 1OCZB 3BHPA 1P7GA 2EULA 5F2VO 3UQ8A 4WFFA 1I94O 4X65B 2GDSA 1JFFB 1F23A 2Q7GA 2Y0PA 4CH6A 4RWUA 5JCOC 3CRCA 2A3QA 4RQEA 1QHTA 4X66B 2EJRA 2R9IA 1XREA 4N21A 2EIKC 5DN6G 4MVMA 3J7AU 2Q68A 2LQTA 3JSLA 2OYQA 2QTSA 1FS0G 5E79Z 1N36B 3L70H 1Y74B 1NBMG 1NH2D 1XMOB 1E1RG 3RT3C 5J9PC 4C7UA 2OCCC 5L3BA 1G6UA 1NT2B 2EBOA 1YTFD 1AILA 1M56B 2EX3A 3SDLA 3CCRV 3P3PA 3CSXA 4MTFA 2UU9B 4O4LB 2UXCO 2WAMA 1Y67A 1H8EG 2HJDA 4EEQA 4LF4B 2E75B 3AG7A 4PV1B 5GW7A 2P4KA 3KZIZ 2EINB 4L87A 4I50B 2JJ1G 5A2QN 1X59A 5BY1A 1RPRA 3K9AA 2WSSG 3N2GB 2JJ2G 2BTQB 1KU9A 4PDMA 1ORQC 2A7WA 5KMGA 1SQVH 3FAVB 1ZL8B 1WLEA 4MT8A 4AILC 2DWEC 2ZR2A 2HJFC 3LNMB 1QVGU 4XBFA 2WLLB 2XAGA 2H94A 4RUFA 3T1HB 4JV5B 1FFTB 4MVUA 1L0LH 3ZHVA 5L3DA 5JJEB 1JCHA 5B66Z 2R9AA 4J41A 2BOCC 1N0JA 1Y4MA 4LWSA 4K0KB 1OHHG 2IM9A 2GV9A 1N0NA 3FB6C 3TETA 4JI0O 3OMIB 1CXZB 3A0BZ 4BIZA 1IURA 2HHHO 3QNEA 5LXTA 4MVOA 1EZJA 1ZAUA 1TVKB 3B09A 1YDXA 5AG2A 4FLZA 2WLLA 4DW1A 3L9DA 2X0LA 4CS4A 4JAUA 1PD3A 1SRYA 5CA1B 4JPRA 2F95B 1SQQH 4UB8Z 2QWOB 2Y69C 3ASNC 5ITZB 5KA5A 1Q3EA 1GTOA 4JF3A 4DK0A 2FYUH 1K8AW 4MS2A 3OFNG 1XNRO 2AHZA 4TQDA 3CMEV 1AI4A 1OV9A 4I5SA 4U7OA 1SS3A 3G71V 4NVPA 3N2KA 4D7SA 3G4SV 1LNQA 1BQ0A 1WPBA 1UFIA 1IBMB 5KHJA 2QKSA 1M4UA 4DR7O 3VQVA 1VQ4V 4MTGA 1N4CA 3CCVV 3FYEB 4DW0A 3RYFA 5DECA 3CRRA 4NXMO 2HEPA 2D3OW 2QM7A 1NR7A 1ZLZA 1KMIZ 1PL0A 5FNVB 1GM7A 3OR6C 2ZM6O 4B3TB 4FPPA 2GHYA 3ABKB 2XAHA 4UCUA 3RYHA 3GB7C 3ABLC 3AG1B 2R9RB 3X2QC 3RYHB 2P67A 1RSOB 4I9QA 3LUTB 3LSUA 4LF8O 5B1AB 1HNZB 2PI4A 2XT9A 1IX9A 4Q6GA 1Y76B 1AJNA 2Y48A 4DR6B 5EZYB 3SYAA 1US6A 2QEXV 2RDCA 4U7NA 3C90A 2ZIOA 1GO3F 2E5LB 1SC5B 2AHYA 2VQEO 1FD9A 2OWOA 3CCEV 2YSUB 2W0FC 5KHHA 3L72H 4BAYA 2Q0AA 2DJVA 3VQWA 4FLXA 2PZSA 1FJGO 5BR8O 3JD1A 3WFVA 4B3SB 3K5LA 1COWG 3K06A 4JI7O 4QIWF 4PJ0Z 4JAAA 1R6KA 2RN9A 2AXTZ 5LL6Y 4XDKA 1JPXA 1QBZA 3S3XA 3H1IH 4PA6A 1NS1A 2EIJB 3SPCA 3JAMN 1I08A 2UXDB 4DR5B 2EJ7A 5DM6V 1F4MA 1Y66A 4WBNB 4JI8O 3I55V 4I4TA 4GT1A 5CN0A 4H37A 3ZBHA 1XQ8A 5A9GA 2VS0A 5LMUO 2JS5A 4F6RA 2EIMC 4LFBO 2WLMA 1QLNA 1PNMA 3MDSA 3ZRWB 3CC7V 3RBZA 4I0XB 5LMUB 2IJIA 1YI2V 3ZRVA 4D6TH 4LF9O 4QPKA 3D36C 3Q4HB 3KG2A 4UV9A 1BGYH 1M56C 4LNUA 2YEVB 1YCIA 3QO5A 4NR1A 2LJ2A 4HBNA 1P4RA 4R50A 5JVDB 4GCZA 3D3QA 3E89A 3OM3B 3D8CA 5KX5A 5BMVB 1QCEA 4DV6B 1BQZA 1NTZH 3E8HA 2YUAA 2ZDIC 2B1GA 1HR0B 2E74B 1U97A 4DUYB 3ZRWA 2ZCEA 3CRAA 2FTKA 3SPIA 2WA3A 1JR9A 3AK3A 2WLIA 5IE9A 2KG7A 3H9VA 2JS3A 4O4HB 4UCVA 1SZXA 1K4CC 1B6QA 2Y0IA 1LUWA 2QWQB 1JA8A 2LW1A 5H9CA 3ZRSA 2P7TC 2YIDA 3G6EV 3SYOA 3BAAA 1OCOC 2DW4A 3JASB 5CA0A 2ARHA 1VF6C 1B04A 3DC6A 2YDEA 3H1HH 4DR2B 3ZHUA 4J42A 1GAXA 2NN4A 4GKKB 3JYCA 2YIAA 4O2BA 4B3SO 2JK5C 3RN4A 2UUAB 3E8GA 1VIBA 3BVOA 2JIZG 5B3SB 3JAKA 2IJJA 3EVKA 3ZMVA 1ENVA 2ZINA 3U11A 4FFKA 4IL6Z 5IT9N 1H5WA 3K0GA 4LF9B 5EIBD 1K92A 1B06A 5IYZB 1BS3A 4MVZA 2ZXWC 4LBEC 4Q20A 1AI5A 1SA0B 1RM1C 1VQ9V 3JAWA 4LF7O 5LHHA 4JAVA 1X4TA 3FKSG 1HNXB 2L35A 4WCEV 1Y76A 1GM9A 5CBFA 1N34O 4O4JB 5LA6B 1H8HG 4NTYA 5B1NA 3K5OA 3LNNA 3OGCC 3JD4A 2ZE5A 4JGSA 1K4DC 1LR1A 1V9PA 1GK9A 1URFA 4DV0O 1GN2A 4G27B 4KFMA 3VQXA 1Q82W 2DMXA 2Y4TA 3JAWB 1DGSA 1G1XB 4LH6A 3OUFA 1N32B 4F4LA 3FD9A 3B40A 4JI5O 2Q7HA 2Y4UA 4OGQB 5BMVA 1JJ2U 2DOSA 1MOFA 4DV1B 3STLC 4Z1VA 4I7ZB 4BIUA 2XASA 4WFHA 2NLJC 5GONA 4TQFA 4I0XA 2CTRA 1SF9A 3E22B 3M7MX 5EC1C 3UO3A 4LF6O 4CS3A 1Z5VA 4PA4A 4B3TO 3OTOB 1NTMH 3IFXA 1YZBA 1P49A 2LGWA 5LMNO 1FXHA 4GKJB 3CMAV 3DGEA 4WBNA 4XDJA 4FVMA 1FAFA 5JQGA 4JI4O 1L1FA 1K7DA 4JTCB 4EB6B 3OD4A 4H13B 4JI2B 1BCCH 3DXRB 2GUZA 3ZHTA 1EBOA 2CGNA 1M9NA 4YY3O 1MG1A 2VQEB 1FOUA 1Z2GA 2L6LA 3ZS8C 2E5LO 3UT5B 4ZHQA 2YEVA 3ABKC 2JGUA 4KUMA 1SZTA 3JSNA 4B3RB 1EFRG 5LGTA 2JEUA 3M99B 4B3RO 3QVNA 3SYPA 4BIOA 2IU0A 3ETEA 4KHPB 1G4YB 1W0KG 1AI7A 3BPZA 3E8BA 4X64O 3K79A 2V1DA 4IYHA 3JARB 5JH7A 2P4VA 2YC0A 4O4IA 3K58A 1WN7A 3I56V 1ZTEA 4LFAO 3O65A 4ZKIA 1FFXB 5KA6A 2CTWA 5IJ0B 3K04A 