1WB8A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [FE]
publication title Iron Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus: Analysis of Structure and Thermostability
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 75
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb8A02
3AK2A 2CDYA 1D5NA 2CE4A 1MNGA 1IX9A 1GN4A 4JZ2A 4YIOA 1SZXA 3DC5A 1Y67A 1P7GA 3K9SA 1MSDA 1BT8A 1GN2A 1I0HA 1AR4A 1B06A 1AP6A 4C7UA 1KKCA 3OT7A 1PL4A 1ZUQA 1EN4A 3CEIA 4JYYA 2ADPA 2GDSA 3AK1A 5A9GA 3C3SA 1MMMA 1BSMA 3C3TA 3KKYA 4FFKA 2QKCA 1ZSPA 1AP5A 2QKAA 3QVNA 1ZTEA 3BFRA 1IDSA 5AG2A 1LUWA 1QNMA 2ADQB 4F6EA 1PM9A 1XREA 1ZLZA 1GN6A 1EM1A 1XUQA 1XILA 1VEWA 3DC6A 2RCVA 1MA1A 1AR5A 1EN6A 1N0JA 3EVKA 1GN3A 3LSUA 1I08A 2AW9A 4X9QA 1IXBA 1XDCA 3TJTA 1JA8A 1AVMA 3IC9A 1LUVA 3MDSA 3RN4A 2P4KA 1WB8A 1JR9A 4JZGA 1WB7A 1N0NA 3AK3A 1EN5A 1BS3A 4YIPA 4E4EA 1VARA 4BR6A 4GUNA
chains in the Genus database with same CATH superfamily
3AK2A 2Q5ZA 3I55V 4AILC 4N23A 4LH6A 1VQMV 2YI8A 4NKGB 3FYIB 1YHQV 2EIJB 2XAFA 5JJNB 1QR9A 1KYOF 3T4ZA 3ZHVA 3APQA 1NQTA 4DR7O 4FPPA 1KBHA 1WP7A 1VQ7V 4PA9A 1DK1A 1GAXA 2QA4V 3OMIB 2XASA 4JV5B 3AK1A 4JI0O 2JJ1G 5LGTA 1JFFB 2X6CA 1YJNV 2CTWA 5LGUA 4X1IA 3C90A 3CCQV 4JI8B 3SYPA 2HJFC 3N2KA 4O4HB 1Y74A 3ABKC 2ZR3A 4IIJA 5CA0A 5KHIA 5B1AB 3ASOB 1RSOA 1NH2B 3CX5F 1P7BA 3CSXA 4LF8O 4UCSA 5LA6B 4LFCB 4DV2B 1IVSA 4KXRA 1ZTEA 1IDSA 2JK5C 2VS0A 2JS5A 1NS1A 2NNUA 1H2MA 4B3SO 2YIAA 1ZAUA 1TAEA 3D36C 1ZLZA 4JI2O 3BPZA 1XUQA 1HR0B 4WFGA 3CJHB 4X65B 2BTQB 2AW9A 2DQ0A 1JX9A 1WP8A 3IC9A 1GTOA 2H94A 5LYJA 4DYLA 3IGAC 1WPXA 4MVQA 3JD4A 5FNVA 4EFEA 1M5IA 4P9PA 4LH7A 3ZBHA 1AJQA 3E8FA 4DR3O 2PUSA 1R6TA 2BCCH 3K5LA 4LWSA 4X8AA 4BIZA 1K9MW 3ABLB 3CRRA 5CN0A 4DUYO 1S72V 4B08A 1IX9A 1MABG 1FFXA 2VRZA 2YS8A 2FMLA 1P7GA 4XDLA 4NXMO 2KQXA 4K3AA 1GN2A 1CEZA 1GMGA 3SR2C 2ZD9A 1OCOC 3JSNA 1NZ6A 1I7FA 2E3CA 4JI7B 5HFLA 2YSUB 4YY3O 3G6BA 2D2CB 2EIMC 3W7TA 2GDSA 1M57B 5L3DA 3ABTA 4TUYB 3S3WA 5J9PC 2CAZC 1HP8A 3UKMA 2XNDG 2PI5A 3EFFK 3ZHRA 1YXBA 1Y76A 5TISZ 2JVDA 4PI2A 1RP3B 1SRYA 1N4CA 3MD0A 1KUQA 1FXKB 2JGDB 2EINB 2JGUA 2UUCB 2YEVA 3VQYA 2LW1A 1XILA 1VEWA 2Y69B 3A2FA 3N27A 1N0JA 1AJNA 4BW9A 3EVKA 4J9YB 2ZE6A 4IYIA 4NB5A 4DUZB 1L1FA 3RYHA 1XMQO 5GONB 2EZPA 3FB6C 5CA1B 4JI6B 2IH1C 1GO3F 5B1BB 2W0XA 3ETDA 4DRXB 3OTOO 4LFAB 1VQLV 3JAKB 2WLJA 4UV8A 2WLNA 3HKBA 4H37A 4UCTA 4O2BA 4NTXA 1YDXA 4FK5C 5GTIZ 3QG5A 5B3SC 3B2EE 4EB6B 5JVDB 3LSQA 5IYZB 4KP4A 2ITCC 5KAFZ 4MVZA 2KKWA 3WB0A 2NN4A 2WLIA 4YIOA 3M8AA 1IBLO 1HDJA 1R3KC 3AG2C 2FYUH 1Q5OA 2DYRB 5A2QN 2UUAO 2CH7A 3OUFA 2QWNB 1RPRA 3RWRD 4JI5B 1FFTB 1FJGO 1JNBA 1SETA 3FKSG 1B04A 3E83A 1OCCC 4JAVA 4JYYA 4ZI7B 3QNEA 5BR8B 1H2NA 1NVPB 2YIBA 3AG4B 4J41A 4LF6O 2A79B 1QLEC 1OCCB 4FM1A 1MSWD 2D3OW 3ZX6A 3T1HO 3WB2A 1XNRO 2KB1A 1HNWB 4GX1A 4TQFA 1XNQO 2LGWA 1SQFA 2UUBO 4TWKA 4BAYA 2UXBB 4Z1VA 2PF4E 1WAZA 3L74H 2WAMA 4I0XB 2XOKG 1HNXB 4PDLA 2PYLA 4ZBMA 2HHHB 1Q43A 3RVZA 4YJ3B 3K59A 3LDDA 4JTCB 4NR1A 1Z2GA 5IJ9B 4F6RA 5J2UA 3QO5A 2M7WA 2Q68A 5LBQA 1BQ0A 1TVKA 1KMIZ 1GK9A 4HNAB 1VARA 5JQGB 4PDRA 4FMTA 3JD0A 2Z5UA 4JI1B 2UU9B 5DM6V 1HNZB 2P90A 1XL6A 1MNGA 3K9AA 4MVMA 5EZYB 1G4YB 5J2TA 5IWAB 2C2AA 5H6QA 3IJ4A 4C7UA 2WWWA 4RWUA 3PJSK 3UM7A 1N34B 1WN7A 3SJQC 4ZKIA 3AG3B 1ZUQA 1VF6A 2AHYA 1BE3H 5IYDO 5BMVA 4DR2B 1XMOO 4LFBB 3AG1C 1S5LZ 4JYAB 2Q69A 2QWQB 2YIBD 2RN9A 4J7JA 2VQEB 1UPGA 5FL7G 2Q0AA 1OZ0A 3W7WA 3RFRA 2G38A 1R1BA 4DR6O 4UFZA 3CC7V 4O4JA 4JTDB 4QGPA 4OX9B 1O9HA 4DV1B 1ZL8B 3ZMZA 5EBWC 1K33A 5B1NA 4X9QA 3AEIA 1ROPA 3OGIB 2FB5A 3RGBA 5EYPB 1COWG 3JARB 1JA8A 2IM9A 3CCEV 1MOFA 2E76B 5KUKA 1YEWA 1LUVA 1FS0G 4LF5O 4JI3B 5LP6B 4P30A 3CCJV 3GWOA 4DV7O 5KA6A 2WLHA 1IBMO 4O2AA 2R9RB 2YXLA 2QM4A 5IDJA 3NR7A 2ZM6B 3BRCA 5C8YA 4JI4B 5K1PA 4BR6A 2UXCB 1RFYA 3FFQA 4PA6A 2OCCB 2CE4A 1NVPD 3H1KH 3RYCA 1SZXA 4FIPC 3E8GA 3LSSA 5CBHA 4DR1O 1QVGU 2L6LA 2VQFO 2JJ2G 4DR7B 1QBZA 1Q6UA 4MSWC 4J80A 3CC4V 2QKSA 1YVWA 1J5EO 3BA9A 4JAAA 3EXAA 4L8JA 4JI0B 3K58A 5IJ0A 1PPJH 1W59A 1EFRG 1E79G 4X66O 1QLNA 2RJZA 2YDEA 2QEXV 1OJHA 3E22A 5LHHA 