1WB8A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
b'IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [FE]
molecule tags Oxidoreductase
source organism Sulfolobus solfataricus
publication title Iron Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus: Analysis of Structure and Thermostability
pubmed doi rcsb
total genus 75
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb8A02
4GUNA 4JZGA 3CEIA 1EN6A 5AG2A 1GN2A 1SZXA 1VARA 3EVKA 3QVNA 1JR9A 1JA8A 1XUQA 1GN3A 1XILA 1EN4A 1KKCA 1MA1A 1MSDA 3AK3A 1B06A 1I0HA 1EM1A 1ZSPA 4C7UA 3DC5A 3AK2A 1IX9A 1ZLZA 3AK1A 1ZTEA 3BFRA 3LSUA 2P4KA 1MMMA 1IDSA 1QNMA 4E4EA 4F6EA 3C3TA 1N0JA 1WB7A 1AR4A 2CDYA 5A9GA 2ADQB 1GN6A 1AP6A 1VEWA 4FFKA 2AW9A 3IC9A 3KKYA 1P7GA 3K9SA 2ADPA 1Y67A 3OT7A 3RN4A 1I08A 4JZ2A 3DC6A 4X9QA 2RCVA 4YIPA 1D5NA 1XDCA 1PM9A 1WB8A 1LUWA 2GDSA 1BSMA 1AP5A 4JYYA 1GN4A 1IXBA 2QKCA 1BS3A 1MNGA 4BR6A 2CE4A 1PL4A 1BT8A 3C3SA 1XREA 1LUVA 1N0NA 1EN5A 1AVMA 1ZUQA 3MDSA 4YIOA 2QKAA 1AR5A 3TJTA
chains in the Genus database with same CATH superfamily
3ZCCA 2Q0AA 2EX3A 4MVRA 1EN6A 1GN2A 1Y66A 2WLNA 4P9OA 1HNXO 4L87A 2QWRB 4AQYB 2LFRA 3FB8C 4MW8A 1NR1A 2GBOA 4TQFA 3DGEA 2DWEC 1Y6XA 4O4LA 2HVKC 3CB2A 4O2BB 1V9PA 1XHZA 1P49A 4UV8A 4CZZA 3DC5A 3OFNG 3P3NA 3WB2A 2Y0PA 5KHIA 3HR0A 4DV0B 3UCSC 3E83A 4PI2A 4OPHA 2XAQA 1I94B 1A32A 5KX5B 4LF5B 2EIJC 2BSKB 1HR0B 1Y74A 3WB0A 3SPGA 1FJGO 3H1HH 5A9GA 3G6EV 4J80A 2GHYA 1CPYA 5EBMC 3UKMA 4WCEV 3IC9A 1JPXA 4QE7A 1K8AW 2VRZA 3ABUA 2HJFC 2VQEO 5IY5B 5K1PA 1Y67A 2PY5A 4UCVA 2D2CB 1AJQA 1JMKC 2UUAB 2QGNA 2QWQB 4NKGB 3PJSK 5GONA 3CC4V 3RYCB 1RSOA 4J7ZA 3CPWU 3AG3B 5IJ0B 4U3JB 4I9WA 4GX0A 5EZYA 2V4DA 5JH7A 3CCMV 3JAMN 2XASA 2PUSA 2GTSA 4FM0A 3UO3A 5EIBC 3CCQV 4YXWG 3K59A 2CTPA 4PELA 1J95A 3HKDB 5AG2A 1S5HC 3SJQC 1H8EG 1BZKA 3ML0A 4DK1A 1OCOB 4DV5B 3E8GA 3WFVA 1Q6UA 1F7YA 2LP7A 1IBKB 3B09A 1NQTA 4MVUA 2KKWA 3E8HA 1NS1A 4WF9V 3K5MA 5JCOC 5K1XA 1HNWO 2P4KA 1IDSA 5IJ0A 2FTKA 2X6AA 1K3EA 1QBZA 3BA9A 4TT3G 3X2QC 2HEPA 5CB4B 3BPZA 5EYPB 1V55C 5GONB 4K8ZA 1VQ7V 1L0NH 4KHPB 3ZRWA 3E22A 3FAVA 4WFBV 3EHBB 2XOKG 5KMGB 4JI1B 3JYCA 4JAUA 4X64O 4FLYA 3K9SA 1WA8A 4DR5B 3CD6V 3BRCA 4JI8O 1FXKA 1YDXA 2A9HA 3OT7A 1SRYA 3FYEB 4DW1A 4FIPC 4YJ2B 3CP1A 3JD0A 4MSWC 3B4SA 2LGWA 5L3GA 4IGGA 3K58A 2GUZB 3T1YB 1R6TA 4I4TA 2GDSA 3GWKC 4F4LA 2EULA 4LF9B 2R9IA 2QTSA 3U10A 1BT8A 4JTCB 5CA1A 3JD1A 5BY1A 3CCUV 1LUVA 4MTOA 4K0KB 3F5TA 3UQ8A 1QU7A 3MAQA 1QQCA 1FS0G 3ETDA 1S5JA 3CEIA 1VQNV 1R3IC 1IBLO 5B3SC 5LP6C 5CMUA 2LQTA 4AQYO 1JA8A 1NR7A 2Y4UA 1BCCH 1JX9A 4HYOA 2UXDO 1VQ9V 1M57B 5B1NA 5D5QA 2Q7HA 3JARA 2ZDIA 3ZHSA 2WA3A 2VWJA 1BHAA 1OHHG 2NR5A 3JALA 4BIZA 4N23A 3N27A 1IX9A 2YIBD 3K0GA 1K4CC 1JFFB 3AG2B 3IJ4A 3QTCA 4TUYB 4NXMB 3CXHF 2OIGA 5IYBO 4P2ZA 4IYHA 4DV1B 4LFAO 2ZIOA 2QR4A 3APQA 5B1AC 1YCIA 4JYCA 2IM9A 3CCSV 2CH7B 3BABA 3FD9A 2ZM6B 2UUAO 1Q43A 3ZN1A 2B5UA 2N04A 2V1DA 1PM9A 2ZNIA 5IJ9B 4DR4O 4B3MB 3JAWB 4WFEA 1N32B 4JI3B 3O9OA 4MW3A 4MVZA 4X1IA 5LGUA 1EBOA 3STZC 4J7KA 2YUAA 2Q0OC 1GKFA 2G38A 3T1HO 3C3SA 4XDJA 2A0LA 3CCVV 4FPPA 2ZE6A 1PNMA 1AR5A 1T5EA 3CXCU 4GX2A 3SR2C 2QTOA 1H2SB 4GUNA 4WBNB 1TUEB 1U97A 4LF4B 1VARA 4QJFB 2W0FC 3EVKA 1VQ4V 4ZI7B 4PA4A 1KB9F 5LGNA 1WJZA 1VP7A 1IBMO 4TSFG 1GRJA 4IHJB 4DV4O 1ZAUA 1EM1A 2W6JG 5H2FZ 4AILC 1HNWB 4NXNB 3TETA 1NH2B 1MMMA 4I55B 2CGOA 3L9DA 2YEVB 3C3TA 1H2KA 3CC7V 3VQVA 1O9HA 5JWPA 4PA9A 1MABG 3Q4HB 1S0VA 2E5LO 1VEWA 3SJBC 2Q4PA 4JI1O 3RFRA 3E89A 3VOUA 1Q86W 3ZRVA 1AI5A 4UVBA 3JARB 5KHGA 4WFHA 2Y0IA 4DR3O 2HP8A 2OTJV 1WP8A 1S72V 5CA0B 1AI4A 2W6IG 1YTFD 1AR1B 3RYFA 1WB8A 2UU9B 1VQMV 4OGQB 4GX5A 4GKJO 3JATA 1OCRB 1G8MA 1BS3A 2DQ3A 3HKCA 3LDCA 3A0BZ 1TGOA 2F4VO 3LSQA 5LXTB 4RQFA 2WLIA 4LFBO 2OCCC 2JGDB 5FLXN 4JI2O 4PI0A 3K79A 1N34B 2HLDG 4HAMA 1AROP 1IURA 2PYJA 4CH5A 1P7BA 1BQ0A 1M56C 5H6RA 1I5YA 1X4TA 4IL6Z 5H9CA 2YI9A 1OCZC 4UB8Z 1LR1A 3CMAV 1KD1W 1VQ5V 3OGIB 3W7XA 1W0KG 2UXDB 4RWUA 1O9GA 2R72A 1QVGU 5CBHA 4FLWA 1L1FA 5C93A 5DN6G 2KQXA 2Q9LA 2FKXA 5JCOA 5LHGA 4O2AB 4X66B 3ZBHA 1I7FA 1I0HA 3G67A 3WB1A 1ZL8A 3AK2A 1QLEC 3ABKB 1YF2A 3RYHB 