3QO8A 1AR1B 3CC4V 5C8YA 1SQFA 1I7FA 2W6JG 3ZMUA 4GX5A 3RW0A 4YY3B 3FB8C 4JV5O 3A0HZ 1SA0A 2YIBD 1JX9A 3APOA 2IH3C 1OZ0A 1N32O 2FKXA 3P32A 3HKCA 2ZQMA 5E1AC 2IH1C 1GN6A 1WP8A 4DV7B 1H2KA 1RM1B 5IJ9A 2YICA 5LA6A 3F7VC 4E4EA 4NXNO 1TUEB 3T1YB 2C2AA 5LYJA 3TXQA 3K9SA 1O9HA 3OMAB 1RSOA 1MZEA 1MABG 2Z3YA 1XMQO 3G6BA 3CPWU 1V55C 5C93A 3JD2A 1WJZA 2QWNB 3N2KB 4NTWA 4FZ0A 4YHHO 4ZI7A 1IBKB 4UVAA 3CP1A 4GKJO 1TGOA 3H1KH 3W7WA 2EIKB 1VF5B 5LP6C 3IC9A 1N33B 5EBLC 3CCUV 2CGOA 4HZ3A 4PDLA 1L0NH 4MVSA 4EFBA 1YXBA 3UKMA 1YJ9V 4J7JA 2A06H 1WA8A 2AGAA 2WLKA 4P30A 1F51A 3ETDA 3SYQA 3RGBA 4K8XA 2Q69A 3W7TA 4J10A 1V54B 1IBLO 1VEWA 4U3JB 5EBWC 4YJ3B 5L3GA 4YJ3A 2EILB 4JI3O 1E1QG 1F7YA 3A0RA 2H3OA 3ZIAG 2ODMA 5BXZA 2YXHA 3OUSA 2HVJC 4DV0B 1WA8B 2KB1A 2UU9O 3IAYA 1Q6IA 1W59A 1WAZA 3E8FA 2O57A 3OW2U 4DR6O 1VQNV 1Q7YW 5B1OA 4X20B 4UCOA 4UCTA 1E79G 4UCSA 3CCQV 3FX7A 2A9HA 5B5EZ 4JTDB 1VQ5V 3ABMB 4OPHA 4HNAA 4PA7A 3WB2A 2UUAO 1ZL8A 2ETNA 2ZE8A 5FPRA 4TSFG 2QM8A 4LFCB 3ASOC 3C3SA 4FJCC 5LGUA 4K0KO 1S76D 5KHKA 3L71H 1R3LC 2IBZH 2CAZC 2CE4A 2X7RB 4DUYO 4X1YA 5LGNA 3RFRA 5LP6A 2F1MA 3ZCCA 2EZPA 1Q90D 4EKWA 5JWPA 4I50A 1NVPB 1PNKA 3B8NA 3KKYA 4UUJC 5LOVB 4NKGB 1EN4A 2Q67A 1S5HC 2UUBO 3MHSC 4TV9A 3HR0A 1JJOA 1HWYA 1P7BA 4O4LA 3AG1C 4TV9B 2GUZB 3PJSK 1PL4A 4NB5A 2WLNA 2XTAA 1K9MW 5KHGA 1GM8A 1SQXH 4RUEA 2WLHA 5FPOA 2EIJC 1MZFA 4W4LA 3UM7A 2IW5A 1MSDA 1XNRB 4H44B 1I0HA 2Q9LA 5LP6B 4RO2A 1IVSA 4TT3G 2KG7B 5K1PA 2A79B 2KQXA 4PDVA 1YTFB 1CP9A 5LOVA 2UXXA 3CEIA 5IYBO 2X6CA 5IY5C 3OGIB 3GVMA 1TVKA 4JYAO 2ZDIA 3JARA 2Q0OC 2ZE7A 1YITV 4J11A 5KUMA 2IJHA 4ZBMA 3T1HO 2QKAA 4O2BB 1Q6UA 3LDEA 5L3CA 2GSMB 3THOA 2RNBA 3OAAG 1TAEA 2YXYA 3IC7A 3CXCU 3BABA 4YXWG 4DYLA 4BW9A 4FLUA 4PI2A 3I5DA 3ASOB 3RYIB 5KAIZ 4F6EA 2UXNA 3JASA 4LFAB 1F4NA 2ILMA 4U3JA 4YIPA 3KDRA 4EFEA 3CCLV 4LF5B 2QE7G 1IBLB 1EN6A 2LP7A 3AG4C 1BL8A 4UV8A 3R65A 3O9OA 2Z0AA 4DR4B 3K03A 3H1LH 3MD0A 3CCMV 1YHQV 1PPJH 3J80N 3SPGA 2JDIG 4JI3B 4FMTA 3K3WA 1IDSA 5H2FZ 4KL1A 1WP7A 2PGGA 4JI0B 1WB7A 4LF8B 3CS5A 2OTLV 1KD1W 3HKBB 1WB8A 3JCUZ 1I94B 3A8TA 3H1JH 4JI5B 1VQ8V 4JZGA 1YSCA 1VQ7V 1IXBA 2UXBO 4PD4F 4RAIA 1KBHA 4ZOLB 1THZA 2Q4PA 2K9PA 1YEWA 3LDDA 1Q81W 2GBOA 4WFBV 1N33O 2CTQA 4UVBA 4GYCB 2DQ0A 4MW3A 3P3NA 1RP3B 1TUBA 1VMGA 3FB7C 1PNLA 2UUCB 2BCCH 3D3IA 5B1BB 3OTFA 4AI8A 5JCOA 3ZN1A 1T5EA 2AW9A 4P2ZA 1AVMA 2M7WA 1VP7A 3BCCH 4JYYA 1OJHA 2XOKG 3DTUB 1FFXA 4WFEA 1W0JG 2EZOA 2B5UA 3N27A 3UT5A 3SR2C 2LO1A 2JGDA 2WPDG 3BA8A 3R66A 3CYOA 1KKCA 1KP3A 5DEDA 1G8MA 2EINC 5LHIA 1BHAA 2K1EA 4TWKA 3WG7C 4LF5O 2QGNA 1SETA 1K5QA 3GWOA 1EZVH 3G67A 4DV1O 1KKDA 4OXSA 3ZHRA 5KAFZ 2WLIB 3AG3C 2PUSA 1VF6A 3ABTA 4DRXA 1R3JC 4I55A 3OE7G 5IYCO 1H2NA 2Y69B 3ASNB 1GN4A 4JI6B 1XDCA 3SYCA 1MSWD 1YJNV 3TK1A 1NJIW 3SJBC 3VOUA 4BR6A 3T4DA 4TOIA 5KLVH 3ABLB 3F5WC 3STZC 2UXDO 3B2EE 3OEHG 4KP4A 1K3EA 2P06A 3T2MA 1GKFA 4QE9A 2CK3G 2P22C 2ZXWB 1KB9F 5ITZA 4JYCA 3HKDB 3CRQA 2QR4A 3JCZA 3OMNB 1XHXA 3CRMA 1DLBA 3E35A 5CA3A 2P6JA 2W6IG 1SKVA 5EC2C 4ZI7B 4FM0A 4TV8A 5JVDA 1JQ0A 1XMOO 2UUCO 2DYRC 1FKAO 4FM2A 5EK0A 4DV4O 4DV5O 1VQMV 3HPLC 4FM1A 1SESA 3VBBA 2RJZA 1OCOB 5JJJB 4L8JA 4KXRA 5LYJB 2HFEC 4X64B 3E2EA 4BW5A 1D5AA 2OTJV 1NH2B 2ZM6B 2RQ6A 3ZJZA 3T1CA 4X8AA 4AHCA 4X66O 1BZKA 4FIPC 4DR3B 3LSQA 2PYJA 1LUVA 5EZYA 5J2UB 1I5XA 2YI9A 3RVYA 3AG3B 5J2UA 1S72V 4J80A 4JI2O 2P90A 3ETGA 1FXKC 3WB1A 3HKEA 4DUZB 2QM4A 3FYIB 3HKBA 4LFCO 1KQSU 3WU2Z 5B1AC 1AB3A 3ZHSA 3K59A 1N8RW 2DWDC 2WLJA 2G38A 4J9ZB 3W7UA 4X62O 2DYSC 1DTOA 4IGGA 4JI7B 4Z2WA 4CH4A 2HVKC 5BR8B 3BFRA 4HNAB 2ZE6A 4A5UB 1Q86W 1VQLV 4LF7B 2GTSA 1XNQB 4K35A 1JFFA 4DO2A 1NTKH 1XL6A 4IHJB 1NKDA 1HNXO 1V55B 1AP5A 1RFYA 2QTOA 1BSMA 2HG5C 1H2LA 1M90W 4X65O 1GMGA 3AK1A 4ZOLA 4E2LA 4FLTA 4GLXA 4FLWA 2EILC 1N36O 2KKWA 2ZR3A 4B3MB 1NR1A 4FK5C 1AP6A 3DSQA 3FFQA 4FZ1A 4P9OA 4AQYB 1D2DA 2HR3A 4DRXB 2MK3A 4MTOA 4B7KA 4JI1B 3TJTA 4KHPO 5IWAB 2YI8A 