4IHJB 4MT8A 2QKAA 2F43G 3CXHF 2BOBC 4LF8B 1TUEB 5KA5A 1R73A 1Q90D 4MVRA 4YJ2A 4B3SB 1PM9A 2ZR2A 3ZN1A 4PD4F 3T2MA 3RBZA 4JI2B 4Z2WA 3L73H 4X20B 4K35A 2O57A 3KZIZ 1I08A 2WSSG 3STZC 5KHGA 5L3FA 1VMGA 2RMKB 3HKCA 1K3EA 1JPXA 2LO1A 1YCIA 3A0RA 2UXDO 1WB8A 1AB3A 4W4KA 2XTAA 4JZGA 2VWKA 4I50A 4JYBA 2E5LO 3CYOA 4WCEV 5LOVB 2ETNA 5LMNO 3IAYA 4JTAB 2WLLA 1JQ0A 3NXSA 1PKXA 4O4LA 3B09A 1GM9A 4FFBA 1DF5A 2HVJC 2F4VO 2A06H 1Y67A 4LF7O 2JS3A 4NXMB 2BSKA 3N2KB 3D8CA 1Y74B 4IIJB 2RDCA 5CA0B 4DW1A 3CHXA 2EIJC 1CP9A 1RSOB 4X89A 1YJ9V 3ZN0A 4UXNA 1HWYA 3UO2A 4PA4A 2V1DA 1VQPV 1JJ2U 4YY3B 1X59A 3UT5B 3TCUA 2IW5A 1X4TA 1K34A 4YXWG 5EBLC 4UVBA 1A32A 5HFMA 4K8ZA 3UO3A 1SKVA 1Q8IA 4FLTA 3ZHSA 4I55A 2QKCA 2Q4PA 2HJDA 2P7TC 5KX5B 3ZHQA 5B1AC 3ASOC 4ABMA 3BFRA 1LUWA 3E2EA 1VP7A 4DR5O 4FM2A 1NTZH 4OPHA 2F1MA 3ZHUA 5FNVB 2XUMA 3VBBA 1F51A 3FX7A 1GN6A 1KP2A 4ZOLB 3ABMB 2LFRA 2PGGA 1BQZA 1DGSA 3ETQA 4RUFA 1XMQB 3T4DA 4DV5O 2CGOA 3MDSA 2N04A 1XI1A 2HR3A 3CCVV 1AI4A 3ZMUA 1PD3A 1FFXB 5JCOA 2Q7HA 3OTOB 3DXRA 4WFHA 4MVSA 3JASA 4YIPA 1OCRB 3ABUA 1H8HG 1TUBB 1B6QA 3HKDA 4I7ZB 1XL4A 2CDYA 5DECA 3A8TA 5EIBC 1M1KW 4JZ2A 4CS2A 3ABLC 1IBKO 1IBLB 1SS3A 2RQ6A 1G8MA 2KG7A 2WA4A 2X6AA 2UUAB 4BIOA 5BZBA 1KB9F 1WPBA 3LUTB 1FJGB 3IC7A 1UJWB 4P9OA 3RYFA 4O4IB 3FB8C 1L8DA 4FLUA 4UUJC 3TK1A 1VQ8V 3PN1A 3I5DA 3CC2V 4O4HA 1M57C 2YEVB 4U3FH 1BSMA 5L3GA 2DYSB 5LA6A 4PA7A 4LF6B 4MVUA 2B5UA 4DK0A 3CRQA 4E2LA 2OIGA 1WA8A 3T1YO 2LQTA 2P67A 2ADQB 3T1HB 1FPOA 1XNRB 3P32A 4LF4O 4WFBV 3LNNA 3RVYA 1YF2A 3W7XA 3J81N 4TQDA 1FXKC 1XNQB 3X2QB 4BIUA 2UUBB 1DTOA 2EINC 2MW2B 2UXNA 3CJHA 2BTQA 1EN6A 2EJ7A 3K04A 4O2BB 3LSUA 2Y69C 3CWBH 1GKFA 4EFBA 5LHGA 4JF3A 1MZEA 2ZXWB 3D36A 3BCCH 3JD1A 5H9CA 2N74A 1XHXA 4TT3G 3HB3B 2WLIB 1S77D 4XBFA 5B1BC 2QE7G 4A5UB 4GZRB 1BS3A 2CH7B 3UQ8A 2LGQA 1US6A 3H1JH 4J9ZB 4R7CA 1OV9A 1YI2V 4GKKO 2PZSA 3Q4HA 3CCLV 2V4DA 4FLYA 4ZHQB 3RYIA 3TETA 1E1QG 2PTMA 4LCUC 5CB4A 2QM7A 4H0LB 2L35A 3WU2Z 5KHKA 3M7MX 4UVAA 1KKCA 4X62B 2DYRC 3P3PA 3JALA 1EN4A 1NR1A 2Y48A 4YHHO 3B77A 1Q81W 1PNLA 3ZRSA 1XMOB 4TUYA 1XEQA 2ZKOA 3VQVA 4I4TA 1NH2D 3J7AU 1U96A 4LR3A 3WFVA 2OTLV 1YTFB 3ZRWB 1TA8A 1VQ6V 5L3EA 2QTOA 1ZSPA 2R70A 3AG4C 3B40A 4LNUB 4MW8A 4TV8B 4DR6B 4DW0A 2JGDA 2QWOB 3IFXA 3HPLC 2DQ3A 3VOUA 4QPJA 2QGNA 1KECA 1S5HC 1FKAO 3ML0A 4F6RB 2DN9A 1EM1A 3OAAG 1BL8A 5CMUA 5J2UB 1GM7A 3ZMTA 3CPWU 4JASA 1BHBA 4R6ZA 4IYHA 2ARHA 4KL1A 1FXHA 2Q9LA 1EZJA 4NXNB 4X1YA 3OEHG 2B9ZA 2H8PC 4PHZA 3TXSA 2JIZG 5CA1A 5F2VO 2HEPA 1M90W 3JATB 5EC1C 3THOA 1RM1B 4LF5B 4UCOA 2IJKA 2Z0AA 5EBMC 5J2TB 4DV7B 1SA0A 4Z1MG 1WB7A 1IBMB 5EIBD 5KAIZ 3OR7C 4ZIBA 3KCYA 4EB6A 5LXTB 2P5OA 2JEUA 5IYZA 1RPOA 4OGQB 5BMVB 5ITZA 4AQYO 1V54B 2WA3A 4HYOA 4UV9A 4X1KB 1QR8A 2ITDC 3CCRV 2OTJV 3SYAA 1B06A 4DR1B 4X64O 3WG7B 1Q82W 3MAQA 2MK3A 2QSAA 3SPCA 2VQFB 3SYOA 4CH3A 4ZI7A 4DR4O 2ZIOA 1SQBH 4MVOA 3AG3C 3P30A 1I5XA 1J5EB 2EIKB 2B1GA 3QO8A 5GTHZ 2ZCEA 4X66B 1MMMA 5CBGA 1H5WA 4FZ0A 4U3JA 2CTRA 1QU7A 4QE7A 2P6JA 4KHPO 4GLXA 3CB2A 4R50A 3SPHA 1SQQH 4DV3O 2IJIA 2AHZA 2CK3G 4F6EA 4WFAV 3CS5A 1U97A 1J95A 4L87A 3ZMSA 4D7SA 3FD9A 2KSDA 2DJVA 1AR5A 2K1EA 4U7OA 4I0XA 1OCZB 2QM8A 4G28B 4WBNA 4AI8A 1S3JA 2F66C 1SQPH 2X7RB 4P2ZA 1AVMA 4PJ0Z 4YJ3A 2GUZB 2Y4TA 2V7QG 5L3BA 3R66A 3RN4A 5IJ9A 4FLWA 1KD1W 1SZTA 1NBMG 3L9DA 4PI0A 4QIWF 2UXDB 2PY5A 5LP6C 1M93A 2E5LB 4I9QA 1AROP 4HNAA 4CH5A 4K0KO 4I9WA 3U10A 3R65A 1N33O 5LMNB 4JPRA 5LGNA 5KMGA 1HW7A 3M99B 1D5NA 1R6NA 4TV9A 3DGEA 4IGGA 1SQXH 1GN4A 2F4VB 1Q3EA 2CUGA 2OCCC 1N32O 4LF7B 4DV0O 1BT8A 1NU1H 3ASNB 1YJWV 1SQGA 3E22B 4MW3A 1PL4A 2ZE8A 2HP8A 3APOA 3CEIA 1YSCA 1D2DA 3CCMV 4B3MO 2ADPA 2Y0PA 1XBLA 3OMNB 1AI5A 3JCUZ 4YJ2B 4B3TO 2F93B 1FD9A 1QVFU 1R3JC 4WF9V 1I5YA 1NJIW 3KG2A 3LNMB 2Q8VA 3OTFA 2XAQA 3ICXA 4R8CA 2OCHA 3JYCA 2OIEA 3A0HZ 5IY5B 4FLXA 2YXYA 4DR5B 2FTKA 4MTOA 3HKCB 3BVOA 3KCXA 4DO2A 2EILB 3G71V 1XREA 1ZL8A 4J42A 3LDEA 1M56B 1YZBA 3QO7A 4QE9A 3SPGA 2R72A 2UXXA 1R6KA 1K4DC 2PI4A 3T1CA 3OD4A 2WLLB 5KHHA 5LP6A 3ETEA 2GSMB 4DV5B 3CD6V 2H3OA 2OT5A 4D6TH 1VF5B 2YI9A 1V55B 4FLVA 1PL0A 1Y6XA 2A9HA 2IH3C 