4JASA 4FVMA 4FLZA 4UVAA 3ZHVA 4DV1O 5B66Z 5LOVA 1N0JA 3A0RA 4TV8A 4JI4B 1RPOA 1KUQA 2M7WA 4CS3A 4EEQA 3OTOO 3ZS8C 2ZM6O 2AGAA 4P30A 4UCSA 1F23A 1TA8A 1F4MA 1M4UA 3AG1C 3JAKB 4OX9B 4B3RO 2UUCO 3T4DA 1XHXA 2R9AA 3BA8A 2PI5A 1BL8A 1GTOA 2GTAA 2CTQA 1XNRB 5JJNB 5BR8O 1ORQC 1XOUA 2E75B 2JS5A 4LP8A 2BTQA 4DV0O 3JD2A 4TV9B 3G80A 1OCCC 4CH3A 4X65O 4YHHB 2EIMB 2JJ1G 4RQEA 2QM7A 3CMEV 4R7CA 4LF5O 1M1KW 2WAMA 3EXAA 1HR0O 1OV9A 4X62B 1HNZB 2ZINA 1AJNA 2IH1C 1EN5A 1PL0A 2QM8A 5LMUB 4DXWA 1K4DC 5IT9N 3CX5F 4QGPA 2KG7B 4LF7O 1W59A 3OGCC 4QE9A 4LF8B 3AG2C 2H94A 1NBMG 1U96A 3TK1A 2DYSC 1MSWD 5LL6Y 4DR2B 4PHZA 2LFSA 3ABLB 1XUQA 1IBMB 4MVQA 1WPXA 4B3TB 3K5LA 1K34A 1EN4A 4PDLA 4ABMA 4DUYO 2WLIB 1XL6A 5EC1C 2ZCEA 3Q4HA 3AEIA 1ZLZA 2E3CA 3SPCA 4D7SA 3L72H 1M5IA 2YIDA 4BWAA 3HKCB 2ILMA 1YEWA 5JQGA 2CUGA 2E76B 1VQKV 5KAFZ 4EKWA 3AG4B 1VF6C 2E5LB 3I5DA 2A3QA 5LA6A 3ZIAG 3ZMUA 4YJ3A 2IJJA 2AZ2A 2XAJA 1MZEA 2QJ1A 4JTAB 4JYAB 3K9AA 2EINB 2F1MA 3KKYA 1XMQO 1V54B 4LFCO 4JV5B 3N2KA 2EZOA 1OCRC 2XUMA 3GWOA 3DTUB 1JNBA 4NR1A 1HWYA 5EYPA 4TV8B 5JVDB 4GT1A 1VQ6V 3VQXA 2WA4A 2VQFO 2RCVA 2CAZC 3OR6C 4H44B 4Z1MG 4X1YB 1LUWA 2KG7A 3ETGA 3CCEV 2JDIG 3L70H 3T4ZA 1FXHA 1GN4A 1I5XA 1JQ0A 3UT5A 1YIJV 1ZWIC 2F95B 2UUBO 3GB7C 2F4VB 1JCHA 3D3IA 5CA1B 1NT2B 1AILA 2P90A 4X1KA 3SYCA 5LP6A 3N2GB 4X89A 4I4TB 4I7ZB 4EFEA 1PP9H 3RVZA 4DRXA 4Z1VA 2BTQB 3X2QB 3JCZA 3M8AA 3B8MA 4NTWA 4U7OA 3HB3B 4DV2O 1FFTB 1WAZA 5ITZA 1FJGB 1NVPD 4GKKB 5DEDA 1SQQH 4J41A 1Q90D 3LDDA 3SYAA 3JSLA 2QWPB 5H6QA 4DV3O 3H9VA 3FX7A 1UJWB 4TUYA 1TAEA 4BW5A 3K5NA 1AB3A 1YITV 1Q8IA 5JH7B 1OCOC 4EB6A 2HR3A 4UFZA 2DOSA 1Z5VA 1NH2D 2DW4A 4K0KO 5LMNO 2WWWA 2ZXWC 3RYHA 3SYPA 4E4EA 4D6TH 4WFAV 3FB5C 2YIBA 2P22C 1YJWV 3L73H 3OTOB 3E8BA 5J2TA 5CBGA 1K5QA 4CH6A 1AP6A 4XBFA 4WFFA 2OCHA 1RSOB 4UCRA 3K06A 4LBEC 1N8RW 5CA0A 2ADPA 3DC6A 2YEVA 1GM9A 1H38A 1DTOA 3DXRA 1ZX3A 4X65B 5FPRA 4G28B 3CS5A 1GK9A 4QPJA 1IBKO 4O2AA 3OM3B 4O4LB 4DW0A 5LOVB 1F51A 1XREA 3U0ZA 1M93A 4JI0O 4YJ2A 1GM7A 3SYQA 4Q20A 2JS3A 2JJ2G 2BOBC 1URFA 3TJTA 4J7JA 3KG2A 4WBNA 2Q5ZA 4KL1A 4DV7B 3E86A 3QVNA 4DV6B 4GYCB 2YDEA 5E79Z 3ZHTA 3H1JH 1YJNV 2IW5A 5DECA 1BQZA 1PNLA 2EIMC 2KSDA 1Q81W 2CH7A 1D5AA 2Y69B 3AK3A 5KX5A 2FL4A 3T2MA 3ZN0A 5B3SB 1CEZA 3ZMTA 4Z2WA 1Q5OA 5IWAO 1VF6A 3BFRA 3LSUA 4WFGA 1NU1H 2IJIA 3IC7A 4OPAA 4FZ1A 4UXNA 3JD3A 5JQGB 5IYDO 3E8FA 2RDCA 2QE7G 2Q67A 4PJ0Z 1FKAO 4YY3O 2AW9A 4LFCB 1ROPA 5FPOA 3OD4A 4ZHQB 2DE0X 2L6LA 2ZD9A 1Q82W 2N74A 2BOCC 1CP9A 4JZ2A 1SQBH 3CCJV 3SPHA 3U11A 2WLJA 1S3JA 3HPLC 2Q6AA 4JI7O 3VQWA 2A06H 1JJ2U 4TOIA 1YXBA 4TQDA 1BHBA 2ZE5A 4JAAA 4GCZA 4BR6A 3LUTB 1L8DA 4FFBA 4I50B 1BE3H 2EILC 3ZJZA 3TGUH 1N33B 1N4CA 1PKXA 4X8AA 1NTKH 1G4YB 5JJJB 3K3WA 3SDLA 4DV2B 2ETNA 4LH6A 1H2NA 4KUMA 4KP4A 4JI6O 2C2AA 4LFAB 2X0LA 4X20B 1W0JG 1HNXB 5KA5A 1D2DA 4ZIBA 3CC2V 2H8PC 4ZKIA 4DRXB 5LGTA 1K33A 1G6UA 5FL7G 1KKCA 1MA1A 4LNUB 4B08A 3ZRSA 4E2LA 2HKOA 5B5EZ 4RO2A 1NI8A 1ZSPA 3T1CA 3ZRWB 1IZ3A 1JFFA 2AHZA 1VF5B 2GUZA 4JI2B 4JI3O 2ZIMA 1N34O 3OUSA 4MVMA 4F6RA 4JGSA 4IIJA 5B1OA 3RYIB 2UXBB 3JALB 1V54C 4EB6B 2EBOA 3SGIA 4I0XA 2CDYA 1RP3B 3OW2U 1NTZH 4R6ZA 3ZHQA 1RM1B 4FFKA 3RWRD 2WLHA 5BMVB 1G1XB 5F2VO 1P7GA 1S5LZ 2YSUB 4ICGA 4K8XA 2EZPA 3RVYA 1Y4MA 5CB4A 3RN4A 1XMOB 2MK3A 1X59A 1K73W 1WNSA 4CC6A 3APOA 5KUMA 2PI4A 2ZKOA 1BSMA 5C8YB 2CTRA 5CN0A 1J5EB 4DUZO 5IY5C 1S76D 3S3XA 2YIAA 1KMIZ 4JI4O 2Z5UA 4P9PA 4R50A 3BCCH 3P30A 2Q73A 3F5WC 3JSNA 2UXCO 4FMTA 2Y48A 2JK5C 3CRRA 3JATB 2F23A 3HKDA 4OX9O 1DF5A 2UUCB 1YSCA 1R73A 3ZHUA 5JVDA 2Q7GA 1H2GA 1SZXA 3G6BA 4JPRA 2PGGA 5KMGA 4O4JB 3QF7A 4MTXA 1KKDA 3ZEDA 1QVFU 3WG7C 4O4IA 3ASNC 3QO8A 1HDJA 3A2FA 5FNVB 3CRCA 4YHHO 1NKDA 5LHIA 3K03A 5GW7A 4LH7A 4LF6B 4BAYA 3N2GA 1HNZO 1TUBA 3BVOA 2XAHA 3R66A 1WLEA 2YS8A 1CXZB 4LF7B 3AG1B 4X1IB 3BEHA 4KHPO 4LFBB 1DLBA 3MHHC 2B1IA 2CTWA 2RQ6A 1EZJA 1PD3A 1SC5B 4DR5O 1M90W 3JASA 1KU9A 2OT5A 2DYRC 1FXKB 1NJIW 1VMGA 2LW7A 2QKSA 3BAAA 3KCXA 4J9ZB 3D36C 4B7EA 1KYOF 3VQYA 3ZMSA 3C90A 2H3OA 4JYYA 4F6RB 1JVMA 2X7RB 3UT5B 1FYJA 3LDEA 2ZE8A 1DF4A 2LO1A 4HBNA 2EINC 4CS4A 3CYOA 3ASOB 