5LXTB 4NXMB 1HR0O 2X6AA 3QF7A 4IT5A 3DC5A 1VQPV 3DXRA 2V4DA 1DF5A 5B3SC 2BOBC 1NVPD 2N05A 4J7ZA 4TUYA 4ZIBA 1VF7A 2ZIMA 4G2KA 4YHHB 4OX9B 1S3JA 3JD0A 3U10A 5H5NA 1VQ6V 4X88A 2DYRB 2HHHB 2R70A 1CPYA 4UVCA 2LGQA 4DV3O 1R3KC 2UXCB 1XMQB 1S5JA 1BMFG 2EIMB 2WA4A 1BHBA 2XNDG 3MHHC 4LFBB 2FB5A 2E76B 3FB5C 4FFBA 3D36A 5LMNB 5IYDO 1FXVA 2CTPA 2DYSB 2F66C 1XL4A 1ROPA 3CCJV 5IWAO 2WWWA 5IJ9B 1TA8A 1OCRC 5EYPA 5LHGA 4DR2O 4JI4B 5CB4A 3EXAA 4QGPA 2QSAA 2XHBA 4AQYO 2LFRA 1O9GA 4DV4B 3OEEG 2NNUA 5D5QA 1FPOA 1Q5OA 4QE7A 5D5PA 5L3EA 1JNBA 2B9ZA 2ZNIA 4PA9A 4DR1O 4O2AB 1FYJA 1H2GA 1EN5A 1OCCB 3KCXA 3AG2B 2ADQB 4DK1A 2F23A 4Z1MG 4JI8B 1NZ6A 1PV0A 2OCHA 3HKCB 1B3QA 3BEHA 1R6TA 3SJAC 3NR7A 3K5NA 1DK1A 5EYPB 4XDLA 3X2QB 2F4VO 3JAKB 3TXSA 1Y6XA 2HKOA 4YJ2B 2DN9A 1QNMA 4MW8A 3ZMTA 2M6YA 3H01A 2VQFO 4UFZA 4PI0A 4J7KA 2PTMA 4X20A 1CEZA 2F43G 3RWRD 2JRIA 3K5MA 4DUZO 4TV8B 4FLVA 3ZX6A 4IIJB 2H8PC 3AEIA 3F5TA 4DR7B 4HYOA 2Z5UA 2DE0X 4EB6A 1IBMO 1M5IA 1M1KW 1Q8IA 2Q5ZA 2QWRB 3JALA 4CH5A 3UO2A 1NU1H 1QVFU 2HLDG 1Z5WA 5L3FA 3ABUA 4B7EA 1I5YA 4X9QA 3RYIA 1GRJA 1V54C 1XNQO 2QDOA 3RYCB 1M93A 1MA1A 2PI5A 3RYCA 5HFMA 1PM9A 2FMLA 4I4TB 2CH7A 5KHIA 2KSDA 4W4KA 3ZRXA 1XOUA 1XILA 3JD3A 5FL7G 3L73H 1ZUQA 3IGAC 4J9YB 5HFLA 3G80A 3WB0A 1OCCC 4R8CA 5GONB 2QKCA 2V7QG 4U3FH 4QJFB 3T4ZA 3SJQC 1M57C 4I9WA 4LP8A 3LSSA 3SPHA 4K3AA 2RMKB 1K73W 1OCZC 2QA4V 2YXLA 1VQOV 1HNWO 3CC2V 4LNUB 1OCRB 4ASUG 3OT7A 1SQPH 3W7SA 3FAVA 3BA9A 1IZ3A 4MVQA 1VARA 5JJNB 1XUQA 2RCVA 5KUKA 2W0XA 1H38A 4CC5A 3IJ4A 1P84F 2XAJA 2A0LA 3JALB 2GTAA 1KP2A 4K8ZA 1SQGA 3QO7A 3ZMSA 1IBKO 3ICXA 1J5EO 2JEXA 1AROP 5CB4B 1IJGA 5B1BC 1XHZA 1J5EB 1S77D 3ABMC 4X1KB 5KMGB 2NR5A 3ETQA 4DXWA 4N23A 4QPJA 1PP9H 3ZMZA 1QR9A 1Q43A 1K33A 4DV2B 2UXBB 2ZNJA 5CBHA 4X62B 5BZBA 2PY5A 3BY6A 1Q6HA 1QU7A 1NI8A 1ZX3A 1N34B 2XAQA 3LDCA 1K5SA 2P5OA 1KECA 4UXNA 2Q6AA 4LF4O 4WFAV 4WF9V 4LC1A 5H6RA 3WG7B 1QR8A 4O2AA 3BRCA 1AR4A 4MVRA 2N04A 4CH3A 4GX0A 2VQFB 3S3WA 3F7YC 2X6BA 2HP8A 5CA0B 5FLXN 1HNZO 4O4IB 1XI1A 5JQGB 1JMKC 4P9PA 2LW7A 2F4VB 3RYFB 1BT8A 4MSWC 3M8AA 1AJQA 3HKDA 4FLYA 3CXHF 2ZT9B 3K0DA 3UCSC 1A32A 1YVWA 4GKKO 4WFGA 1KUQA 1S5LZ 1QLEB 3J81N 2B1IA 3CCSV 3PN1A 1GH6A 2VWJA 4H33A 4B08A 4R7CA 3A2FA 3ZEDA 1L8DA 2XUMA 1VQKV 2LFSA 1FXKB 2BSKB 1H2SB 4JYAB 5KX5B 3CX5F 1R1BA 2E3CA 5LBQA 1HW7A 3E86A 4OX9O 2OCCB 4DV3B 4IHJA 5CBGA 3W7XA 2BTOA 4PELA 1AR5A 4NTXA 2ZD9A 5GTHZ 4JTAB 3T1YO 3CB2A 4DR3O 3E22A 5GTIZ 1YIJV 4UB6Z 4CBCA 4BWAA 1MNGA 5IDJA 4GX1A 2PYLA 4LWSB 4RQFA 2R72A 1KC8W 2ZKOA 4X89A 2BTQA 4PDRA 2AZ0A 2JGDB 1FXKA 2BSKA 1FJGB 3CHXA 4JI1O 1HDJA 3OR7C 4H0LB 3K08A 3B77A 1BE3H 4GX2A 4O4JA 1YF2A 5IY5B 4CS2A 5FNVA 5J2TA 1W2BU 3CWBH 5EBMC 4DR1B 3AK2A 3QG5A 3RVZA 4HAMA 2DQ3A 3L74H 5H6QA 2Q8VA 5C8YB 4OPAA 4CZZA 4I55B 2UUBB 3AG2C 4X1KA 5IYZA 2AZ2A 1AJPA 4JYBA 1K34A 1D5NA 1R3IC 2CDYA 4GUNA 4IYIA 4B3MO 1SQBH 3ML0A 3ZHQA 1MMMA 1QLEC 3L75H 4JASA 2VWKA 4PHZA 3HKEB 4FFBB 1R73A 2IJKA 2QJ1A 5JH7B 2VRZA 4YIOA 4LR3A 1JOYA 4TUYB 4GZRB 3QTCA 3CE2A 1KYOF 3B4SA 3EHBB 4JZ2A 4X1YB 5TISZ 4PA3A 1WPXA 2ATKC 3SPJA 4D7TA 4MTXA 1M57B 3SGIA 1Y74A 1YJWV 4DR4O 3K57A 3KCYA 2N74A 2F93B 4X1IA 1NQTA 4DV2O 2FL4A 3B8MA 1ZWIC 3OTOO 4DV7O 3CD6V 1XBLA 2CUGA 1DF4A 2OIEA 3AG4B 2YS8A 4LF6B 5J2TB 4ABMA 5IJ0A 3APQA 5CA1A 4JI6O 1WNSA 4UCRA 2QWPB 4O4HA 3MAQA 4ZHQB 1K97A 1GN3A 5K1XA
chains in the Genus database with same CATH topology