1VQ9V 1VQKV 1EN5A 5IYCO 2GTAA 1N36O 1JOYA 3E86A 4GUNA 3J80N 1AI6A 1FXVA 2B1IA 4DV6O 3FB7C 1EBOA 1Y4MA 3ZIAG 4JGSA 1IBKB 4HAMA 1IJGA 4GCZA 4PELA 2ATKC 4DR3B 3A0BZ 4MTFA 1BHAA 4GKJO 5L3CA 1G6UA 3CP1A 4H13B 1KU9A 2BOCC 1VF7A 3L71H 4DUYB 3RT3C 4J11A 2XHBA 4X1IB 2RNBA 3L70H 2YXHA 2LFSA 4IHJA 5C93A 1I94O 3OFNG 3N2GA 3GVMA 3QVNA 4HZ3A 5AG2A 3T1YB 4H44B 4PA3A 4B7KA 3L72H 4W4LA 4PDMA 1P84F 4LF4B 3ZS8C 4CZZA 3ZJZA 3JAWA 3HKEA 3SPJA 2ZM6O 1GN3A 3BAAA 4J10A 4JI4O 1CPYA 4RQEA 5GW7A 5E79Z 1IXBA 1UFIA 1PV0A 3ABMC 4PDVA 4DK1A 1H2GA 2VWJA 2YIDA 1THZA 3HKDB 3FAVA 4B3RO 2P22C 1K4CC 3G67A 4K8XA 5LYJB 4DXWA 2XT9A 1VIBA 3SYCA 2DWEC 4CS4A 4I5SA 5LOVA 1VQ5V 2KG7B 3AK3A 1P4RA 4FLZA 3HR0A 1Y66A 2FL4A 3ZHTA 3B4SA 2DOSA 1OCRC 4GYCB 5JH7A 3RYFB 4GKKB 4LWSB 2ZQMA 4PV1B 2DWDC 2QJ1A 2AZ0A 1JVMA 2HKOA 2XAHA 1XQ8A 1NKDA 5JJJB 3ZEDA 4DV4O 2OWOA 5B5EZ 1GH6A 1F4NA 1WA8B 1WLEA 3UCSC 3UT5A 4YHHB 3TXQA 2GV9A 2X0LA 2R9IA 4AHCA 1WJZA 5H5NA 1KC8W 3ABKB 5EK0A 2Q7GA 5H2FZ 2XAGA 3K03A 4CS3A 4UVCA 1BMFG 2IJHA 3F5TA 4MS2A 3MHHC 3VQXA 2NR5A 5KX5A 3OMAB 1Q6IA 5IYBO 2DYSC 1Y76B 4J7KA 1N8RW 2ZINA 1AJPA 1QCEA 1SQVH 1JFFA 1JJOA 4RQFA 3SYQA 2HLDG 4ZOLA 4RUEA 1F4MA 1P49A 3SJCC 3STLC 4JYCA 2JRIA 4H33A 3X2QC 1AI7A 1YITV 2AGAA 4CH6A 3H1IH 3O9OA 4JAUA 1KKDA 5LMUO 1CXZB 3RYHB 3Q4HB 2ZXWC 3G80A 1JR9A 3RYIB 4LF9O 3FB5C 4Q6GA 4X88A 5CB4B 3HKBB 4B7EA 2HG5C 4E4EA 3BA8A 3BHPA 1TUBA 1SF9A 3JALB 1LR1A 1FOUA 2Q7EA 1QHTA 3JD3A 1URFA 1JCHA 2ZE7A 4AQYB 2QTSA 5DEDA 1EZVH 5IE9A 2YUAA 4ASUG 4I4TB 3S3XA 4UB8Z 1MSDA 4D7TA 1OCOB 5BXZA 1MZFA 1H38A 4X64B 2JEXA 2ZNIA 1SERA 2EIMB 1VQNV 4DR4B 4O4IA 1NTMH 4JV5O 1W0KG 4TSFG 4KFMA 3G4SV 1VQ4V 1NR7A 3OEEG 4FM0A 4FVMA 4JI8O 3K79A 4CBCA 1ZWIC 1PP9H 2Q73A 4WFFA 1M9NA 4DV2O 4LFCO 2WLKA 1L0LH 4KHPB 1R3IC 4X1YB 2DMXA 3OR6C 4DV3B 3EHBB 3CXCU 3BABA 5LL6Y 4G2KA 4TOIA 4OPAA 3H1HH 1B3QA 3ETGA 2X6BA 3U0ZA 1HR0O 3DTUB 1SA0B 4QJFB 4X65O 1VQOV 1Q86W 4IL6Z 4J7ZA 5KUMA 1ENVA 1XDCA 2CTPA 3D3QA 3B8NA 1FXKA 2E74B 3CMAV 1BZKA 5ITZB 2A0LA 2HVKC 1D5AA 1RM1C 1F23A 5B3SB 1N0NA 2LP7A 5D5PA 3GWKC 2Z3YA 1TVKB 4K0KB 4FZ1A 4UCUA 1DF4A 4UCVA 3DSQA 1N33B 5GONA 3K0GA 3GB7C 2Q67A 4ZHQA 2Y0IA 1VF6C 3AG2B 4MTXA 3K3WA 4DRXA 5DN6G 5B66Z 3JAKA 3OM3B 3SGIA 1V54C 2XAJA 1N32B 1I0HA 1AR4A 4DV0B 4GX0A 3SPIA 2A3QA 4WFEA 4U3JB 3CMEV 4JI7O 1NI8A 1BCCH 5JVDA 3WG7C 3VQWA 3K5NA 1OHHG 3K06A 4Q20A 4B3MB 1Z5VA 3ZRVA 2HFEC 4B3TB 2EBOA 2LJ2A 3C3SA 3BEHA 3U11A 3ZRWA 2EIKC 1QLEB 2N05A 3LDCA 3C3TA 3H01A 4GT1A 2QR4A 4LNUA 1YIJV 4TV8A 4WBNB 2DW4A 3K57A 4O4JB 1FYJA 5FLXN 2A7WA 3AG7A 2UUCO 4KUMA 2IU3A 4F4LA 2ZE5A 1O9GA 4NTWA 5B1OA 1LNQA 4DUZO 1Q6HA 1OCZC 3JATA 5KMGB 4JI6O 4OXSA 4TV9B 3OUSA 3WB1A 2R9AA 4N21A 4LFAO 1M4UA 5LHIA 4X62O 4O2AB 4QPKA 1IXMA 3JSLA 2PYJA 4GX5A 3TGUH 3F7VC 5LXTA 1Q7YW 3G6EV 5KLVH 1N36B 1TGOA 5C8YB 1AR1B 2E75B 3E8HA 2ZDIC 4QNHB 4DV6B 4X1KA 2EZOA 2QWPB 1SC5B 3DC5A 4BWAA 3RYCB 4CC5A 1H8EG 4G27B 3K9SA 2CGNA 1AP6A 1SESA 4BW5A 4JI5O 3OGCC 1T5EA 1KQSU 2GHYA 5JQGA 3ASNC 1K73W 1GRJA 3K0DA 3AG1B 4GX2A 3W7SA 4GKJB 5FPOA 3ZRXA 4LP8A 2P4VA 5EZYA 5BR8O 1Z5WA 3E35A 4LBEC 3BY6A 1YTFD 1W0JG 4NTYA 2F95B 5A9GA 2EJRA 3SJBC 3QTCA 3L75H 5IJ0B 2IBZH 3ZMVA 4NXNO 1I94B 4FFKA 1BGYH 4LC1A 1QNMA 3F5WC 3OW2U 3E8BA 5FPRA 3K5OA 5H6RA 4NVPA 1K5SA 2DE0X 1HNWO 1JMKC 2ILMA 5IY5C 4CC6A 2Q6AA 1S0VA 3CRCA 2UXBO 2RCVA 1MA1A 2EILC 3QF7A 3CE2A 1M56C 1HNXO 1K8AW 3CCSV 3E89A 2GUZA 2EX3A 3W7UA 2HHHO 5JWPA 3KDRA 2GTSA 2P4KA 4B3RB 1XHZA 1GM8A 5JJEB 2P06A 2Y4UA 1W2BU 5CA3A 4I50B 1V55C 3CCUV 2AXTZ 3O65A 2ZDIA 4XDKA 5EYPA 4RO2A 3JARA 2IJJA 4JI1O 2UU9O 1HNZO 2CTQA 1H2SB 1MG1A 2ZNJA 2ZIMA 2M6YA 4O4LB 2LW7A 2OYQA 4FFBB 5IWAO 1KP3A 2F23A 2Q0OC 3P3NA 4U7NA 3JD2A 1PNKA 2JDIG 1N34O 2BSKB 4IT5A 2W6JG 3MHSC 1DLBA 3OT7A 1ZX3A 3N2GB 2WLMA 3CRAA 4UCRA 1AILA 4DV4B 2GBOA 4UB6Z 3D3IA 4DR2O 4LFBO 5IT9N 2QDOA 2NLJC 4JYAO 5K1XA 1IZ3A 2VQEO 3B8MA 2FKXA 3JCZA 4RAIA 3OE7G 3JAWB 3HKEB 3KKYA 1R3LC 1PNMA 1AP5A 1G1XB 4I55B 3H9VA 3SJAC 2ZT9B 1WNSA 1XOUA 2W6IG 2YC0A 1IURA 1K7DA 4XDJA 4OX9O 3FAVB 3F7YC 4DV1O 2EULA 4NYKA 2AZ2A 3JAMN 1L0NH 5EC2C 2W0FC 3DC6A 1F7YA 4EKWA 5E1AC 4CH4A 3SDLA 5JCOC 1S5JA 1NT2B 1H2KA 3TJTA 1NTKH 1E1RG 1ORQC 2QWRB 4FJCC 3FYEB 2YICA 2K9PA 3K08A 4EEQA 3CRMA 1FAFA 2BTOA 5LMUB 2BE3A 4JI3O 5JH7B 2ODMA 1K92A 3ZCCA 4ICGA 3K5MA 5CBFA 4LF9B 5KHJA 3I56V 1V9PA 3H1LH 4X20A 1K5QA 1QQCA 3DXRB 2IU0A 1H2LA 1S76D 5BY1A 4HBNA 3JASB 1K97A 2UXCO 2WPDG 3RW0A 5D5QA 4MTGA