1MG1A 2XTAA 5HFMA 4LNUA 4DR7O 3MDSA 2PF4E 1M56B 3FB6C 2ZR2A 3M99B 1R6KA 5KHHA 3VBBA 5J2UB 1R3KC 2W0XA 5EK0A 1AI6A 1UPGA 2VWKA 2VQFB 2FYUH 3A0HZ 5B1BB 4DR6O 1GO3F 1US6A 1FXVA 4CH4A 2Y69C 2WLLB 5L3DA 5ITZB 5A2QN 4H37A 2UUBB 1W2BU 4KFMA 3G71V 3OMAB 4HNAA 1QR8A 1FPOA 2WLKA 2MW2B 4JI5B 2FB5A 4PA3A 3AG7A 4ZBMA 4JAVA 3RYFB 2DYRB 3W7SA 1FAFA 3M7MX 3RBZA 4F6EA 1EFRG 4BW9A 2B1GA 3P32A 4CS2A 2L35A 4O2BA 3DSQA 5L3FA 2IBZH 4IHJA 3HKEA 1XEQA 4X1YA 4RUEA 4DO2A 2EJ7A 3CJHB 5CA3A 2IJKA 2LW1A 1XMOO 1B6QA 1Y74B 3W7TA 2N05A 3LNMB 1JOYA 3K57A 3OMIB 3SPJA 4DR4B 2JIZG 1N36B 1P4RA 5DM6V 3J7AU 2QKCA 3T1HB 3STLC 5LYJA 3ASNB 2O57A 1I94O 4NVPA 4LCUC 2DJVA 4ZOLB 2OYQA 3TXQA 4JF3A 1XI1A 4GZRB 1YHQV 4ZOLA 2JGUA 3MHSC 1IXMA 2QEXV 2ITCC 3OE7G 3SJCC 1RPRA 2ATKC 4W4KA 2NN4A 2IH3C 1R3LC 5L3BA 5D5PA 2XNDG 3PN1A 2VS0A 4DK0A 4JZGA 3I55V 2ZXWB 1H2LA 3ABKC 1H5WA 5KHKA 1WN7A 2R9RB 4NYKA 1Z5WA 4JYBA 5TISZ 4JYAO 4PV1B 4LC1A 4LF4O 5BMVA 3KZIZ 3R65A 1YJ9V 1R6NA 2QWNB 3BY6A 3NR7A 1SQVH 3AG3C 4KXRA 4PDMA 1NVPB 4DYLA 2HHHB 2JGDA 1BMFG 3JAWA 1ZTEA 4LWSB 4NTYA 1QNMA 4I9QA 4AI8A 3B8NA 2F43G 2OCCB 1PPJH 5KA6A 1RM1C 3QO7A 3ZX6A 2K9PA 3D8CA 4DV6O 4AHCA 2P7TC 1DGSA 2P67A 5L3EA 2Q68A 4UV9A 2EIKB 3G4SV 4ZHQA 1PV0A 3JD4A 4J42A 1GH6A 5EIBD 5IDJA 2WPDG 4YIPA 3MD0A 4DR3B 5H5NA 3A8TA 2Z3YA 1B3QA 5KAIZ 3LSSA 2XHBA 5EZYB 3IAYA 5IWAB 1TVKB 2Z0AA 2P06A 5KHJA 2UU9O 2F93B 3D36A 4I5SA 1WPBA 1M57C 2P4VA 2ZE7A 4EFBA 4I50A 4FFBB 5JJEB 1R1BA 2NLJC 3FB7C 3CE2A 1VQPV 1TVKA 4DR7B 3K04A 2QDOA 4YY3B 3AG4C 3HKBA 1XNQB 3LNNA 4X64B 1KBHA 1FD9A 2QSAA 4QNHB 5J9PC 3RW0A 3OAAG 1YI2V 1NZ6A 4FZ0A 3ASOC 3L74H 3CJHA 4DR1O 2ODMA 4U7NA 4B7KA 4JI7B 1THZA 2AZ0A 2EILB 1GN3A 2VQEB 1HP8A 1P84F 1AI7A 1XILA 3FFQA 1MOFA 2OWOA 3E35A 4GX1A 1E1RG 1KECA 2PYLA 1VQLV 1OJHA 5LA6B 1SF9A 3ABLC 5LHHA 4JI5O 4J11A 2WLMA 3OEEG 4X66O 2BCCH 5LXTA 4FK5C 1BGYH 3QG5A 1SZTA 4HNAB 1HW7A 3CRQA 3KDRA 5GTHZ 1OZ0A 1Y76B 2BTOA 4J10A 4QIWF 1AR4A 4ZI7A 1IBLB 2Y4TA 4FLXA 3H01A 3THOA 4L8JA 2RN9A 5L3CA 1FOUA 1QR9A 2ARHA 4PA6A 3HKBB 3HKEB 4FLVA 4PDVA 1XNRO 2RJZA 5BR8B 4B3RB 4G27B 4DV7O 1H2MA 4YJ3B 4NB5A 1N36O 3ZMZA 2ZT9B 1Y76A 3F7VC 1IXBA 4NXMO 1Z2GA 2X6BA 1VQ8V 2QWOB 4NTXA 5KUKA 2UXBO 3WG7B 4HZ3A 3E2EA 2OTLV 5IJ9A 5LMUO 4B3SB 4H0LB 4BIUA 3I56V 1AVMA 4O4HA 3ETQA 3O65A 4RAIA 1JJOA 3TXSA 4LR3A 1YZBA 3WU2Z 1FFXB 2HVJC 1QLEB 3JAKA 1XL4A 2M6YA 2RNBA 3OTFA 4B3MO 4CC5A 4UUJC 2D3OW 1E79G 4DUZB 2LJ2A 4JI8B 4B3TO 1B04A 1K9MW 5EBLC 3UM7A 2E74B 3W7UA 1B06A 2HHHO 1K97A 1SA0A 2F66C 2YXLA 5LP6B 3H1IH 1OCZB 4DUYB 3BHPA 4TWKA 2HG5C 1SQGA 2V7QG 1KP3A 3AK1A 4O4HB 4UCTA 3SPIA 4LF9O 4TV9A 4FJCC 4XDLA 1SA0B 2ZQMA 5IE9A 5EC2C 1VQOV 1Q7YW 2CK3G 2PZSA 5CBFA 3F7YC 2IJHA 2ADQB 3ETEA 2WLLA 1H8HG 4JV5O 4G2KA 2EIJB 4GLXA 2RMKB 3CRAA 1XMQB 1ENVA 4FLTA 5IYZA 1YTFB 1WA8B 2LGQA 4JI6B 2ZDIC 1FFXA 3CSXA 1K7DA 3K08A 4DV4B 3CCLV 4LF6O 1D5NA 3E22B 3B40A 3FAVB 4H33A 1FXKC 1L0LH 3CCRV 2CGNA 1IJGA 4X1KB 1MNGA 2EIKC 2DWDC 5HFLA 2BSKA 1COWG 3ZRXA 3ABMC 1N0NA 1SQFA 4O4IB 2JEUA 3CHXA 2JRIA 2XAGA 2YICA 1XNQO 4Q6GA 2QKAA 4MVSA 3QNEA 4UB6Z 1Q6IA 4GKKO 1LNQA 3H1LH 2IU0A 2DQ0A 2YI8A 4DR1B 1SS3A 4OXSA 3ABMB 2P6JA 1E1QG 3B77A 3OUFA 1VIBA 2ITDC 1KC8W 4O4JA 3H1KH 3RT3C 4GKJB 2X6CA 4MVOA 4FLUA 4DV3B 5BZBA 1MSDA 3IFXA 3ZMVA 4IIJB 3RYIA 5LMNB 1S77D 3UO2A 4D7TA 4MTGA 3KCYA 4PA7A 5C8YA 1N32O 3ABTA 1J5EO 2IU3A 4BIOA 4ASUG 1DK1A 4MS2A 3GVMA 3K5OA 2A7WA 2B9ZA 2Q69A 3P3PA 4LWSA 4FM1A 3OEHG 4JTDB 2UXCB 1GN6A 2K1EA 2EJRA 2PTMA 4U3FH 3CRMA 4R8CA 1WP7A 1GAXA 2WSSG 4X88A 5BXZA 1XBLA 2OIEA 2YXHA 5IYCO 1I08A 3W7WA 4X9QA 2FMLA 1SESA 3J81N 1KP2A 1UFIA 2YXYA 3L71H 2UXXA 2XAFA 1AP5A 5J2UA 4U3JA 3S3WA 2Q8VA 4I55A 4UCOA 2QM4A 5EBWC 4B3SO 4CBCA 5B1AB 4W4LA 1SQPH 2BE3A 2HFEC 1ZL8B 3B2EE 3TCUA 4NXNO 2DYSB 4JI0B 2YC0A 5GTIZ 3RGBA 5LYJB 5IYZB 2UXNA 3JASB 3J80N 3JCUZ 1GM8A 4FM2A 1F4NA 1QCEA 1Q3EA 2DMXA 3OMNB 1AJPA 3ZHRA 4PDRA 4UVCA 3EFFK 3D3QA 4IYIA 1JR9A 1IVSA 1SETA 3K0DA 4J9YB 1RFYA 4MT8A 3QO5A 4A5UB 1EZVH 1OCCB 2DN9A 4DV5O 2AHYA 2GV9A 4I0XB 2QA4V 4X20A 5B1BC 4X62O 2A79B 1K5SA 4C7UA 4RUFA 4XDKA 3FYIB 1KQSU 3ICXA 3OR7C 2JEXA 4MTFA 2GSMB 4N21A 3SYOA 1PNKA 4LF8O 1VF7A 1WB7A 3DXRB 3RYCA 1TUBB 1Q6HA 4DR2O 3SJAC 2KB1A 2P5OA 2XT9A 5KLVH 1SQXH 4QPKA 3N2KB 4H13B 2ZNJA 5E1AC 5LBQA 1XDCA 5J2TB 2Q7EA 4DR6B 1GMGA 3NXSA 1XQ8A 4K3AA 2R70A 3T1YO 1SKVA 3IGAC 4UCUA 1MZFA 3L75H 1R3JC 2CE4A 1PL4A 2AXTZ 1QLNA 2JVDA 1N33O 1NTMH 2NNUA 2HJDA 1QHTA 1V55B 4PD4F 1YVWA 1ZUQA 2ZR3A 3FKSG 4YIOA 5FNVA 4K35A 1SERA 1K92A 1M9NA 3CWBH 4IT5A