3C3SA 5A9GA 1XILA 1B06A 1BS3A 1ZUQA 2AW9A 1AP5A 1AVMA 1EN5A 4F6EA 1BSMA 1Y67A 2CE4A 2ADQB 1AR4A 2QKCA 3MDSA 4JYYA 3AK2A 4YIPA 3KDRA 3AK1A 2P4KA 3IC9A 1AP6A 3C3TA 2ADPA 1BT8A 3OT7A 1ZLZA 1D5NA 3KKYA 1EN6A 3TJTA 3QVNA 1VARA 1EN4A 2CDYA 4GUNA 1XUQA 2RCVA 1KKCA 1QNMA 1GN2A 1ZSPA 3DC5A 1MMMA 1PL4A 1ZTEA 3LSUA 4YIOA 1IX9A 1JR9A 1IDSA 3AK3A 4JZ2A 1VEWA 1MSDA 1LUVA 1EM1A 1P7GA 1I0HA 1WB7A 1N0JA 1SZXA 1WB8A 2GDSA 1GN4A 1N0NA 1XDCA 3CEIA 1LUWA 1JA8A 1AR5A 4BR6A 4JZGA 1IXBA 4X9QA 1XREA 3DC6A 5AG2A 2QKAA 1MNGA 1GN6A 1MA1A 3RN4A 3BFRA 1PM9A 1I08A 4E4EA 3EVKA 4C7UA 4FFKA 3K9SA 1GN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3S A;  5A9G A;  1XIL A;  1B06 A;  1BS3 A;  1ZUQ A;  2AW9 A;  1AP5 A;  1AVM A;  1EN5 A;  4F6E A;  1BSM A;  1Y67 A;  2CE4 A;  2ADQ B;  1AR4 A;  2QKC A;  3MDS A;  4JYY A;  3AK2 A;  4YIP A;  3AK1 A;  2P4K A;  3IC9 A;  1AP6 A;  3C3T A;  2ADP A;  1BT8 A;  3OT7 A;  1ZLZ A;  1D5N A;  3KKY A;  1EN6 A;  3TJT A;  3QVN A;  1VAR A;  1EN4 A;  2CDY A;  4GUN A;  1XUQ A;  2RCV A;  1KKC A;  1QNM A;  1GN2 A;  1ZSP A;  3DC5 A;  1MMM A;  1PL4 A;  1ZTE A;  3LSU A;  4YIO A;  1IX9 A;  1JR9 A;  1IDS A;  3AK3 A;  4JZ2 A;  1VEW A;  1MSD A;  1LUV A;  1EM1 A;  1P7G A;  1I0H A;  1WB7 A;  1N0J A;  1SZX A;  1WB8 A;  2GDS A;  1GN4 A;  1N0N A;  1XDC A;  3CEI A;  1LUW A;  1JA8 A;  1AR5 A;  4BR6 A;  4JZG A;  1IXB A;  4X9Q A;  1XRE A;  3DC6 A;  5AG2 A;  2QKA A;  1MNG A;  1GN6 A;  1MA1 A;  3RN4 A;  3BFR A;  1PM9 A;  1I08 A;  4E4E A;  3EVK A;  4C7U A;  4FFK A;  3K9S A;  1GN3 A; 
#chains in the Genus database with same CATH topology
 2BE3 A;  5CMU A;  4QNH B;  1UPG A;  1SER A;  3JAT B;  5EIB C;  3CJH A;  3HB3 B;  3CJH B;  2IU3 A;  1J95 A;  2CH7 B;  2ITD C;  4G28 B;  2XAF A;  3SJC C;  2JVD A;  1H2M A;  2Q7E A;  3VQY A;  4LCU C;  3GWK C;  3C3T A;  1AI6 A;  4IIJ A;  1JVM A;  2ADP A;  4CC6 A;  4NXN B;  4F6R B;  1XEQ A;  2YIB A;  4DR5 O;  2MW2 B;  2OT5 A;  3TGU H;  1S0V A;  3NXS A;  1UJW B;  4DV6 O;  4LH7 A;  4NYK A;  1HNW B;  2PF4 E;  4DV5 B;  3EFF K;  2OIG A;  3E83 A;  1ZSP A;  3P30 A;  3Q4H A;  4YJ2 A;  1R6N A;  2D2C B;  3ZN0 A;  1PKX A;  1U96 A;  2ITC C;  3N2G A;  1QQC A;  1HP8 A;  1RPO A;  3JAT A;  4R6Z A;  2Q73 A;  3TCU A;  4X1I B;  1TUB B;  3U0Z A;  1IXM A;  1EM1 A;  4ICG A;  1OCZ B;  3BHP A;  1P7G A;  2EUL A;  5F2V O;  3UQ8 A;  4WFF A;  1I94 O;  4X65 B;  2GDS A;  1JFF B;  1F23 A;  2Q7G A;  2Y0P A;  4CH6 A;  4RWU A;  5JCO C;  3CRC A;  2A3Q A;  4RQE A;  1QHT A;  4X66 B;  2EJR A;  2R9I A;  1XRE A;  4N21 A;  2EIK C;  5DN6 G;  4MVM A;  3J7A U;  2Q68 A;  2LQT A;  3JSL A;  2OYQ A;  2QTS A;  1FS0 G;  5E79 Z;  1N36 B;  3L70 H;  1Y74 B;  1NBM G;  1NH2 D;  1XMO B;  1E1R G;  3RT3 C;  5J9P C;  4C7U A;  2OCC C;  5L3B A;  1G6U A;  1NT2 B;  2EBO A;  1YTF D;  1AIL A;  1M56 B;  2EX3 A;  3SDL A;  3CCR V;  3P3P A;  3CSX A;  4MTF A;  2UU9 B;  4O4L B;  2UXC O;  2WAM A;  1Y67 A;  1H8E G;  2HJD A;  4EEQ A;  4LF4 B;  2E75 B;  3AG7 A;  4PV1 B;  5GW7 A;  2P4K A;  3KZI Z;  2EIN B;  4L87 A;  4I50 B;  2JJ1 G;  5A2Q N;  1X59 A;  5BY1 A;  1RPR A;  3K9A A;  2WSS G;  3N2G B;  2JJ2 G;  2BTQ B;  1KU9 A;  4PDM A;  1ORQ C;  2A7W A;  5KMG A;  1SQV H;  3FAV B;  1ZL8 B;  1WLE A;  4MT8 A;  4AIL C;  2DWE C;  2ZR2 A;  2HJF C;  3LNM B;  1QVG U;  4XBF A;  2WLL B;  2XAG A;  2H94 A;  4RUF A;  3T1H B;  4JV5 B;  1FFT B;  4MVU A;  1L0L H;  3ZHV A;  5L3D A;  5JJE B;  1JCH A;  5B66 Z;  2R9A A;  4J41 A;  2BOC C;  1N0J A;  1Y4M A;  4LWS A;  4K0K B;  1OHH G;  2IM9 A;  2GV9 A;  1N0N A;  3FB6 C;  3TET A;  4JI0 O;  3OMI B;  1CXZ B;  3A0B Z;  4BIZ A;  1IUR A;  2HHH O;  3QNE A;  5LXT A;  4MVO A;  1EZJ A;  1ZAU A;  1TVK B;  3B09 A;  1YDX A;  5AG2 A;  4FLZ A;  2WLL A;  4DW1 A;  3L9D A;  2X0L A;  4CS4 A;  4JAU A;  1PD3 A;  1SRY A;  5CA1 B;  4JPR A;  2F95 B;  1SQQ H;  4UB8 Z;  2QWO B;  2Y69 C;  3ASN C;  5ITZ B;  5KA5 A;  1Q3E A;  1GTO A;  4JF3 A;  4DK0 A;  2FYU H;  1K8A W;  4MS2 A;  3OFN G;  1XNR O;  2AHZ A;  4TQD A;  3CME V;  1AI4 A;  1OV9 A;  4I5S A;  4U7O A;  1SS3 A;  3G71 V;  4NVP A;  3N2K A;  4D7S A;  3G4S V;  1LNQ A;  1BQ0 A;  1WPB A;  1UFI A;  1IBM B;  5KHJ A;  2QKS A;  1M4U A;  4DR7 O;  3VQV A;  1VQ4 V;  4MTG A;  1N4C A;  3CCV V;  3FYE B;  4DW0 A;  3RYF A;  5DEC A;  3CRR A;  4NXM O;  2HEP A;  2D3O W;  2QM7 A;  1NR7 A;  1ZLZ A;  1KMI Z;  1PL0 A;  5FNV B;  1GM7 A;  3OR6 C;  2ZM6 O;  4B3T B;  4FPP A;  2GHY A;  