chains in the Genus database with same CATH topology
3AK2A 2CDYA 1D5NA 2CE4A 1MNGA 1IX9A 1GN4A 4JZ2A 4YIOA 1SZXA 3DC5A 1Y67A 1P7GA 3K9SA 1MSDA 1BT8A 1GN2A 1I0HA 1AR4A 1B06A 1AP6A 4C7UA 1KKCA 3OT7A 1PL4A 1ZUQA 1EN4A 3CEIA 4JYYA 2ADPA 2GDSA 3AK1A 5A9GA 3C3SA 1MMMA 1BSMA 3C3TA 3KKYA 4FFKA 2QKCA 1ZSPA 1AP5A 2QKAA 3QVNA 1ZTEA 3BFRA 1IDSA 5AG2A 1LUWA 1QNMA 2ADQB 4F6EA 1PM9A 1XREA 1ZLZA 1GN6A 1EM1A 1XUQA 1XILA 1VEWA 3DC6A 2RCVA 1MA1A 1AR5A 1EN6A 1N0JA 3EVKA 1GN3A 3LSUA 1I08A 2AW9A 4X9QA 1IXBA 1XDCA 3TJTA 1JA8A 1AVMA 3IC9A 1LUVA 3KDRA 3MDSA 3RN4A 2P4KA 1WB8A 1JR9A 4JZGA 1WB7A 1N0NA 3AK3A 1EN5A 1BS3A 4YIPA 4E4EA 1VARA 4BR6A 4GUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AK2 A;  2CDY A;  1D5N A;  2CE4 A;  1MNG A;  1IX9 A;  1GN4 A;  4JZ2 A;  4YIO A;  1SZX A;  3DC5 A;  1Y67 A;  1P7G A;  3K9S A;  1MSD A;  1BT8 A;  1GN2 A;  1I0H A;  1AR4 A;  1B06 A;  1AP6 A;  4C7U A;  1KKC A;  3OT7 A;  1PL4 A;  1ZUQ A;  1EN4 A;  3CEI A;  4JYY A;  2ADP A;  2GDS A;  3AK1 A;  5A9G A;  3C3S A;  1MMM A;  1BSM A;  3C3T A;  3KKY A;  4FFK A;  2QKC A;  1ZSP A;  1AP5 A;  2QKA A;  3QVN A;  1ZTE A;  3BFR A;  1IDS A;  5AG2 A;  1LUW A;  1QNM A;  2ADQ B;  4F6E A;  1PM9 A;  1XRE A;  1ZLZ A;  1GN6 A;  1EM1 A;  1XUQ A;  1XIL A;  1VEW A;  3DC6 A;  2RCV A;  1MA1 A;  1AR5 A;  1EN6 A;  1N0J A;  3EVK A;  1GN3 A;  3LSU A;  1I08 A;  2AW9 A;  4X9Q A;  1IXB A;  1XDC A;  3TJT A;  1JA8 A;  1AVM A;  3IC9 A;  1LUV A;  3MDS A;  3RN4 A;  2P4K A;  1WB8 A;  1JR9 A;  4JZG A;  1WB7 A;  1N0N A;  3AK3 A;  1EN5 A;  1BS3 A;  4YIP A;  4E4E A;  1VAR A;  4BR6 A;  4GUN A; 
#chains in the Genus database with same CATH topology
 3AK2 A;  2Q5Z A;  3I55 V;  4AIL C;  4N23 A;  4LH6 A;  1VQM V;  2YI8 A;  4NKG B;  3FYI B;  1YHQ V;  2EIJ B;  2XAF A;  5JJN B;  1QR9 A;  1KYO F;  3T4Z A;  3ZHV A;  3APQ A;  1NQT A;  4DR7 O;  4FPP A;  1KBH A;  1WP7 A;  1VQ7 V;  4PA9 A;  1DK1 A;  1GAX A;  2QA4 V;  3OMI B;  2XAS A;  4JV5 B;  3AK1 A;  4JI0 O;  2JJ1 G;  5LGT A;  1JFF B;  2X6C A;  1YJN V;  2CTW A;  5LGU A;  4X1I A;  3C90 A;  3CCQ V;  4JI8 B;  3SYP A;  2HJF C;  3N2K A;  4O4H B;  1Y74 A;  3ABK C;  2ZR3 A;  4IIJ A;  5CA0 A;  5KHI A;  5B1A B;  3ASO B;  1RSO A;  1NH2 B;  3CX5 F;  1P7B A;  3CSX A;  4LF8 O;  4UCS A;  5LA6 B;  4LFC B;  4DV2 B;  1IVS A;  4KXR A;  1ZTE A;  1IDS A;  2JK5 C;  2VS0 A;  2JS5 A;  1NS1 A;  2NNU A;  1H2M A;  4B3S O;  2YIA A;  1ZAU A;  1TAE A;  3D36 C;  1ZLZ A;  4JI2 O;  3BPZ A;  1XUQ A;  1HR0 B;  4WFG A;  3CJH B;  4X65 B;  2BTQ B;  2AW9 A;  2DQ0 A;  1JX9 A;  1WP8 A;  3IC9 A;  1GTO A;  2H94 A;  5LYJ A;  4DYL A;  3IGA C;  1WPX A;  4MVQ A;  3JD4 A;  5FNV A;  4EFE A;  1M5I A;  4P9P A;  4LH7 A;  3ZBH A;  1AJQ A;  3E8F A;  4DR3 O;  2PUS A;  1R6T A;  2BCC H;  3K5L A;  4LWS A;  4X8A A;  4BIZ A;  1K9M W;  3ABL B;  3CRR A;  5CN0 A;  4DUY O;  1S72 V;  4B08 A;  1IX9 A;  1MAB G;  1FFX A;  2VRZ A;  2YS8 A;  2FML A;  1P7G A;  4XDL A;  4NXM O;  2KQX A;  4K3A A;  1GN2 A;  1CEZ A;  1GMG A;  3SR2 C;  2ZD9 A;  1OCO C;  3JSN A;  1NZ6 A;  1I7F A;  2E3C A;  4JI7 B;  5HFL A;  2YSU B;  4YY3 O;  3G6B A;  2D2C B;  2EIM C;  3W7T A;  2GDS A;  1M57 B;  5L3D A;  3ABT A;  4TUY B;  3S3W A;  5J9P C;  2CAZ C;  1HP8 A;  3UKM A;  2XND G;  2PI5 A;  3EFF K;  3ZHR A;  1YXB A;  1Y76 A;  5TIS Z;  2JVD A;  4PI2 A;  1RP3 B;  1SRY A;  1N4C A;  3MD0 A;  1KUQ A;  1FXK B;  2JGD B;  2EIN B;  2JGU A;  2UUC B;  2YEV A;  3VQY A;  2LW1 A;  1XIL A;  1VEW A;  2Y69 B;  3A2F A;  3N27 A;  1N0J A;  1AJN A;  4BW9 A;  3EVK A;  4J9Y B;  2ZE6 A;  4IYI A;  4NB5 A;  4DUZ B;  1L1F A;  3RYH A;  1XMQ O;  5GON B;  2EZP A;  3FB6 C;  5CA1 B;  4JI6 B;  2IH1 C;  1GO3 F;  5B1B B;  2W0X A;  3ETD A;  4DRX B;  3OTO O;  4LFA B;  1VQL V;  3JAK B;  2WLJ A;  4UV8 