chains in the Genus database with same CATH topology
4GUNA 4JZGA 3CEIA 1EN6A 5AG2A 1GN2A 1SZXA 1VARA 3EVKA 3QVNA 1JR9A 1JA8A 1XUQA 1GN3A 1XILA 1EN4A 1KKCA 1MA1A 1MSDA 3AK3A 1B06A 1I0HA 1EM1A 1ZSPA 4C7UA 3DC5A 3AK2A 1IX9A 1ZLZA 3AK1A 1ZTEA 3BFRA 3LSUA 2P4KA 1MMMA 1IDSA 1QNMA 4E4EA 4F6EA 3KDRA 3C3TA 1N0JA 1WB7A 1AR4A 2CDYA 5A9GA 2ADQB 1GN6A 1AP6A 1VEWA 4FFKA 2AW9A 3IC9A 3KKYA 1P7GA 3K9SA 2ADPA 1Y67A 3OT7A 3RN4A 1I08A 4JZ2A 3DC6A 4X9QA 2RCVA 4YIPA 1D5NA 1XDCA 1PM9A 1WB8A 1LUWA 2GDSA 1BSMA 1AP5A 4JYYA 1GN4A 1IXBA 2QKCA 1BS3A 1MNGA 4BR6A 2CE4A 1PL4A 1BT8A 3C3SA 1XREA 1LUVA 1N0NA 1EN5A 1AVMA 1ZUQA 3MDSA 4YIOA 2QKAA 1AR5A 3TJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GUN A;  4JZG A;  3CEI A;  1EN6 A;  5AG2 A;  1GN2 A;  1SZX A;  1VAR A;  3EVK A;  3QVN A;  1JR9 A;  1JA8 A;  1XUQ A;  1GN3 A;  1XIL A;  1EN4 A;  1KKC A;  1MA1 A;  1MSD A;  3AK3 A;  1B06 A;  1I0H A;  1EM1 A;  1ZSP A;  4C7U A;  3DC5 A;  3AK2 A;  1IX9 A;  1ZLZ A;  3AK1 A;  1ZTE A;  3BFR A;  3LSU A;  2P4K A;  1MMM A;  1IDS A;  1QNM A;  4E4E A;  4F6E A;  3C3T A;  1N0J A;  1WB7 A;  1AR4 A;  2CDY A;  5A9G A;  2ADQ B;  1GN6 A;  1AP6 A;  1VEW A;  4FFK A;  2AW9 A;  3IC9 A;  3KKY A;  1P7G A;  3K9S A;  2ADP A;  1Y67 A;  3OT7 A;  3RN4 A;  1I08 A;  4JZ2 A;  3DC6 A;  4X9Q A;  2RCV A;  4YIP A;  1D5N A;  1XDC A;  1PM9 A;  1WB8 A;  1LUW A;  2GDS A;  1BSM A;  1AP5 A;  4JYY A;  1GN4 A;  1IXB A;  2QKC A;  1BS3 A;  1MNG A;  4BR6 A;  2CE4 A;  1PL4 A;  1BT8 A;  3C3S A;  1XRE A;  1LUV A;  1N0N A;  1EN5 A;  1AVM A;  1ZUQ A;  3MDS A;  4YIO A;  2QKA A;  1AR5 A;  3TJT A; 
#chains in the Genus database with same CATH topology
 3ZCC A;  2Q0A A;  2EX3 A;  4MVR A;  1EN6 A;  1GN2 A;  1Y66 A;  2WLN A;  4P9O A;  1HNX O;  4L87 A;  2QWR B;  4AQY B;  2LFR A;  3FB8 C;  4MW8 A;  1NR1 A;  2GBO A;  4TQF A;  3DGE A;  2DWE C;  1Y6X A;  4O4L A;  2HVK C;  3CB2 A;  4O2B B;  1V9P A;  1XHZ A;  1P49 A;  4UV8 A;  4CZZ A;  3DC5 A;  3OFN G;  3P3N A;  3WB2 A;  2Y0P A;  5KHI A;  3HR0 A;  4DV0 B;  3UCS C;  3E83 A;  4PI2 A;  4OPH A;  2XAQ A;  1I94 B;  1A32 A;  5KX5 B;  4LF5 B;  2EIJ C;  2BSK B;  1HR0 B;  1Y74 A;  3WB0 A;  3SPG A;  1FJG O;  3H1H H;  5A9G A;  3G6E V;  4J80 A;  2GHY A;  1CPY A;  5EBM C;  3UKM A;  4WCE V;  3IC9 A;  1JPX A;  4QE7 A;  1K8A W;  2VRZ A;  3ABU A;  2HJF C;  2VQE O;  5IY5 B;  5K1P A;  1Y67 A;  2PY5 A;  4UCV A;  2D2C B;  1AJQ A;  1JMK C;  2UUA B;  2QGN A;  2QWQ B;  4NKG B;  3PJS K;  5GON A;  3CC4 V;  3RYC B;  1RSO A;  4J7Z A;  3CPW U;  3AG3 B;  5IJ0 B;  4U3J B;  4I9W A;  4GX0 A;  5EZY A;  2V4D A;  5JH7 A;  3CCM V;  3JAM N;  2XAS A;  2PUS A;  2GTS A;  4FM0 A;  3UO3 A;  5EIB C;  3CCQ V;  4YXW G;  3K59 A;  2CTP A;  4PEL A;  1J95 A;  3HKD B;  5AG2 A;  1S5H C;  3SJQ C;  1H8E G;  1BZK A;  3ML0 A;  4DK1 A;  1OCO B;  4DV5 B;  3E8G A;  3WFV A;  1Q6U A;  1F7Y A;  2LP7 A;  1IBK B;  3B09 A;  1NQT A;  4MVU A;  2KKW A;  3E8H A;  1NS1 A;  4WF9 V;  3K5M A;  5JCO C;  5K1X A;  1HNW O;  2P4K A;  1IDS A;  5IJ0 A;  2FTK A;  2X6A A;  1K3E A;  1QBZ A;  3BA9 A;  4TT3 G;  3X2Q C;  2HEP A;  5CB4 B;  3BPZ A;  5EYP B;  1V55 C;  5GON B;  4K8Z A;  1VQ7 V;  1L0N H;  4KHP B;  3ZRW A;  3E22 A;  3FAV A;  4WFB V;  3EHB B;  2XOK G;  5KMG B;  4JI1 B;  3JYC A;  4JAU A;  4X64 O;  4FLY A;  3K9S A;  1WA8 A;  4DR5 B;  3CD6 V;  3BRC A;  4JI8 O;  1FXK A;  1YDX A;  2A9H A;  3OT7 A;  1SRY A;  3FYE B;  4DW1 A;  4FIP C;  4YJ2 B;  3CP1 A;  3JD0 A;  4MSW C;  3B4S A;  2LGW A;  5L3G A;  4IGG A;  3K58 A;  2GUZ B;  3T1Y B;  1R6T A;  4I4T A;  2GDS A;  3GWK C;  4F4L A;  2EUL A;  4LF9 B;  2R9I A;  2QTS A;  3U10 A;  1BT8 A;  4JTC B;  5CA1 A;  3JD1 A;  5BY1 A;  3CCU V;  1LUV A;  4MTO A;  4K0K