3ABK B;  2XAH A;  4UCU A;  3RYH A;  3GB7 C;  3ABL C;  3AG1 B;  2R9R B;  3X2Q C;  3RYH B;  2P67 A;  1RSO B;  4I9Q A;  3LUT B;  3LSU A;  4LF8 O;  5B1A B;  1HNZ B;  2PI4 A;  2XT9 A;  1IX9 A;  4Q6G A;  1Y76 B;  1AJN A;  2Y48 A;  4DR6 B;  5EZY B;  3SYA A;  1US6 A;  2QEX V;  2RDC A;  4U7N A;  3C90 A;  2ZIO A;  1GO3 F;  2E5L B;  1SC5 B;  2AHY A;  2VQE O;  1FD9 A;  2OWO A;  3CCE V;  2YSU B;  2W0F C;  5KHH A;  3L72 H;  4BAY A;  2Q0A A;  2DJV A;  3VQW A;  4FLX A;  2PZS A;  1FJG O;  5BR8 O;  3JD1 A;  3WFV A;  4B3S B;  3K5L A;  1COW G;  3K06 A;  4JI7 O;  4QIW F;  4PJ0 Z;  4JAA A;  1R6K A;  2RN9 A;  2AXT Z;  5LL6 Y;  4XDK A;  1JPX A;  1QBZ A;  3S3X A;  3H1I H;  4PA6 A;  1NS1 A;  2EIJ B;  3SPC A;  3JAM N;  1I08 A;  2UXD B;  4DR5 B;  2EJ7 A;  5DM6 V;  1F4M A;  1Y66 A;  4WBN B;  4JI8 O;  3I55 V;  4I4T A;  4GT1 A;  5CN0 A;  4H37 A;  3ZBH A;  1XQ8 A;  5A9G A;  2VS0 A;  5LMU O;  2JS5 A;  4F6R A;  2EIM C;  4LFB O;  2WLM A;  1QLN A;  1PNM A;  3MDS A;  3ZRW B;  3CC7 V;  3RBZ A;  4I0X B;  5LMU B;  2IJI A;  1YI2 V;  3ZRV A;  4D6T H;  4LF9 O;  4QPK A;  3D36 C;  3Q4H B;  3KG2 A;  4UV9 A;  1BGY H;  1M56 C;  4LNU A;  2YEV B;  1YCI A;  3QO5 A;  4NR1 A;  2LJ2 A;  4HBN A;  1P4R A;  4R50 A;  5JVD B;  4GCZ A;  3D3Q A;  3E89 A;  3OM3 B;  3D8C A;  5KX5 A;  5BMV B;  1QCE A;  4DV6 B;  1BQZ A;  1NTZ H;  3E8H A;  2YUA A;  2ZDI C;  2B1G A;  1HR0 B;  2E74 B;  1U97 A;  4DUY B;  3ZRW A;  2ZCE A;  3CRA A;  2FTK A;  3SPI A;  2WA3 A;  1JR9 A;  3AK3 A;  2WLI A;  5IE9 A;  2KG7 A;  3H9V A;  2JS3 A;  4O4H B;  4UCV A;  1SZX A;  1K4C C;  1B6Q A;  2Y0I A;  1LUW A;  2QWQ B;  1JA8 A;  2LW1 A;  5H9C A;  3ZRS A;  2P7T C;  2YID A;  3G6E V;  3SYO A;  3BAA A;  1OCO C;  2DW4 A;  3JAS B;  5CA0 A;  2ARH A;  1VF6 C;  1B04 A;  3DC6 A;  2YDE A;  3H1H H;  4DR2 B;  3ZHU A;  4J42 A;  1GAX A;  2NN4 A;  4GKK B;  3JYC A;  2YIA A;  4O2B A;  4B3S O;  2JK5 C;  3RN4 A;  2UUA B;  3E8G A;  1VIB A;  3BVO A;  2JIZ G;  5B3S B;  3JAK A;  2IJJ A;  3EVK A;  3ZMV A;  1ENV A;  2ZIN A;  3U11 A;  4FFK A;  4IL6 Z;  5IT9 N;  1H5W A;  3K0G A;  4LF9 B;  5EIB D;  1K92 A;  1B06 A;  5IYZ B;  1BS3 A;  4MVZ A;  2ZXW C;  4LBE C;  4Q20 A;  1AI5 A;  1SA0 B;  1RM1 C;  1VQ9 V;  3JAW A;  4LF7 O;  5LHH A;  4JAV A;  1X4T A;  3FKS G;  1HNX B;  2L35 A;  4WCE V;  1Y76 A;  1GM9 A;  5CBF A;  1N34 O;  4O4J B;  5LA6 B;  1H8H G;  4NTY A;  5B1N A;  3K5O A;  3LNN A;  3OGC C;  3JD4 A;  2ZE5 A;  4JGS A;  1K4D C;  1LR1 A;  1V9P A;  1GK9 A;  1URF A;  4DV0 O;  1GN2 A;  4G27 B;  4KFM A;  3VQX A;  1Q82 W;  2DMX A;  2Y4T A;  3JAW B;  1DGS A;  1G1X B;  4LH6 A;  3OUF A;  1N32 B;  4F4L A;  3FD9 A;  3B40 A;  4JI5 O;  2Q7H A;  2Y4U A;  4OGQ B;  5BMV A;  1JJ2 U;  2DOS A;  1MOF A;  4DV1 B;  3STL C;  4Z1V A;  4I7Z B;  4BIU A;  2XAS A;  4WFH A;  2NLJ C;  5GON A;  4TQF A;  4I0X A;  2CTR A;  1SF9 A;  3E22 B;  3M7M X;  5EC1 C;  3UO3 A;  4LF6 O;  4CS3 A;  1Z5V A;  4PA4 A;  4B3T O;  3OTO B;  1NTM H;  3IFX A;  1YZB A;  1P49 A;  2LGW A;  5LMN O;  1FXH A;  4GKJ B;  3CMA V;  3DGE A;  4WBN A;  4XDJ A;  4FVM A;  1FAF A;  5JQG A;  4JI4 O;  1L1F A;  1K7D A;  4JTC B;  4EB6 B;  3OD4 A;  4H13 B;  4JI2 B;  1BCC H;  3DXR B;  2GUZ A;  3ZHT A;  1EBO A;  2CGN A;  1M9N A;  4YY3 O;  1MG1 A;  2VQE B;  1FOU A;  1Z2G A;  2L6L A;  3ZS8 C;  2E5L O;  3UT5 B;  4ZHQ A;  2YEV A;  3ABK C;  2JGU A;  4KUM A;  1SZT A;  3JSN A;  4B3R B;  1EFR G;  5LGT A;  2JEU A;  3M99 B;  4B3R O;  3QVN A;  3SYP A;  4BIO A;  2IU0 A;  3ETE A;  4KHP B;  1G4Y B;  1W0K G;  1AI7 A;  3BPZ A;  3E8B A;  4X64 O;  3K79 A;  2V1D A;  4IYH A;  3JAR B;  5JH7 A;  2P4V A;  2YC0 A;  4O4I A;  3K58 A;  1WN7 A;  3I56 V;  1ZTE A;  4LFA O;  3O65 A;  4ZKI A;  1FFX B;  5KA6 A;  2CTW A;  5IJ0 B;  3K04 A;  3QO8 A;  1AR1 B;  3CC4 V;  5C8Y A;  1SQF A;  1I7F A;  2W6J G;  3ZMU A;  4GX5 A;  3RW0 A;  4YY3 B;  3FB8 C;  4JV5 O;  3A0H Z;  1SA0 A;  2YIB D;  1JX9 A;  3APO