A;  2WLN A;  3HKB A;  4H37 A;  4UCT A;  4O2B A;  4NTX A;  1YDX A;  4FK5 C;  5GTI Z;  3QG5 A;  5B3S C;  3B2E E;  4EB6 B;  5JVD B;  3LSQ A;  5IYZ B;  4KP4 A;  2ITC C;  5KAF Z;  4MVZ A;  2KKW A;  3WB0 A;  2NN4 A;  2WLI A;  4YIO A;  3M8A A;  1IBL O;  1HDJ A;  1R3K C;  3AG2 C;  2FYU H;  1Q5O A;  2DYR B;  5A2Q N;  2UUA O;  2CH7 A;  3OUF A;  2QWN B;  1RPR A;  3RWR D;  4JI5 B;  1FFT B;  1FJG O;  1JNB A;  1SET A;  3FKS G;  1B04 A;  3E83 A;  1OCC C;  4JAV A;  4JYY A;  4ZI7 B;  3QNE A;  5BR8 B;  1H2N A;  1NVP B;  2YIB A;  3AG4 B;  4J41 A;  4LF6 O;  2A79 B;  1QLE C;  1OCC B;  4FM1 A;  1MSW D;  2D3O W;  3ZX6 A;  3T1H O;  3WB2 A;  1XNR O;  2KB1 A;  1HNW B;  4GX1 A;  4TQF A;  1XNQ O;  2LGW A;  1SQF A;  2UUB O;  4TWK A;  4BAY A;  2UXB B;  4Z1V A;  2PF4 E;  1WAZ A;  3L74 H;  2WAM A;  4I0X B;  2XOK G;  1HNX B;  4PDL A;  2PYL A;  4ZBM A;  2HHH B;  1Q43 A;  3RVZ A;  4YJ3 B;  3K59 A;  3LDD A;  4JTC B;  4NR1 A;  1Z2G A;  5IJ9 B;  4F6R A;  5J2U A;  3QO5 A;  2M7W A;  2Q68 A;  5LBQ A;  1BQ0 A;  1TVK A;  1KMI Z;  1GK9 A;  4HNA B;  1VAR A;  5JQG B;  4PDR A;  4FMT A;  3JD0 A;  2Z5U A;  4JI1 B;  2UU9 B;  5DM6 V;  1HNZ B;  2P90 A;  1XL6 A;  1MNG A;  3K9A A;  4MVM A;  5EZY B;  1G4Y B;  5J2T A;  5IWA B;  2C2A A;  5H6Q A;  3IJ4 A;  4C7U A;  2WWW A;  4RWU A;  3PJS K;  3UM7 A;  1N34 B;  1WN7 A;  3SJQ C;  4ZKI A;  3AG3 B;  1ZUQ A;  1VF6 A;  2AHY A;  1BE3 H;  5IYD O;  5BMV A;  4DR2 B;  1XMO O;  4LFB B;  3AG1 C;  1S5L Z;  4JYA B;  2Q69 A;  2QWQ B;  2YIB D;  2RN9 A;  4J7J A;  2VQE B;  1UPG A;  5FL7 G;  2Q0A A;  1OZ0 A;  3W7W A;  3RFR A;  2G38 A;  1R1B A;  4DR6 O;  4UFZ A;  3CC7 V;  4O4J A;  4JTD B;  4QGP A;  4OX9 B;  1O9H A;  4DV1 B;  1ZL8 B;  3ZMZ A;  5EBW C;  1K33 A;  5B1N A;  4X9Q A;  3AEI A;  1ROP A;  3OGI B;  2FB5 A;  3RGB A;  5EYP B;  1COW G;  3JAR B;  1JA8 A;  2IM9 A;  3CCE V;  1MOF A;  2E76 B;  5KUK A;  1YEW A;  1LUV A;  1FS0 G;  4LF5 O;  4JI3 B;  5LP6 B;  4P30 A;  3CCJ V;  3GWO A;  4DV7 O;  5KA6 A;  2WLH A;  1IBM O;  4O2A A;  2R9R B;  2YXL A;  2QM4 A;  5IDJ A;  3NR7 A;  2ZM6 B;  3BRC A;  5C8Y A;  4JI4 B;  5K1P A;  4BR6 A;  2UXC B;  1RFY A;  3FFQ A;  4PA6 A;  2OCC B;  2CE4 A;  1NVP D;  3H1K H;  3RYC A;  1SZX A;  4FIP C;  3E8G A;  3LSS A;  5CBH A;  4DR1 O;  1QVG U;  2L6L A;  2VQF O;  2JJ2 G;  4DR7 B;  1QBZ A;  1Q6U A;  4MSW C;  4J80 A;  3CC4 V;  2QKS A;  1YVW A;  1J5E O;  3BA9 A;  4JAA A;  3EXA A;  4L8J A;  4JI0 B;  3K58 A;  5IJ0 A;  1PPJ H;  1W59 A;  1EFR G;  1E79 G;  4X66 O;  1QLN A;  2RJZ A;  2YDE A;  2QEX V;  1OJH A;  3E22 A;  5LHH A;  4IHJ B;  4MT8 A;  2QKA A;  2F43 G;  3CXH F;  2BOB C;  4LF8 B;  1TUE B;  5KA5 A;  1R73 A;  1Q90 D;  4MVR A;  4YJ2 A;  4B3S B;  1PM9 A;  2ZR2 A;  3ZN1 A;  4PD4 F;  3T2M A;  3RBZ A;  4JI2 B;  4Z2W A;  3L73 H;  4X20 B;  4K35 A;  2O57 A;  3KZI Z;  1I08 A;  2WSS G;  3STZ C;  5KHG A;  5L3F A;  1VMG A;  2RMK B;  3HKC A;  1K3E A;  1JPX A;  2LO1 A;  1YCI A;  3A0R A;  2UXD O;  1WB8 A;  1AB3 A;  4W4K A;  2XTA A;  4JZG A;  2VWK A;  4I50 A;  4JYB A;  2E5L O;  3CYO A;  4WCE V;  5LOV B;  2ETN A;  5LMN O;  3IAY A;  4JTA B;  2WLL A;  1JQ0 A;  3NXS A;  1PKX A;  4O4L A;  3B09 A;  1GM9 A;  4FFB A;  1DF5 A;  2HVJ C;  2F4V O;  2A06 H;  1Y67 A;  4LF7 O;  2JS3 A;  4NXM B;  2BSK A;  3N2K B;  3D8C A;  1Y74 B;  4IIJ B;  2RDC A;  5CA0 B;  4DW1 A;  3CHX A;  2EIJ C;  1CP9 A;  1RSO B;  4X89 A;  1YJ9 V;  3ZN0 A;  4UXN A;  1HWY A;  3UO2 A;  4PA4 A;  2V1D A;  1VQP V;  1JJ2 U;  4YY3 B;  1X59 A;  3UT5 B;  3TCU A;  2IW5 A;  1X4T A;  1K34 A;  4YXW G;  5EBL C;  4UVB A;  1A32 A;  5HFM A;  4K8Z A;  3UO3 A;  1SKV A;  1Q8I A;  4FLT A;  3ZHS A;  4I55 A;  2QKC A;  2Q4P A;  2HJD A;  2P7T C;  5KX5 B;  3ZHQ A;  5B1A C;  3ASO C;  4ABM A;  3BFR A;  1LUW A;  3E2E A;  1VP7 A;  4DR5 O;  4FM2 A;  1NTZ H;  4OPH A;  2F1M A;  3ZHU A;  5FNV B;  2XUM A;  3VBB A;  1F51 A;  3FX7 A;  1GN6 A;  1KP2 A;  4ZOL B;  3ABM B;  2LFR A;  2PGG A;  1BQZ A;  1DGS A;  3ETQ A;  4RUF A;  1XMQ B;  3T4D A;  4DV5 O;  2CGO A;  3MDS A;  2N04 A;  1XI1 A;  2HR3 A;  3CCV V;  1AI4 A;  3ZMU A;  1PD3 