B;  3F5T A;  3UQ8 A;  1QU7 A;  3MAQ A;  1QQC A;  1FS0 G;  3ETD A;  1S5J A;  3CEI A;  1VQN V;  1R3I C;  1IBL O;  5B3S C;  5LP6 C;  5CMU A;  2LQT A;  4AQY O;  1JA8 A;  1NR7 A;  2Y4U A;  1BCC H;  1JX9 A;  4HYO A;  2UXD O;  1VQ9 V;  1M57 B;  5B1N A;  5D5Q A;  2Q7H A;  3JAR A;  2ZDI A;  3ZHS A;  2WA3 A;  2VWJ A;  1BHA A;  1OHH G;  2NR5 A;  3JAL A;  4BIZ A;  4N23 A;  3N27 A;  1IX9 A;  2YIB D;  3K0G A;  1K4C C;  1JFF B;  3AG2 B;  3IJ4 A;  3QTC A;  4TUY B;  4NXM B;  3CXH F;  2OIG A;  5IYB O;  4P2Z A;  4IYH A;  4DV1 B;  4LFA O;  2ZIO A;  2QR4 A;  3APQ A;  5B1A C;  1YCI A;  4JYC A;  2IM9 A;  3CCS V;  2CH7 B;  3BAB A;  3FD9 A;  2ZM6 B;  2UUA O;  1Q43 A;  3ZN1 A;  2B5U A;  2N04 A;  2V1D A;  1PM9 A;  2ZNI A;  5IJ9 B;  4DR4 O;  4B3M B;  3JAW B;  4WFE A;  1N32 B;  4JI3 B;  3O9O A;  4MW3 A;  4MVZ A;  4X1I A;  5LGU A;  1EBO A;  3STZ C;  4J7K A;  2YUA A;  2Q0O C;  1GKF A;  2G38 A;  3T1H O;  3C3S A;  4XDJ A;  2A0L A;  3CCV V;  4FPP A;  2ZE6 A;  1PNM A;  1AR5 A;  1T5E A;  3CXC U;  4GX2 A;  3SR2 C;  2QTO A;  1H2S B;  4GUN A;  4WBN B;  1TUE B;  1U97 A;  4LF4 B;  1VAR A;  4QJF B;  2W0F C;  3EVK A;  1VQ4 V;  4ZI7 B;  4PA4 A;  1KB9 F;  5LGN A;  1WJZ A;  1VP7 A;  1IBM O;  4TSF G;  1GRJ A;  4IHJ B;  4DV4 O;  1ZAU A;  1EM1 A;  2W6J G;  5H2F Z;  4AIL C;  1HNW B;  4NXN B;  3TET A;  1NH2 B;  1MMM A;  4I55 B;  2CGO A;  3L9D A;  2YEV B;  3C3T A;  1H2K A;  3CC7 V;  3VQV A;  1O9H A;  5JWP A;  4PA9 A;  1MAB G;  3Q4H B;  1S0V A;  2E5L O;  1VEW A;  3SJB C;  2Q4P A;  4JI1 O;  3RFR A;  3E89 A;  3VOU A;  1Q86 W;  3ZRV A;  1AI5 A;  4UVB A;  3JAR B;  5KHG A;  4WFH A;  2Y0I A;  4DR3 O;  2HP8 A;  2OTJ V;  1WP8 A;  1S72 V;  5CA0 B;  1AI4 A;  2W6I G;  1YTF D;  1AR1 B;  3RYF A;  1WB8 A;  2UU9 B;  1VQM V;  4OGQ B;  4GX5 A;  4GKJ O;  3JAT A;  1OCR B;  1G8M A;  1BS3 A;  2DQ3 A;  3HKC A;  3LDC A;  3A0B Z;  1TGO A;  2F4V O;  3LSQ A;  5LXT B;  4RQF A;  2WLI A;  4LFB O;  2OCC C;  2JGD B;  5FLX N;  4JI2 O;  4PI0 A;  3K79 A;  1N34 B;  2HLD G;  4HAM A;  1ARO P;  1IUR A;  2PYJ A;  4CH5 A;  1P7B A;  1BQ0 A;  1M56 C;  5H6R A;  1I5Y A;  1X4T A;  4IL6 Z;  5H9C A;  2YI9 A;  1OCZ C;  4UB8 Z;  1LR1 A;  3CMA V;  1KD1 W;  1VQ5 V;  3OGI B;  3W7X A;  1W0K G;  2UXD B;  4RWU A;  1O9G A;  2R72 A;  1QVG U;  5CBH A;  4FLW A;  1L1F A;  5C93 A;  5DN6 G;  2KQX A;  2Q9L A;  2FKX A;  5JCO A;  5LHG A;  4O2A B;  4X66 B;  3ZBH A;  1I7F A;  1I0H A;  3G67 A;  3WB1 A;  1ZL8 A;  3AK2 A;  1QLE C;  3ABK B;  1YF2 A;  3RYH B;  4JAS A;  4FVM A;  4FLZ A;  4UVA A;  3ZHV A;  4DV1 O;  5B66 Z;  5LOV A;  1N0J A;  3A0R A;  4TV8 A;  4JI4 B;  1RPO A;  1KUQ A;  2M7W A;  4CS3 A;  4EEQ A;  3OTO O;  3ZS8 C;  2ZM6 O;  2AGA A;  4P30 A;  4UCS A;  1F23 A;  1TA8 A;  1F4M A;  1M4U A;  3AG1 C;  3JAK B;  4OX9 B;  4B3R O;  2UUC O;  3T4D A;  1XHX A;  2R9A A;  3BA8 A;  2PI5 A;  1BL8 A;  1GTO A;  2GTA A;  2CTQ A;  1XNR B;  5JJN B;  5BR8 O;  1ORQ C;  1XOU A;  2E75 B;  2JS5 A;  4LP8 A;  2BTQ A;  4DV0 O;  3JD2 A;  4TV9 B;  3G80 A;  1OCC C;  4CH3 A;  4X65 O;  4YHH B;  2EIM B;  2JJ1 G;  4RQE A;  2QM7 A;  3CME V;  4R7C A;  4LF5 O;  1M1K W;  2WAM A;  3EXA A;  1HR0 O;  1OV9 A;  4X62 B;  1HNZ B;  2ZIN A;  1AJN A;  2IH1 C;  1EN5 A;  1PL0 A;  2QM8 A;  5LMU B;  4DXW A;  1K4D C;  5IT9 N;  3CX5 F;  4QGP A;  2KG7 B;  4LF7 O;  1W59 A;  3OGC C;  4QE9 A;  4LF8 B;  3AG2 C;  2H94 A;  1NBM G;  1U96 A;  3TK1 A;  2DYS C;  1MSW D;  5LL6 Y;  4DR2 B;  4PHZ A;  2LFS A;  3ABL B;  1XUQ A;  1IBM B;  4MVQ A;  1WPX A;  4B3T B;  3K5L A;  1K34 A;  1EN4 A;  4PDL A;  4ABM A;  4DUY O;  2WLI B;  1XL6 A;  5EC1 C;  2ZCE A;  3Q4H A;  3AEI A;  1ZLZ A;  2E3C A;  3SPC A;  4D7S A;  3L72 H;  1M5I A;  2YID A;  4BWA A;  3HKC B;  2ILM A;  1YEW A;  5JQG A;  2CUG A;  2E76 B;  1VQK V;  5KAF Z;  4EKW A;  3AG4 B;  1VF6 C;  2E5L B;  3I5D A;  2A3Q A;  5LA6 A;  3ZIA G;  3ZMU A;  4YJ3 A;  2IJJ A;  2AZ2 A;  2XAJ A;  1MZE A;  2QJ1 A;  4JTA B;  4JYA B;  3K9A A;  2EIN B;  2F1M A;  3KKY A;  1XMQ O;  1V54 B;  4LFC O;  4JV5 B;  3N2K A;  2EZO A;  1OCR C;  2XUM A;  3GWO A;  3DTU B;  1JNB A;  4NR1 A;  1HWY A;  5EYP