A;  2IH3 C;  1OZ0 A;  1N32 O;  2FKX A;  3P32 A;  3HKC A;  2ZQM A;  5E1A C;  2IH1 C;  1GN6 A;  1WP8 A;  4DV7 B;  1H2K A;  1RM1 B;  5IJ9 A;  2YIC A;  5LA6 A;  3F7V C;  4E4E A;  4NXN O;  1TUE B;  3T1Y B;  2C2A A;  5LYJ A;  3TXQ A;  3K9S A;  1O9H A;  3OMA B;  1RSO A;  1MZE A;  1MAB G;  2Z3Y A;  1XMQ O;  3G6B A;  3CPW U;  1V55 C;  5C93 A;  3JD2 A;  1WJZ A;  2QWN B;  3N2K B;  4NTW A;  4FZ0 A;  4YHH O;  4ZI7 A;  1IBK B;  4UVA A;  3CP1 A;  4GKJ O;  1TGO A;  3H1K H;  3W7W A;  2EIK B;  1VF5 B;  5LP6 C;  3IC9 A;  1N33 B;  5EBL C;  3CCU V;  2CGO A;  4HZ3 A;  4PDL A;  1L0N H;  4MVS A;  4EFB A;  1YXB A;  3UKM A;  1YJ9 V;  4J7J A;  2A06 H;  1WA8 A;  2AGA A;  2WLK A;  4P30 A;  1F51 A;  3ETD A;  3SYQ A;  3RGB A;  4K8X A;  2Q69 A;  3W7T A;  4J10 A;  1V54 B;  1IBL O;  1VEW A;  4U3J B;  5EBW C;  4YJ3 B;  5L3G A;  4YJ3 A;  2EIL B;  4JI3 O;  1E1Q G;  1F7Y A;  3A0R A;  2H3O A;  3ZIA G;  2ODM A;  5BXZ A;  2YXH A;  3OUS A;  2HVJ C;  4DV0 B;  1WA8 B;  2KB1 A;  2UU9 O;  3IAY A;  1Q6I A;  1W59 A;  1WAZ A;  3E8F A;  2O57 A;  3OW2 U;  4DR6 O;  1VQN V;  1Q7Y W;  5B1O A;  4X20 B;  4UCO A;  4UCT A;  1E79 G;  4UCS A;  3CCQ V;  3FX7 A;  2A9H A;  5B5E Z;  4JTD B;  1VQ5 V;  3ABM B;  4OPH A;  4HNA A;  4PA7 A;  3WB2 A;  2UUA O;  1ZL8 A;  2ETN A;  2ZE8 A;  5FPR A;  4TSF G;  2QM8 A;  4LFC B;  3ASO C;  3C3S A;  4FJC C;  5LGU A;  4K0K O;  1S76 D;  5KHK A;  3L71 H;  1R3L C;  2IBZ H;  2CAZ C;  2CE4 A;  2X7R B;  4DUY O;  4X1Y A;  5LGN A;  3RFR A;  5LP6 A;  2F1M A;  3ZCC A;  2EZP A;  1Q90 D;  4EKW A;  5JWP A;  4I50 A;  1NVP B;  1PNK A;  3B8N A;  3KKY A;  4UUJ C;  5LOV B;  4NKG B;  1EN4 A;  2Q67 A;  1S5H C;  2UUB O;  3MHS C;  4TV9 A;  3HR0 A;  1JJO A;  1HWY A;  1P7B A;  4O4L A;  3AG1 C;  4TV9 B;  2GUZ B;  3PJS K;  1PL4 A;  4NB5 A;  2WLN A;  2XTA A;  1K9M W;  5KHG A;  1GM8 A;  1SQX H;  4RUE A;  2WLH A;  5FPO A;  2EIJ C;  1MZF A;  4W4L A;  3UM7 A;  2IW5 A;  1MSD A;  1XNR B;  4H44 B;  1I0H A;  2Q9L A;  5LP6 B;  4RO2 A;  1IVS A;  4TT3 G;  2KG7 B;  5K1P A;  2A79 B;  2KQX A;  4PDV A;  1YTF B;  1CP9 A;  5LOV A;  2UXX A;  3CEI A;  5IYB O;  2X6C A;  5IY5 C;  3OGI B;  3GVM A;  1TVK A;  4JYA O;  2ZDI A;  3JAR A;  2Q0O C;  2ZE7 A;  1YIT V;  4J11 A;  5KUM A;  2IJH A;  4ZBM A;  3T1H O;  2QKA A;  4O2B B;  1Q6U A;  3LDE A;  5L3C A;  2GSM B;  3THO A;  2RNB A;  3OAA G;  1TAE A;  2YXY A;  3IC7 A;  3CXC U;  3BAB A;  4YXW G;  4DYL A;  4BW9 A;  4FLU A;  4PI2 A;  3I5D A;  3ASO B;  3RYI B;  5KAI Z;  4F6E A;  2UXN A;  3JAS A;  4LFA B;  1F4N A;  2ILM A;  4U3J A;  4YIP A;  3KDR A;  4EFE A;  3CCL V;  4LF5 B;  2QE7 G;  1IBL B;  1EN6 A;  2LP7 A;  3AG4 C;  1BL8 A;  4UV8 A;  3R65 A;  3O9O A;  2Z0A A;  4DR4 B;  3K03 A;  3H1L H;  3MD0 A;  3CCM V;  1YHQ V;  1PPJ H;  3J80 N;  3SPG A;  2JDI G;  4JI3 B;  4FMT A;  3K3W A;  1IDS A;  5H2F Z;  4KL1 A;  1WP7 A;  2PGG A;  4JI0 B;  1WB7 A;  4LF8 B;  3CS5 A;  2OTL V;  1KD1 W;  3HKB B;  1WB8 A;  3JCU Z;  1I94 B;  3A8T A;  3H1J H;  4JI5 B;  1VQ8 V;  4JZG A;  1YSC A;  1VQ7 V;  1IXB A;  2UXB O;  4PD4 F;  4RAI A;  1KBH A;  4ZOL B;  1THZ A;  2Q4P A;  2K9P A;  1YEW A;  3LDD A;  1Q81 W;  2GBO A;  4WFB V;  1N33 O;  2CTQ A;  4UVB A;  4GYC B;  2DQ0 A;  4MW3 A;  3P3N A;  1RP3 B;  1TUB A;  1VMG A;  3FB7 C;  1PNL A;  2UUC B;  2BCC H;  3D3I A;  5B1B B;  3OTF A;  4AI8 A;  5JCO A;  3ZN1 A;  1T5E A;  2AW9 A;  4P2Z A;  1AVM A;  2M7W A;  1VP7 A;  3BCC H;  4JYY A;  1OJH A;  2XOK G;  3DTU B;  1FFX A;  4WFE A;  1W0J G;  2EZO A;  2B5U A;  3N27 A;  3UT5 A;  3SR2 C;  2LO1 A;  2JGD A;  2WPD G;  3BA8 A;  3R66 A;  3CYO A;  1KKC A;  1KP3 A;  5DED A;  1G8M A;  2EIN C;  5LHI A;  1BHA A;  2K1E A;  4TWK A;  3WG7 C;  4LF5 O;  2QGN A;  1SET A;  1K5Q A;  3GWO A;  1EZV H;  3G67 A;  4DV1 O;  1KKD A;  4OXS A;  3ZHR A;  5KAF Z;  2WLI B;  3AG3 C;  2PUS A;  1VF6 A;  3ABT A;  4DRX A;  1R3J C;  4I55 A;  3OE7 G;  5IYC O;  1H2N A;  2Y69 B;  