A;  1FFX B;  5JCO A;  2Q7H A;  3OTO B;  3DXR A;  4WFH A;  4MVS A;  3JAS A;  4YIP A;  1OCR B;  3ABU A;  1H8H G;  1TUB B;  1B6Q A;  3HKD A;  4I7Z B;  1XL4 A;  2CDY A;  5DEC A;  3A8T A;  5EIB C;  1M1K W;  4JZ2 A;  4CS2 A;  3ABL C;  1IBK O;  1IBL B;  1SS3 A;  2RQ6 A;  1G8M A;  2KG7 A;  2WA4 A;  2X6A A;  2UUA B;  4BIO A;  5BZB A;  1KB9 F;  1WPB A;  3LUT B;  1FJG B;  3IC7 A;  1UJW B;  4P9O A;  3RYF A;  4O4I B;  3FB8 C;  1L8D A;  4FLU A;  4UUJ C;  3TK1 A;  1VQ8 V;  3PN1 A;  3I5D A;  3CC2 V;  4O4H A;  1M57 C;  2YEV B;  4U3F H;  1BSM A;  5L3G A;  2DYS B;  5LA6 A;  4PA7 A;  4LF6 B;  4MVU A;  2B5U A;  4DK0 A;  3CRQ A;  4E2L A;  2OIG A;  1WA8 A;  3T1Y O;  2LQT A;  2P67 A;  2ADQ B;  3T1H B;  1FPO A;  1XNR B;  3P32 A;  4LF4 O;  4WFB V;  3LNN A;  3RVY A;  1YF2 A;  3W7X A;  3J81 N;  4TQD A;  1FXK C;  1XNQ B;  3X2Q B;  4BIU A;  2UUB B;  1DTO A;  2EIN C;  2MW2 B;  2UXN A;  3CJH A;  2BTQ A;  1EN6 A;  2EJ7 A;  3K04 A;  4O2B B;  3LSU A;  2Y69 C;  3CWB H;  1GKF A;  4EFB A;  5LHG A;  4JF3 A;  1MZE A;  2ZXW B;  3D36 A;  3BCC H;  3JD1 A;  5H9C A;  2N74 A;  1XHX A;  4TT3 G;  3HB3 B;  2WLI B;  1S77 D;  4XBF A;  5B1B C;  2QE7 G;  4A5U B;  4GZR B;  1BS3 A;  2CH7 B;  3UQ8 A;  2LGQ A;  1US6 A;  3H1J H;  4J9Z B;  4R7C A;  1OV9 A;  1YI2 V;  4GKK O;  2PZS A;  3Q4H A;  3CCL V;  2V4D A;  4FLY A;  4ZHQ B;  3RYI A;  3TET A;  1E1Q G;  2PTM A;  4LCU C;  5CB4 A;  2QM7 A;  4H0L B;  2L35 A;  3WU2 Z;  5KHK A;  3M7M X;  4UVA A;  1KKC A;  4X62 B;  2DYR C;  3P3P A;  3JAL A;  1EN4 A;  1NR1 A;  2Y48 A;  4YHH O;  3B77 A;  1Q81 W;  1PNL A;  3ZRS A;  1XMO B;  4TUY A;  1XEQ A;  2ZKO A;  3VQV A;  4I4T A;  1NH2 D;  3J7A U;  1U96 A;  4LR3 A;  3WFV A;  2OTL V;  1YTF B;  3ZRW B;  1TA8 A;  1VQ6 V;  5L3E A;  2QTO A;  1ZSP A;  2R70 A;  3AG4 C;  3B40 A;  4LNU B;  4MW8 A;  4TV8 B;  4DR6 B;  4DW0 A;  2JGD A;  2QWO B;  3IFX A;  3HPL C;  2DQ3 A;  3VOU A;  4QPJ A;  2QGN A;  1KEC A;  1S5H C;  1FKA O;  3ML0 A;  4F6R B;  2DN9 A;  1EM1 A;  3OAA G;  1BL8 A;  5CMU A;  5J2U B;  1GM7 A;  3ZMT A;  3CPW U;  4JAS A;  1BHB A;  4R6Z A;  4IYH A;  2ARH A;  4KL1 A;  1FXH A;  2Q9L A;  1EZJ A;  4NXN B;  4X1Y A;  3OEH G;  2B9Z A;  2H8P C;  4PHZ A;  3TXS A;  2JIZ G;  5CA1 A;  5F2V O;  2HEP A;  1M90 W;  3JAT B;  5EC1 C;  3THO A;  1RM1 B;  4LF5 B;  4UCO A;  2IJK A;  2Z0A A;  5EBM C;  5J2T B;  4DV7 B;  1SA0 A;  4Z1M G;  1WB7 A;  1IBM B;  5EIB D;  5KAI Z;  3OR7 C;  4ZIB A;  3KCY A;  4EB6 A;  5LXT B;  2P5O A;  2JEU A;  5IYZ A;  1RPO A;  4OGQ B;  5BMV B;  5ITZ A;  4AQY O;  1V54 B;  2WA3 A;  4HYO A;  4UV9 A;  4X1K B;  1QR8 A;  2ITD C;  3CCR V;  2OTJ V;  3SYA A;  1B06 A;  4DR1 B;  4X64 O;  3WG7 B;  1Q82 W;  3MAQ A;  2MK3 A;  2QSA A;  3SPC A;  2VQF B;  3SYO A;  4CH3 A;  4ZI7 A;  4DR4 O;  2ZIO A;  1SQB H;  4MVO A;  3AG3 C;  3P30 A;  1I5X A;  1J5E B;  2EIK B;  2B1G A;  3QO8 A;  5GTH Z;  2ZCE A;  4X66 B;  1MMM A;  5CBG A;  1H5W A;  4FZ0 A;  4U3J A;  2CTR A;  1QU7 A;  4QE7 A;  2P6J A;  4KHP O;  4GLX A;  3CB2 A;  4R50 A;  3SPH A;  1SQQ H;  4DV3 O;  2IJI A;  2AHZ A;  2CK3 G;  4F6E A;  4WFA V;  3CS5 A;  1U97 A;  1J95 A;  4L87 A;  3ZMS A;  4D7S A;  3FD9 A;  2KSD A;  2DJV A;  1AR5 A;  2K1E A;  4U7O A;  4I0X A;  1OCZ B;  2QM8 A;  4G28 B;  4WBN A;  4AI8 A;  1S3J A;  2F66 C;  1SQP H;  2X7R B;  4P2Z A;  1AVM A;  4PJ0 Z;  4YJ3 A;  2GUZ B;  2Y4T A;  2V7Q G;  5L3B A;  3R66 A;  3RN4 A;  5IJ9 A;  4FLW A;  1KD1 W;  1SZT A;  1NBM G;  3L9D A;  4PI0 A;  4QIW F;  2UXD B;  2PY5 A;  5LP6 C;  1M93 A;  2E5L B;  4I9Q A;  1ARO P;  4HNA A;  4CH5 A;  4K0K O;  4I9W A;  3U10 A;  3R65 A;  1N33 O;  5LMN B;  4JPR A;  5LGN A;  5KMG A;  1HW7 A;  3M99 B;  1D5N A;  1R6N A;  4TV9 A;  3DGE A;  4IGG A;  1SQX H;  1GN4 A;  2F4V B;  1Q3E A;  2CUG A;  2OCC C;  1N32 O;  4LF7 B;  4DV0 O;  1BT8 A;  1NU1 H;  3ASN B;  1YJW V;  1SQG A;  3E22 B;  4MW3 A;  1PL4 A;  2ZE8 A;  2HP8 A;  3APO A;  3CEI A;  1YSC A;  1D2D A;  3CCM V;  4B3M O;  2ADP A;  2Y0P A;  1XBL A;  3OMN B;  1AI5 A;  3JCU Z;  4YJ2 B;  4B3T O;  2F93 B;  1FD9 A;  1QVF U;  1R3J C;  4WF9 V;  1I5Y A;  1NJI W;  