A;  4TV8 B;  5JVD B;  4GT1 A;  1VQ6 V;  3VQX A;  2WA4 A;  2VQF O;  2RCV A;  2CAZ C;  3OR6 C;  4H44 B;  4Z1M G;  4X1Y B;  1LUW A;  2KG7 A;  3ETG A;  3CCE V;  2JDI G;  3L70 H;  3T4Z A;  1FXH A;  1GN4 A;  1I5X A;  1JQ0 A;  3UT5 A;  1YIJ V;  1ZWI C;  2F95 B;  2UUB O;  3GB7 C;  2F4V B;  1JCH A;  3D3I A;  5CA1 B;  1NT2 B;  1AIL A;  2P90 A;  4X1K A;  3SYC A;  5LP6 A;  3N2G B;  4X89 A;  4I4T B;  4I7Z B;  4EFE A;  1PP9 H;  3RVZ A;  4DRX A;  4Z1V A;  2BTQ B;  3X2Q B;  3JCZ A;  3M8A A;  3B8M A;  4NTW A;  4U7O A;  3HB3 B;  4DV2 O;  1FFT B;  1WAZ A;  5ITZ A;  1FJG B;  1NVP D;  4GKK B;  5DED A;  1SQQ H;  4J41 A;  1Q90 D;  3LDD A;  3SYA A;  3JSL A;  2QWP B;  5H6Q A;  4DV3 O;  3H9V A;  3FX7 A;  1UJW B;  4TUY A;  1TAE A;  4BW5 A;  3K5N A;  1AB3 A;  1YIT V;  1Q8I A;  5JH7 B;  1OCO C;  4EB6 A;  2HR3 A;  4UFZ A;  2DOS A;  1Z5V A;  1NH2 D;  2DW4 A;  4K0K O;  5LMN O;  2WWW A;  2ZXW C;  3RYH A;  3SYP A;  4E4E A;  4D6T H;  4WFA V;  3FB5 C;  2YIB A;  2P22 C;  1YJW V;  3L73 H;  3OTO B;  3E8B A;  5J2T A;  5CBG A;  1K5Q A;  4CH6 A;  1AP6 A;  4XBF A;  4WFF A;  2OCH A;  1RSO B;  4UCR A;  3K06 A;  4LBE C;  1N8R W;  5CA0 A;  2ADP A;  3DC6 A;  2YEV A;  1GM9 A;  1H38 A;  1DTO A;  3DXR A;  1ZX3 A;  4X65 B;  5FPR A;  4G28 B;  3CS5 A;  1GK9 A;  4QPJ A;  1IBK O;  4O2A A;  3OM3 B;  4O4L B;  4DW0 A;  5LOV B;  1F51 A;  1XRE A;  3U0Z A;  1M93 A;  4JI0 O;  4YJ2 A;  1GM7 A;  3SYQ A;  4Q20 A;  2JS3 A;  2JJ2 G;  2BOB C;  1URF A;  3TJT A;  4J7J A;  3KG2 A;  4WBN A;  2Q5Z A;  4KL1 A;  4DV7 B;  3E86 A;  3QVN A;  4DV6 B;  4GYC B;  2YDE A;  5E79 Z;  3ZHT A;  3H1J H;  1YJN V;  2IW5 A;  5DEC A;  1BQZ A;  1PNL A;  2EIM C;  2KSD A;  1Q81 W;  2CH7 A;  1D5A A;  2Y69 B;  3AK3 A;  5KX5 A;  2FL4 A;  3T2M A;  3ZN0 A;  5B3S B;  1CEZ A;  3ZMT A;  4Z2W A;  1Q5O A;  5IWA O;  1VF6 A;  3BFR A;  3LSU A;  4WFG A;  1NU1 H;  2IJI A;  3IC7 A;  4OPA A;  4FZ1 A;  4UXN A;  3JD3 A;  5JQG B;  5IYD O;  3E8F A;  2RDC A;  2QE7 G;  2Q67 A;  4PJ0 Z;  1FKA O;  4YY3 O;  2AW9 A;  4LFC B;  1ROP A;  5FPO A;  3OD4 A;  4ZHQ B;  2DE0 X;  2L6L A;  2ZD9 A;  1Q82 W;  2N74 A;  2BOC C;  1CP9 A;  4JZ2 A;  1SQB H;  3CCJ V;  3SPH A;  3U11 A;  2WLJ A;  1S3J A;  3HPL C;  2Q6A A;  4JI7 O;  3VQW A;  2A06 H;  1JJ2 U;  4TOI A;  1YXB A;  4TQD A;  1BHB A;  2ZE5 A;  4JAA A;  4GCZ A;  4BR6 A;  3LUT B;  1L8D A;  4FFB A;  4I50 B;  1BE3 H;  2EIL C;  3ZJZ A;  3TGU H;  1N33 B;  1N4C A;  1PKX A;  4X8A A;  1NTK H;  1G4Y B;  5JJJ B;  3K3W A;  3SDL A;  4DV2 B;  2ETN A;  4LH6 A;  1H2N A;  4KUM A;  4KP4 A;  4JI6 O;  2C2A A;  4LFA B;  2X0L A;  4X20 B;  1W0J G;  1HNX B;  5KA5 A;  1D2D A;  4ZIB A;  3CC2 V;  2H8P C;  4ZKI A;  4DRX B;  5LGT A;  1K33 A;  1G6U A;  5FL7 G;  1KKC A;  1MA1 A;  4LNU B;  4B08 A;  3ZRS A;  4E2L A;  2HKO A;  5B5E Z;  4RO2 A;  1NI8 A;  1ZSP A;  3T1C A;  3ZRW B;  1IZ3 A;  1JFF A;  2AHZ A;  1VF5 B;  2GUZ A;  4JI2 B;  4JI3 O;  2ZIM A;  1N34 O;  3OUS A;  4MVM A;  4F6R A;  4JGS A;  4IIJ A;  5B1O A;  3RYI B;  2UXB B;  3JAL B;  1V54 C;  4EB6 B;  2EBO A;  3SGI A;  4I0X A;  2CDY A;  1RP3 B;  3OW2 U;  1NTZ H;  4R6Z A;  3ZHQ A;  1RM1 B;  4FFK A;  3RWR D;  2WLH A;  5BMV B;  1G1X B;  5F2V O;  1P7G A;  1S5L Z;  2YSU B;  4ICG A;  4K8X A;  2EZP A;  3RVY A;  1Y4M A;  5CB4 A;  3RN4 A;  1XMO B;  2MK3 A;  1X59 A;  1K73 W;  1WNS A;  4CC6 A;  3APO A;  5KUM A;  2PI4 A;  2ZKO A;  1BSM A;  5C8Y B;  2CTR A;  5CN0 A;  1J5E B;  4DUZ O;  5IY5 C;  1S76 D;  3S3X A;  2YIA A;  1KMI Z;  4JI4 O;  2Z5U A;  4P9P A;  4R50 A;  3BCC H;  3P30 A;  2Q73 A;  3F5W C;  3JSN A;  2UXC O;  4FMT A;  2Y48 A;  2JK5 C;  3CRR A;  3JAT B;  2F23 A;  3HKD A;  4OX9 O;  1DF5 A;  2UUC B;  1YSC A;  1R73 A;  3ZHU A;  5JVD A;  2Q7G A;  1H2G A;  1SZX A;  3G6B A;  4JPR A;  2PGG A;  5KMG A;  4O4J B;  3QF7 A;  4MTX A;  1KKD A;  3ZED A;  1QVF U;  3WG7 C;  4O4I A;  3ASN C;  3QO8 A;  1HDJ A;  3A2F A;  5FNV B;  3CRC A;  4YHH O;  1NKD A;  5LHI A;  3K03 A;  5GW7 A;  4LH7 A;  4LF6 B;  4BAY A;  3N2G A;  1HNZ O;  1TUB A;  3BVO A;  2XAH A;  3R66 A;  1WLE A;  2YS8 A;  1CXZ B;  4LF7 B;  3AG1 B;  4X1I B;  