3ASN B;  1GN4 A;  4JI6 B;  1XDC A;  3SYC A;  1MSW D;  1YJN V;  3TK1 A;  1NJI W;  3SJB C;  3VOU A;  4BR6 A;  3T4D A;  4TOI A;  5KLV H;  3ABL B;  3F5W C;  3STZ C;  2UXD O;  3B2E E;  3OEH G;  4KP4 A;  1K3E A;  2P06 A;  3T2M A;  1GKF A;  4QE9 A;  2CK3 G;  2P22 C;  2ZXW B;  1KB9 F;  5ITZ A;  4JYC A;  3HKD B;  3CRQ A;  2QR4 A;  3JCZ A;  3OMN B;  1XHX A;  3CRM A;  1DLB A;  3E35 A;  5CA3 A;  2P6J A;  2W6I G;  1SKV A;  5EC2 C;  4ZI7 B;  4FM0 A;  4TV8 A;  5JVD A;  1JQ0 A;  1XMO O;  2UUC O;  2DYR C;  1FKA O;  4FM2 A;  5EK0 A;  4DV4 O;  4DV5 O;  1VQM V;  3HPL C;  4FM1 A;  1SES A;  3VBB A;  2RJZ A;  1OCO B;  5JJJ B;  4L8J A;  4KXR A;  5LYJ B;  2HFE C;  4X64 B;  3E2E A;  4BW5 A;  1D5A A;  2OTJ V;  1NH2 B;  2ZM6 B;  2RQ6 A;  3ZJZ A;  3T1C A;  4X8A A;  4AHC A;  4X66 O;  1BZK A;  4FIP C;  4DR3 B;  3LSQ A;  2PYJ A;  1LUV A;  5EZY A;  5J2U B;  1I5X A;  2YI9 A;  3RVY A;  3AG3 B;  5J2U A;  1S72 V;  4J80 A;  4JI2 O;  2P90 A;  3ETG A;  1FXK C;  3WB1 A;  3HKE A;  4DUZ B;  2QM4 A;  3FYI B;  3HKB A;  4LFC O;  1KQS U;  3WU2 Z;  5B1A C;  1AB3 A;  3ZHS A;  3K59 A;  1N8R W;  2DWD C;  2WLJ A;  2G38 A;  4J9Z B;  3W7U A;  4X62 O;  2DYS C;  1DTO A;  4IGG A;  4JI7 B;  4Z2W A;  4CH4 A;  2HVK C;  5BR8 B;  3BFR A;  4HNA B;  2ZE6 A;  4A5U B;  1Q86 W;  1VQL V;  4LF7 B;  2GTS A;  1XNQ B;  4K35 A;  1JFF A;  4DO2 A;  1NTK H;  1XL6 A;  4IHJ B;  1NKD A;  1HNX O;  1V55 B;  1AP5 A;  1RFY A;  2QTO A;  1BSM A;  2HG5 C;  1H2L A;  1M90 W;  4X65 O;  1GMG A;  3AK1 A;  4ZOL A;  4E2L A;  4FLT A;  4GLX A;  4FLW A;  2EIL C;  1N36 O;  2KKW A;  2ZR3 A;  4B3M B;  1NR1 A;  4FK5 C;  1AP6 A;  3DSQ A;  3FFQ A;  4FZ1 A;  4P9O A;  4AQY B;  1D2D A;  2HR3 A;  4DRX B;  2MK3 A;  4MTO A;  4B7K A;  4JI1 B;  3TJT A;  4KHP O;  5IWA B;  2YI8 A;  5LXT B;  4NXM B;  1HR0 O;  2X6A A;  3QF7 A;  4IT5 A;  3DC5 A;  1VQP V;  3DXR A;  2V4D A;  1DF5 A;  5B3S C;  2BOB C;  1NVP D;  2N05 A;  4J7Z A;  4TUY A;  4ZIB A;  1VF7 A;  2ZIM A;  4G2K A;  4YHH B;  4OX9 B;  1S3J A;  3JD0 A;  3U10 A;  5H5N A;  1VQ6 V;  4X88 A;  2DYR B;  2HHH B;  2R70 A;  1CPY A;  4UVC A;  2LGQ A;  4DV3 O;  1R3K C;  2UXC B;  1XMQ B;  1S5J A;  1BMF G;  2EIM B;  2WA4 A;  1BHB A;  2XND G;  3MHH C;  4LFB B;  2FB5 A;  2E76 B;  3FB5 C;  4FFB A;  3D36 A;  5LMN B;  5IYD O;  1FXV A;  2CTP A;  2DYS B;  2F66 C;  1XL4 A;  1ROP A;  3CCJ V;  5IWA O;  2WWW A;  5IJ9 B;  1TA8 A;  1OCR C;  5EYP A;  5LHG A;  4DR2 O;  4JI4 B;  5CB4 A;  3EXA A;  4QGP A;  2QSA A;  2XHB A;  4AQY O;  2LFR A;  1O9G A;  4DV4 B;  3OEE G;  2NNU A;  5D5Q A;  1FPO A;  1Q5O A;  4QE7 A;  5D5P A;  5L3E A;  1JNB A;  2B9Z A;  2ZNI A;  4PA9 A;  4DR1 O;  4O2A B;  1FYJ A;  1H2G A;  1EN5 A;  1OCC B;  3KCX A;  3AG2 B;  2ADQ B;  4DK1 A;  2F23 A;  4Z1M G;  4JI8 B;  1NZ6 A;  1PV0 A;  2OCH A;  3HKC B;  1B3Q A;  3BEH A;  1R6T A;  3SJA C;  3NR7 A;  3K5N A;  1DK1 A;  5EYP B;  4XDL A;  3X2Q B;  2F4V O;  3JAK B;  3TXS A;  1Y6X A;  2HKO A;  4YJ2 B;  2DN9 A;  1QNM A;  4MW8 A;  3ZMT A;  2M6Y A;  3H01 A;  2VQF O;  4UFZ A;  4PI0 A;  4J7K A;  2PTM A;  4X20 A;  1CEZ A;  2F43 G;  3RWR D;  2JRI A;  3K5M A;  4DUZ O;  4TV8 B;  4FLV A;  3ZX6 A;  4IIJ B;  2H8P C;  3AEI A;  3F5T A;  4DR7 B;  4HYO A;  2Z5U A;  2DE0 X;  4EB6 A;  1IBM O;  1M5I A;  1M1K W;  1Q8I A;  2Q5Z A;  2QWR B;  3JAL A;  4CH5 A;  3UO2 A;  1NU1 H;  1QVF U;  2HLD G;  1Z5W A;  5L3F A;  3ABU A;  4B7E A;  1I5Y A;  4X9Q A;  3RYI A;  1GRJ A;  1V54 C;  1XNQ O;  2QDO A;  3RYC B;  1M93 A;  1MA1 A;  2PI5 A;  3RYC A;  5HFM A;  1PM9 A;  2FML A;  4I4T B;  2CH7 A;  5KHI A;  2KSD A;  4W4K A;  3ZRX A;  1XOU A;  1XIL A;  3JD3 A;  5FL7 G;  3L73 H;  1ZUQ A;  3IGA C;  4J9Y B;  5HFL A;  3G80 A;  3WB0 A;  1OCC C;  4R8C A;  5GON B;  2QKC A;  2V7Q G;  4U3F H;  4QJF B;  3T4Z A;  3SJQ C;  1M57 C;  4I9W A;  4LP8 A;  3LSS A;  3SPH A;  4K3A A;  2RMK B;  1K73 W;  1OCZ C;  2QA4 V;  2YXL A;  1VQO V;  1HNW O;  