3KG2 A;  3LNM B;  2Q8V A;  3OTF A;  2XAQ A;  3ICX A;  4R8C A;  2OCH A;  3JYC A;  2OIE A;  3A0H Z;  5IY5 B;  4FLX A;  2YXY A;  4DR5 B;  2FTK A;  4MTO A;  3HKC B;  3BVO A;  3KCX A;  4DO2 A;  2EIL B;  3G71 V;  1XRE A;  1ZL8 A;  4J42 A;  3LDE A;  1M56 B;  1YZB A;  3QO7 A;  4QE9 A;  3SPG A;  2R72 A;  2UXX A;  1R6K A;  1K4D C;  2PI4 A;  3T1C A;  3OD4 A;  2WLL B;  5KHH A;  5LP6 A;  3ETE A;  2GSM B;  4DV5 B;  3CD6 V;  2H3O A;  2OT5 A;  4D6T H;  1VF5 B;  2YI9 A;  1V55 B;  4FLV A;  1PL0 A;  1Y6X A;  2A9H A;  2IH3 C;  1VQ9 V;  1VQK V;  1EN5 A;  5IYC O;  2GTA A;  1N36 O;  1JOY A;  3E86 A;  4GUN A;  3J80 N;  1AI6 A;  1FXV A;  2B1I A;  4DV6 O;  3FB7 C;  1EBO A;  1Y4M A;  3ZIA G;  4JGS A;  1IBK B;  4HAM A;  1IJG A;  4GCZ A;  4PEL A;  2ATK C;  4DR3 B;  3A0B Z;  4MTF A;  1BHA A;  4GKJ O;  5L3C A;  1G6U A;  3CP1 A;  4H13 B;  1KU9 A;  2BOC C;  1VF7 A;  3L71 H;  4DUY B;  3RT3 C;  4J11 A;  2XHB A;  4X1I B;  2RNB A;  3L70 H;  2YXH A;  2LFS A;  4IHJ A;  5C93 A;  1I94 O;  3OFN G;  3N2G A;  3GVM A;  3QVN A;  4HZ3 A;  5AG2 A;  3T1Y B;  4H44 B;  4PA3 A;  4B7K A;  3L72 H;  4W4L A;  4PDM A;  1P84 F;  4LF4 B;  3ZS8 C;  4CZZ A;  3ZJZ A;  3JAW A;  3HKE A;  3SPJ A;  2ZM6 O;  1GN3 A;  3BAA A;  4J10 A;  4JI4 O;  1CPY A;  4RQE A;  5GW7 A;  5E79 Z;  1IXB A;  1UFI A;  1PV0 A;  3ABM C;  4PDV A;  4DK1 A;  1H2G A;  2VWJ A;  2YID A;  1THZ A;  3HKD B;  3FAV A;  4B3R O;  2P22 C;  1K4C C;  3G67 A;  4K8X A;  5LYJ B;  4DXW A;  2XT9 A;  1VIB A;  3SYC A;  2DWE C;  4CS4 A;  4I5S A;  5LOV A;  1VQ5 V;  2KG7 B;  3AK3 A;  1P4R A;  4FLZ A;  3HR0 A;  1Y66 A;  2FL4 A;  3ZHT A;  3B4S A;  2DOS A;  1OCR C;  4GYC B;  5JH7 A;  3RYF B;  4GKK B;  4LWS B;  2ZQM A;  4PV1 B;  2DWD C;  2QJ1 A;  2AZ0 A;  1JVM A;  2HKO A;  2XAH A;  1XQ8 A;  1NKD A;  5JJJ B;  3ZED A;  4DV4 O;  2OWO A;  5B5E Z;  1GH6 A;  1F4N A;  1WA8 B;  1WLE A;  3UCS C;  3UT5 A;  4YHH B;  3TXQ A;  2GV9 A;  2X0L A;  2R9I A;  4AHC A;  1WJZ A;  5H5N A;  1KC8 W;  3ABK B;  5EK0 A;  2Q7G A;  5H2F Z;  2XAG A;  3K03 A;  4CS3 A;  4UVC A;  1BMF G;  2IJH A;  3F5T A;  4MS2 A;  3MHH C;  3VQX A;  2NR5 A;  5KX5 A;  3OMA B;  1Q6I A;  5IYB O;  2DYS C;  1Y76 B;  4J7K A;  1N8R W;  2ZIN A;  1AJP A;  1QCE A;  1SQV H;  1JFF A;  1JJO A;  4RQF A;  3SYQ A;  2HLD G;  4ZOL A;  4RUE A;  1F4M A;  1P49 A;  3SJC C;  3STL C;  4JYC A;  2JRI A;  4H33 A;  3X2Q C;  1AI7 A;  1YIT V;  2AGA A;  4CH6 A;  3H1I H;  3O9O A;  4JAU A;  1KKD A;  5LMU O;  1CXZ B;  3RYH B;  3Q4H B;  2ZXW C;  3G80 A;  1JR9 A;  3RYI B;  4LF9 O;  3FB5 C;  4Q6G A;  4X88 A;  5CB4 B;  3HKB B;  4B7E A;  2HG5 C;  4E4E A;  3BA8 A;  3BHP A;  1TUB A;  1SF9 A;  3JAL B;  1LR1 A;  1FOU A;  2Q7E A;  1QHT A;  3JD3 A;  1URF A;  1JCH A;  2ZE7 A;  4AQY B;  2QTS A;  5DED A;  1EZV H;  5IE9 A;  2YUA A;  4ASU G;  4I4T B;  3S3X A;  4UB8 Z;  1MSD A;  4D7T A;  1OCO B;  5BXZ A;  1MZF A;  1H38 A;  4X64 B;  2JEX A;  2ZNI A;  1SER A;  2EIM B;  1VQN V;  4DR4 B;  4O4I A;  1NTM H;  4JV5 O;  1W0K G;  4TSF G;  4KFM A;  3G4S V;  1VQ4 V;  1NR7 A;  3OEE G;  4FM0 A;  4FVM A;  4JI8 O;  3K79 A;  4CBC A;  1ZWI C;  1PP9 H;  2Q73 A;  4WFF A;  1M9N A;  4DV2 O;  4LFC O;  2WLK A;  1L0L H;  4KHP B;  1R3I C;  4X1Y B;  2DMX A;  3OR6 C;  4DV3 B;  3EHB B;  3CXC U;  3BAB A;  5LL6 Y;  4G2K A;  4TOI A;  4OPA A;  3H1H H;  1B3Q A;  3ETG A;  2X6B A;  3U0Z A;  1HR0 O;  3DTU B;  1SA0 B;  4QJF B;  4X65 O;  1VQO V;  1Q86 W;  4IL6 Z;  4J7Z A;  5KUM A;  1ENV A;  1XDC A;  2CTP A;  3D3Q A;  3B8N A;  1FXK A;  2E74 B;  3CMA V;  1BZK A;  5ITZ B;  2A0L A;  2HVK C;  1D5A A;  1RM1 C;  1F23 A;  5B3S B;  1N0N A;  2LP7 A;  5D5P A;  3GWK C;  2Z3Y A;  1TVK B;  4K0K B;  4FZ1 A;  4UCU A;  1DF4 A;  4UCV A;  3DSQ A;  1N33 B;  5GON A;  3K0G A;  3GB7 C;  2Q67 A;  4ZHQ A;  2Y0I A;  1VF6 C;  3AG2 B;  4MTX A;  3K3W A;  4DRX A;  5DN6 G;  5B66 Z;  3JAK A;  3OM3 B;  3SGI A;  1V54 C;  2XAJ A;  1N32 B;  1I0H A;  1AR4 A;  4DV0 B;  4GX0 A;  3SPI A;  2A3Q A;  4WFE A;  4U3J B;  3CME V;  4JI7 O;  1NI8 A;  1BCC H;  5JVD A;  3WG7 C;  3VQW A;  3K5N A;  1OHH G;  3K06 A;  4Q20 A;  4B3M