3BEH A;  4KHP O;  4LFB B;  1DLB A;  3MHH C;  2B1I A;  2CTW A;  2RQ6 A;  1EZJ A;  1PD3 A;  1SC5 B;  4DR5 O;  1M90 W;  3JAS A;  1KU9 A;  2OT5 A;  2DYR C;  1FXK B;  1NJI W;  1VMG A;  2LW7 A;  2QKS A;  3BAA A;  3KCX A;  4J9Z B;  3D36 C;  4B7E A;  1KYO F;  3VQY A;  3ZMS A;  3C90 A;  2H3O A;  4JYY A;  4F6R B;  1JVM A;  2X7R B;  3UT5 B;  1FYJ A;  3LDE A;  2ZE8 A;  1DF4 A;  2LO1 A;  4HBN A;  2EIN C;  4CS4 A;  3CYO A;  3ASO B;  1MG1 A;  2XTA A;  5HFM A;  4LNU A;  4DR7 O;  3MDS A;  2PF4 E;  1M56 B;  3FB6 C;  2ZR2 A;  3M99 B;  1R6K A;  5KHH A;  3VBB A;  5J2U B;  1R3K C;  2W0X A;  5EK0 A;  1AI6 A;  1UPG A;  2VWK A;  2VQF B;  2FYU H;  3A0H Z;  5B1B B;  4DR6 O;  1GO3 F;  1US6 A;  1FXV A;  4CH4 A;  2Y69 C;  2WLL B;  5L3D A;  5ITZ B;  5A2Q N;  4H37 A;  2UUB B;  1W2B U;  4KFM A;  3G71 V;  3OMA B;  4HNA A;  1QR8 A;  1FPO A;  2WLK A;  2MW2 B;  4JI5 B;  2FB5 A;  4PA3 A;  3AG7 A;  4ZBM A;  4JAV A;  3RYF B;  2DYR B;  3W7S A;  1FAF A;  3M7M X;  3RBZ A;  4F6E A;  1EFR G;  4BW9 A;  2B1G A;  3P32 A;  4CS2 A;  2L35 A;  4O2B A;  3DSQ A;  5L3F A;  2IBZ H;  4IHJ A;  3HKE A;  1XEQ A;  4X1Y A;  4RUE A;  4DO2 A;  2EJ7 A;  3CJH B;  5CA3 A;  2IJK A;  2LW1 A;  1XMO O;  1B6Q A;  1Y74 B;  3W7T A;  2N05 A;  3LNM B;  1JOY A;  3K57 A;  3OMI B;  3SPJ A;  4DR4 B;  2JIZ G;  1N36 B;  1P4R A;  5DM6 V;  3J7A U;  2QKC A;  3T1H B;  3STL C;  5LYJ A;  3ASN B;  2O57 A;  1I94 O;  4NVP A;  4LCU C;  2DJV A;  4ZOL B;  2OYQ A;  3TXQ A;  4JF3 A;  1XI1 A;  4GZR B;  1YHQ V;  4ZOL A;  2JGU A;  3MHS C;  1IXM A;  2QEX V;  2ITC C;  3OE7 G;  3SJC C;  1RPR A;  2ATK C;  4W4K A;  2NN4 A;  2IH3 C;  1R3L C;  5L3B A;  5D5P A;  2XND G;  3PN1 A;  2VS0 A;  4DK0 A;  4JZG A;  3I55 V;  2ZXW B;  1H2L A;  3ABK C;  1H5W A;  5KHK A;  1WN7 A;  2R9R B;  4NYK A;  1Z5W A;  4JYB A;  5TIS Z;  4JYA O;  4PV1 B;  4LC1 A;  4LF4 O;  5BMV A;  3KZI Z;  3R65 A;  1YJ9 V;  1R6N A;  2QWN B;  3BY6 A;  3NR7 A;  1SQV H;  3AG3 C;  4KXR A;  4PDM A;  1NVP B;  4DYL A;  2HHH B;  2JGD A;  1BMF G;  3JAW A;  1ZTE A;  4LWS B;  4NTY A;  1QNM A;  4I9Q A;  4AI8 A;  3B8N A;  2F43 G;  2OCC B;  1PPJ H;  5KA6 A;  1RM1 C;  3QO7 A;  3ZX6 A;  2K9P A;  3D8C A;  4DV6 O;  4AHC A;  2P7T C;  1DGS A;  2P67 A;  5L3E A;  2Q68 A;  4UV9 A;  2EIK B;  3G4S V;  4ZHQ A;  1PV0 A;  3JD4 A;  4J42 A;  1GH6 A;  5EIB D;  5IDJ A;  2WPD G;  4YIP A;  3MD0 A;  4DR3 B;  5H5N A;  3A8T A;  2Z3Y A;  1B3Q A;  5KAI Z;  3LSS A;  2XHB A;  5EZY B;  3IAY A;  5IWA B;  1TVK B;  2Z0A A;  2P06 A;  5KHJ A;  2UU9 O;  2F93 B;  3D36 A;  4I5S A;  1WPB A;  1M57 C;  2P4V A;  2ZE7 A;  4EFB A;  4I50 A;  4FFB B;  5JJE B;  1R1B A;  2NLJ C;  3FB7 C;  3CE2 A;  1VQP V;  1TVK A;  4DR7 B;  3K04 A;  2QDO A;  4YY3 B;  3AG4 C;  3HKB A;  1XNQ B;  3LNN A;  4X64 B;  1KBH A;  1FD9 A;  2QSA A;  4QNH B;  5J9P C;  3RW0 A;  3OAA G;  1YI2 V;  1NZ6 A;  4FZ0 A;  3ASO C;  3L74 H;  3CJH A;  4DR1 O;  2ODM A;  4U7N A;  4B7K A;  4JI7 B;  1THZ A;  2AZ0 A;  2EIL B;  1GN3 A;  2VQE B;  1HP8 A;  1P84 F;  1AI7 A;  1XIL A;  3FFQ A;  1MOF A;  2OWO A;  3E35 A;  4GX1 A;  1E1R G;  1KEC A;  2PYL A;  1VQL V;  1OJH A;  5LA6 B;  1SF9 A;  3ABL C;  5LHH A;  4JI5 O;  4J11 A;  2WLM A;  3OEE G;  4X66 O;  2BCC H;  5LXT A;  4FK5 C;  1BGY H;  3QG5 A;  1SZT A;  4HNA B;  1HW7 A;  3CRQ A;  3KDR A;  5GTH Z;  1OZ0 A;  1Y76 B;  2BTO A;  4J10 A;  4QIW F;  1AR4 A;  4ZI7 A;  1IBL B;  2Y4T A;  4FLX A;  3H01 A;  3THO A;  4L8J A;  2RN9 A;  5L3C A;  1FOU A;  1QR9 A;  2ARH A;  4PA6 A;  3HKB B;  3HKE B;  4FLV A;  4PDV A;  1XNR O;  2RJZ A;  5BR8 B;  4B3R B;  4G27 B;  4DV7 O;  1H2M A;  4YJ3 B;  4NB5 A;  1N36 O;  3ZMZ A;  2ZT9 B;  1Y76 A;  3F7V C;  1IXB A;  4NXM O;  1Z2G A;  2X6B A;  1VQ8 V;  2QWO B;  4NTX A;  5KUK A;  2UXB O;  3WG7 B;  4HZ3 A;  3E2E A;  2OTL V;  5IJ9 A;  5LMU O;  4B3S B;  4H0L B;  4BIU A;  3I56 V;  1AVM A;  4O4H A;  3ETQ A;  3O65 A;  4RAI A;  1JJO A;  3TXS A;  4LR3 A;  1YZB A;  3WU2 Z;  1FFX B;  2HVJ C;  1QLE B;  3JAK A;  1XL4 A;  2M6Y A;  2RNB A;  3OTF A;  4B3M O;  4CC5 A;  4UUJ C;  2D3O W;  1E79 G;  4DUZ B;  2LJ2 A;  4JI8 B;  4B3T O;  1B04 A;  