3CC2 V;  4LNU B;  1OCR B;  4ASU G;  3OT7 A;  1SQP H;  3W7S A;  3FAV A;  3BA9 A;  1IZ3 A;  4MVQ A;  1VAR A;  5JJN B;  1XUQ A;  2RCV A;  5KUK A;  2W0X A;  1H38 A;  4CC5 A;  3IJ4 A;  1P84 F;  2XAJ A;  2A0L A;  3JAL B;  2GTA A;  1KP2 A;  4K8Z A;  1SQG A;  3QO7 A;  3ZMS A;  1IBK O;  3ICX A;  1J5E O;  2JEX A;  1ARO P;  5CB4 B;  1IJG A;  5B1B C;  1XHZ A;  1J5E B;  1S77 D;  3ABM C;  4X1K B;  5KMG B;  2NR5 A;  3ETQ A;  4DXW A;  4N23 A;  4QPJ A;  1PP9 H;  3ZMZ A;  1QR9 A;  1Q43 A;  1K33 A;  4DV2 B;  2UXB B;  2ZNJ A;  5CBH A;  4X62 B;  5BZB A;  2PY5 A;  3BY6 A;  1Q6H A;  1QU7 A;  1NI8 A;  1ZX3 A;  1N34 B;  2XAQ A;  3LDC A;  1K5S A;  2P5O A;  1KEC A;  4UXN A;  2Q6A A;  4LF4 O;  4WFA V;  4WF9 V;  4LC1 A;  5H6R A;  3WG7 B;  1QR8 A;  4O2A A;  3BRC A;  1AR4 A;  4MVR A;  2N04 A;  4CH3 A;  4GX0 A;  2VQF B;  3S3W A;  3F7Y C;  2X6B A;  2HP8 A;  5CA0 B;  5FLX N;  1HNZ O;  4O4I B;  1XI1 A;  5JQG B;  1JMK C;  4P9P A;  2LW7 A;  2F4V B;  3RYF B;  1BT8 A;  4MSW C;  3M8A A;  1AJQ A;  3HKD A;  4FLY A;  3CXH F;  2ZT9 B;  3K0D A;  3UCS C;  1A32 A;  1YVW A;  4GKK O;  4WFG A;  1KUQ A;  1S5L Z;  1QLE B;  3J81 N;  2B1I A;  3CCS V;  3PN1 A;  1GH6 A;  2VWJ A;  4H33 A;  4B08 A;  4R7C A;  3A2F A;  3ZED A;  1L8D A;  2XUM A;  1VQK V;  2LFS A;  1FXK B;  2BSK B;  1H2S B;  4JYA B;  5KX5 B;  3CX5 F;  1R1B A;  2E3C A;  5LBQ A;  1HW7 A;  3E86 A;  4OX9 O;  2OCC B;  4DV3 B;  4IHJ A;  5CBG A;  3W7X A;  2BTO A;  4PEL A;  1AR5 A;  4NTX A;  2ZD9 A;  5GTH Z;  4JTA B;  3T1Y O;  3CB2 A;  4DR3 O;  3E22 A;  5GTI Z;  1YIJ V;  4UB6 Z;  4CBC A;  4BWA A;  1MNG A;  5IDJ A;  4GX1 A;  2PYL A;  4LWS B;  4RQF A;  2R72 A;  1KC8 W;  2ZKO A;  4X89 A;  2BTQ A;  4PDR A;  2AZ0 A;  2JGD B;  1FXK A;  2BSK A;  1FJG B;  3CHX A;  4JI1 O;  1HDJ A;  3OR7 C;  4H0L B;  3K08 A;  3B77 A;  1BE3 H;  4GX2 A;  4O4J A;  1YF2 A;  5IY5 B;  4CS2 A;  5FNV A;  5J2T A;  1W2B U;  3CWB H;  5EBM C;  4DR1 B;  3AK2 A;  3QG5 A;  3RVZ A;  4HAM A;  2DQ3 A;  3L74 H;  5H6Q A;  2Q8V A;  5C8Y B;  4OPA A;  4CZZ A;  4I55 B;  2UUB B;  3AG2 C;  4X1K A;  5IYZ A;  2AZ2 A;  1AJP A;  4JYB A;  1K34 A;  1D5N A;  1R3I C;  2CDY A;  4GUN A;  4IYI A;  4B3M O;  1SQB H;  3ML0 A;  3ZHQ A;  1MMM A;  1QLE C;  3L75 H;  4JAS A;  2VWK A;  4PHZ A;  3HKE B;  4FFB B;  1R73 A;  2IJK A;  2QJ1 A;  5JH7 B;  2VRZ A;  4YIO A;  4LR3 A;  1JOY A;  4TUY B;  4GZR B;  3QTC A;  3CE2 A;  1KYO F;  3B4S A;  3EHB B;  4JZ2 A;  4X1Y B;  5TIS Z;  4PA3 A;  1WPX A;  2ATK C;  3SPJ A;  4D7T A;  4MTX A;  1M57 B;  3SGI A;  1Y74 A;  1YJW V;  4DR4 O;  3K57 A;  3KCY A;  2N74 A;  2F93 B;  4X1I A;  1NQT A;  4DV2 O;  2FL4 A;  3B8M A;  1ZWI C;  3OTO O;  4DV7 O;  3CD6 V;  1XBL A;  2CUG A;  1DF4 A;  2OIE A;  3AG4 B;  2YS8 A;  4LF6 B;  5J2T B;  4ABM A;  5IJ0 A;  3APQ A;  5CA1 A;  4JI6 O;  1WNS A;  4UCR A;  2QWP B;  4O4H A;  3MAQ A;  4ZHQ B;  1K97 A;  1GN3 A;  5K1X A; 
#chains in the Genus database with same CATH homology
 3C3S A;  5A9G A;  1XIL A;  1B06 A;  1BS3 A;  1ZUQ A;  2AW9 A;  1AP5 A;  1AVM A;  1EN5 A;  4F6E A;  1BSM A;  1Y67 A;  2CE4 A;  2ADQ B;  1AR4 A;  2QKC A;  3MDS A;  4JYY A;  3AK2 A;  4YIP A;  3KDR A;  3AK1 A;  2P4K A;  3IC9 A;  1AP6 A;  3C3T A;  2ADP A;  1BT8 A;  3OT7 A;  1ZLZ A;  1D5N A;  3KKY A;  1EN6 A;  3TJT A;  3QVN A;  1VAR A;  1EN4 A;  2CDY A;  4GUN A;  1XUQ A;  2RCV A;  1KKC A;  1QNM A;  1GN2 A;  1ZSP A;  3DC5 A;  1MMM A;  1PL4 A;  1ZTE A;  3LSU A;  4YIO A;  1IX9 A;  1JR9 A;  1IDS A;  3AK3 A;  4JZ2 A;  1VEW A;  1MSD A;  1LUV A;  1EM1 A;  1P7G A;  1I0H A;  1WB7 A;  1N0J A;  1SZX A;  1WB8 A;  2GDS A;  1GN4 A;  1N0N A;  1XDC A;  3CEI A;  1LUW A;  1JA8 A;  1AR5 A;  4BR6 A;  4JZG A;  1IXB A;  4X9Q A;  1XRE A;  3DC6 A;  5AG2 A;  2QKA A;  1MNG A;  1GN6 A;  1MA1 A;  3RN4 A;  3BFR A;  1PM9 A;  1I08 A;  4E4E A;  3EVK A;  4C7U A;  4FFK A;  3K9S A;  1GN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...