B;  1Z5V A;  3ZRV A;  2HFE C;  4B3T B;  2EBO A;  2LJ2 A;  3C3S A;  3BEH A;  3U11 A;  3ZRW A;  2EIK C;  1QLE B;  2N05 A;  3LDC A;  3C3T A;  3H01 A;  4GT1 A;  2QR4 A;  4LNU A;  1YIJ V;  4TV8 A;  4WBN B;  2DW4 A;  3K57 A;  4O4J B;  1FYJ A;  5FLX N;  2A7W A;  3AG7 A;  2UUC O;  4KUM A;  2IU3 A;  4F4L A;  2ZE5 A;  1O9G A;  4NTW A;  5B1O A;  1LNQ A;  4DUZ O;  1Q6H A;  1OCZ C;  3JAT A;  5KMG B;  4JI6 O;  4OXS A;  4TV9 B;  3OUS A;  3WB1 A;  2R9A A;  4N21 A;  4LFA O;  1M4U A;  5LHI A;  4X62 O;  4O2A B;  4QPK A;  1IXM A;  3JSL A;  2PYJ A;  4GX5 A;  3TGU H;  3F7V C;  5LXT A;  1Q7Y W;  3G6E V;  5KLV H;  1N36 B;  1TGO A;  5C8Y B;  1AR1 B;  2E75 B;  3E8H A;  2ZDI C;  4QNH B;  4DV6 B;  4X1K A;  2EZO A;  2QWP B;  1SC5 B;  3DC5 A;  4BWA A;  3RYC B;  4CC5 A;  1H8E G;  4G27 B;  3K9S A;  2CGN A;  1AP6 A;  1SES A;  4BW5 A;  4JI5 O;  3OGC C;  1T5E A;  1KQS U;  2GHY A;  5JQG A;  3ASN C;  1K73 W;  1GRJ A;  3K0D A;  3AG1 B;  4GX2 A;  3W7S A;  4GKJ B;  5FPO A;  3ZRX A;  4LP8 A;  2P4V A;  5EZY A;  5BR8 O;  1Z5W A;  3E35 A;  4LBE C;  3BY6 A;  1YTF D;  1W0J G;  4NTY A;  2F95 B;  5A9G A;  2EJR A;  3SJB C;  3QTC A;  3L75 H;  5IJ0 B;  2IBZ H;  3ZMV A;  4NXN O;  1I94 B;  4FFK A;  1BGY H;  4LC1 A;  1QNM A;  3F5W C;  3OW2 U;  3E8B A;  5FPR A;  3K5O A;  5H6R A;  4NVP A;  1K5S A;  2DE0 X;  1HNW O;  1JMK C;  2ILM A;  5IY5 C;  4CC6 A;  2Q6A A;  1S0V A;  3CRC A;  2UXB O;  2RCV A;  1MA1 A;  2EIL C;  3QF7 A;  3CE2 A;  1M56 C;  1HNX O;  1K8A W;  3CCS V;  3E89 A;  2GUZ A;  2EX3 A;  3W7U A;  2HHH O;  5JWP A;  3KDR A;  2GTS A;  2P4K A;  4B3R B;  1XHZ A;  1GM8 A;  5JJE B;  2P06 A;  2Y4U A;  1W2B U;  5CA3 A;  4I50 B;  1V55 C;  3CCU V;  2AXT Z;  3O65 A;  2ZDI A;  4XDK A;  5EYP A;  4RO2 A;  3JAR A;  2IJJ A;  4JI1 O;  2UU9 O;  1HNZ O;  2CTQ A;  1H2S B;  1MG1 A;  2ZNJ A;  2ZIM A;  2M6Y A;  4O4L B;  2LW7 A;  2OYQ A;  4FFB B;  5IWA O;  1KP3 A;  2F23 A;  2Q0O C;  3P3N A;  4U7N A;  3JD2 A;  1PNK A;  2JDI G;  1N34 O;  2BSK B;  4IT5 A;  2W6J G;  3MHS C;  1DLB A;  3OT7 A;  1ZX3 A;  3N2G B;  2WLM A;  3CRA A;  4UCR A;  1AIL A;  4DV4 B;  2GBO A;  4UB6 Z;  3D3I A;  4DR2 O;  4LFB O;  5IT9 N;  2QDO A;  2NLJ C;  4JYA O;  5K1X A;  1IZ3 A;  2VQE O;  3B8M A;  2FKX A;  3JCZ A;  4RAI A;  3OE7 G;  3JAW B;  3HKE B;  3KKY A;  1R3L C;  1PNM A;  1AP5 A;  1G1X B;  4I55 B;  3H9V A;  3SJA C;  2ZT9 B;  1WNS A;  1XOU A;  2W6I G;  2YC0 A;  1IUR A;  1K7D A;  4XDJ A;  4OX9 O;  3FAV B;  3F7Y C;  4DV1 O;  2EUL A;  4NYK A;  2AZ2 A;  3JAM N;  1L0N H;  5EC2 C;  2W0F C;  3DC6 A;  1F7Y A;  4EKW A;  5E1A C;  4CH4 A;  3SDL A;  5JCO C;  1S5J A;  1NT2 B;  1H2K A;  3TJT A;  1NTK H;  1E1R G;  1ORQ C;  2QWR B;  4FJC C;  3FYE B;  2YIC A;  2K9P A;  3K08 A;  4EEQ A;  3CRM A;  1FAF A;  2BTO A;  5LMU B;  2BE3 A;  4JI3 O;  5JH7 B;  2ODM A;  1K92 A;  3ZCC A;  4ICG A;  3K5M A;  5CBF A;  4LF9 B;  5KHJ A;  3I56 V;  1V9P A;  3H1L H;  4X20 A;  1K5Q A;  1QQC A;  3DXR B;  2IU0 A;  1H2L A;  1S76 D;  5BY1 A;  4HBN A;  3JAS B;  1K97 A;  2UXC O;  2WPD G;  3RW0 A;  5D5Q A;  4MTG A; 
#chains in the Genus database with same CATH homology
 3AK2 A;  2CDY A;  1D5N A;  2CE4 A;  1MNG A;  1IX9 A;  1GN4 A;  4JZ2 A;  4YIO A;  1SZX A;  3DC5 A;  1Y67 A;  1P7G A;  3K9S A;  1MSD A;  1BT8 A;  1GN2 A;  1I0H A;  1AR4 A;  1B06 A;  1AP6 A;  4C7U A;  1KKC A;  3OT7 A;  1PL4 A;  1ZUQ A;  1EN4 A;  3CEI A;  4JYY A;  2ADP A;  2GDS A;  3AK1 A;  5A9G A;  3C3S A;  1MMM A;  1BSM A;  3C3T A;  3KKY A;  4FFK A;  2QKC A;  1ZSP A;  1AP5 A;  2QKA A;  3QVN A;  1ZTE A;  3BFR A;  1IDS A;  5AG2 A;  1LUW A;  1QNM A;  2ADQ B;  4F6E A;  1PM9 A;  1XRE A;  1ZLZ A;  1GN6 A;  1EM1 A;  1XUQ A;  1XIL A;  1VEW A;  3DC6 A;  2RCV A;  1MA1 A;  1AR5 A;  1EN6 A;  1N0J A;  3EVK A;  1GN3 A;  3LSU A;  1I08 A;  2AW9 A;  4X9Q A;  1IXB A;  1XDC A;  3TJT A;  1JA8 A;  1AVM A;  3IC9 A;  1LUV A;  3KDR A;  3MDS A;  3RN4 A;  2P4K A;  1WB8 A;  1JR9 A;  4JZG A;  1WB7 A;  1N0N A;  3AK3 A;  1EN5 A;  1BS3 A;  4YIP A;  4E4E A;  1VAR A;  4BR6 A;  4GUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...