1K9M W;  5EBL C;  3UM7 A;  2E74 B;  3W7U A;  1B06 A;  2HHH O;  1K97 A;  1SA0 A;  2F66 C;  2YXL A;  5LP6 B;  3H1I H;  1OCZ B;  4DUY B;  3BHP A;  4TWK A;  2HG5 C;  1SQG A;  2V7Q G;  1KP3 A;  3AK1 A;  4O4H B;  4UCT A;  3SPI A;  4LF9 O;  4TV9 A;  4FJC C;  4XDL A;  1SA0 B;  2ZQM A;  5IE9 A;  5EC2 C;  1VQO V;  1Q7Y W;  2CK3 G;  2PZS A;  5CBF A;  3F7Y C;  2IJH A;  2ADQ B;  3ETE A;  2WLL A;  1H8H G;  4JV5 O;  4G2K A;  2EIJ B;  4GLX A;  2RMK B;  3CRA A;  1XMQ B;  1ENV A;  4FLT A;  5IYZ A;  1YTF B;  1WA8 B;  2LGQ A;  4JI6 B;  2ZDI C;  1FFX A;  3CSX A;  1K7D A;  3K08 A;  4DV4 B;  3CCL V;  4LF6 O;  1D5N A;  3E22 B;  3B40 A;  3FAV B;  4H33 A;  1FXK C;  1L0L H;  3CCR V;  2CGN A;  1IJG A;  4X1K B;  1MNG A;  2EIK C;  2DWD C;  5HFL A;  2BSK A;  1COW G;  3ZRX A;  3ABM C;  1N0N A;  1SQF A;  4O4I B;  2JEU A;  3CHX A;  2JRI A;  2XAG A;  2YIC A;  1XNQ O;  4Q6G A;  2QKA A;  4MVS A;  3QNE A;  4UB6 Z;  1Q6I A;  4GKK O;  1LNQ A;  3H1L H;  2IU0 A;  2DQ0 A;  2YI8 A;  4DR1 B;  1SS3 A;  4OXS A;  3ABM B;  2P6J A;  1E1Q G;  3B77 A;  3OUF A;  1VIB A;  2ITD C;  1KC8 W;  4O4J A;  3H1K H;  3RT3 C;  4GKJ B;  2X6C A;  4MVO A;  4FLU A;  4DV3 B;  5BZB A;  1MSD A;  3IFX A;  3ZMV A;  4IIJ B;  3RYI A;  5LMN B;  1S77 D;  3UO2 A;  4D7T A;  4MTG A;  3KCY A;  4PA7 A;  5C8Y A;  1N32 O;  3ABT A;  1J5E O;  2IU3 A;  4BIO A;  4ASU G;  1DK1 A;  4MS2 A;  3GVM A;  3K5O A;  2A7W A;  2B9Z A;  2Q69 A;  3P3P A;  4LWS A;  4FM1 A;  3OEH G;  4JTD B;  2UXC B;  1GN6 A;  2K1E A;  2EJR A;  2PTM A;  4U3F H;  3CRM A;  4R8C A;  1WP7 A;  1GAX A;  2WSS G;  4X88 A;  5BXZ A;  1XBL A;  2OIE A;  2YXH A;  5IYC O;  1I08 A;  3W7W A;  4X9Q A;  2FML A;  1SES A;  3J81 N;  1KP2 A;  1UFI A;  2YXY A;  3L71 H;  2UXX A;  2XAF A;  1AP5 A;  5J2U A;  4U3J A;  3S3W A;  2Q8V A;  4I55 A;  4UCO A;  2QM4 A;  5EBW C;  4B3S O;  4CBC A;  5B1A B;  4W4L A;  1SQP H;  2BE3 A;  2HFE C;  1ZL8 B;  3B2E E;  3TCU A;  4NXN O;  2DYS B;  4JI0 B;  2YC0 A;  5GTI Z;  3RGB A;  5LYJ B;  5IYZ B;  2UXN A;  3JAS B;  3J80 N;  3JCU Z;  1GM8 A;  4FM2 A;  1F4N A;  1QCE A;  1Q3E A;  2DMX A;  3OMN B;  1AJP A;  3ZHR A;  4PDR A;  4UVC A;  3EFF K;  3D3Q A;  4IYI A;  1JR9 A;  1IVS A;  1SET A;  3K0D A;  4J9Y B;  1RFY A;  4MT8 A;  3QO5 A;  4A5U B;  1EZV H;  1OCC B;  2DN9 A;  4DV5 O;  2AHY A;  2GV9 A;  4I0X B;  2QA4 V;  4X20 A;  5B1B C;  4X62 O;  2A79 B;  1K5S A;  4C7U A;  4RUF A;  4XDK A;  3FYI B;  1KQS U;  3ICX A;  3OR7 C;  2JEX A;  4MTF A;  2GSM B;  4N21 A;  3SYO A;  1PNK A;  4LF8 O;  1VF7 A;  1WB7 A;  3DXR B;  3RYC A;  1TUB B;  1Q6H A;  4DR2 O;  3SJA C;  2KB1 A;  2P5O A;  2XT9 A;  5KLV H;  1SQX H;  4QPK A;  3N2K B;  4H13 B;  2ZNJ A;  5E1A C;  5LBQ A;  1XDC A;  5J2T B;  2Q7E A;  4DR6 B;  1GMG A;  3NXS A;  1XQ8 A;  4K3A A;  2R70 A;  3T1Y O;  1SKV A;  3IGA C;  4UCU A;  1MZF A;  3L75 H;  1R3J C;  2CE4 A;  1PL4 A;  2AXT Z;  1QLN A;  2JVD A;  1N33 O;  1NTM H;  2NNU A;  2HJD A;  1QHT A;  1V55 B;  4PD4 F;  1YVW A;  1ZUQ A;  2ZR3 A;  3FKS G;  4YIO A;  5FNV A;  4K35 A;  1SER A;  1K92 A;  1M9N A;  3CWB H;  4IT5 A; 
#chains in the Genus database with same CATH homology
 4GUN A;  4JZG A;  3CEI A;  1EN6 A;  5AG2 A;  1GN2 A;  1SZX A;  1VAR A;  3EVK A;  3QVN A;  1JR9 A;  1JA8 A;  1XUQ A;  1GN3 A;  1XIL A;  1EN4 A;  1KKC A;  1MA1 A;  1MSD A;  3AK3 A;  1B06 A;  1I0H A;  1EM1 A;  1ZSP A;  4C7U A;  3DC5 A;  3AK2 A;  1IX9 A;  1ZLZ A;  3AK1 A;  1ZTE A;  3BFR A;  3LSU A;  2P4K A;  1MMM A;  1IDS A;  1QNM A;  4E4E A;  4F6E A;  3KDR A;  3C3T A;  1N0J A;  1WB7 A;  1AR4 A;  2CDY A;  5A9G A;  2ADQ B;  1GN6 A;  1AP6 A;  1VEW A;  4FFK A;  2AW9 A;  3IC9 A;  3KKY A;  1P7G A;  3K9S A;  2ADP A;  1Y67 A;  3OT7 A;  3RN4 A;  1I08 A;  4JZ2 A;  3DC6 A;  4X9Q A;  2RCV A;  4YIP A;  1D5N A;  1XDC A;  1PM9 A;  1WB8 A;  1LUW A;  2GDS A;  1BSM A;  1AP5 A;  4JYY A;  1GN4 A;  1IXB A;  2QKC A;  1BS3 A;  1MNG A;  4BR6 A;  2CE4 A;  1PL4 A;  1BT8 A;  3C3S A;  1XRE A;  1LUV A;  1N0N A;  1EN5 A;  1AVM A;  1ZUQ A;  3MDS A;  4YIO A;  2QKA A;  1AR5 A;  3TJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...