1WB8A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
b'IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [FE]
publication title Iron Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus: Analysis of Structure and Thermostability
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 75
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb8A02
1GN6A 1EM1A 1B06A 3BFRA 4JZ2A 1I0HA 1LUVA 1VARA 3QVNA 3MDSA 1BS3A 1EN5A 3EVKA 3CEIA 1GN3A 4F6EA 1IXBA 4YIOA 5AG2A 1PL4A 2ADQB 1EN4A 3AK2A 2AW9A 3C3SA 1GN2A 2ADPA 1MNGA 4BR6A 3AK1A 1XDCA 2RCVA 3AK3A 1KKCA 1ZSPA 2QKCA 4YIPA 1XILA 1AP5A 3K9SA 1BSMA 1ZUQA 1ZLZA 1AVMA 1VEWA 1MMMA 4JZGA 3TJTA 2P4KA 1XUQA 1SZXA 1IX9A 1MSDA 1Y67A 3RN4A 2CE4A 1ZTEA 5A9GA 4X9QA 2CDYA 1JA8A 3DC6A 4E4EA 1D5NA 1LUWA 1N0NA 3DC5A 1P7GA 1GN4A 2GDSA 3IC9A 1IDSA 4GUNA 1EN6A 1AR4A 4FFKA 3KKYA 3OT7A 1JR9A 1XREA 3C3TA 1MA1A 1N0JA 1AR5A 1BT8A 1I08A 4JYYA 1QNMA 2QKAA 4C7UA 3LSUA 1PM9A 1WB7A 1WB8A 1AP6A
chains in the Genus database with same CATH superfamily
5BXZA 1B6QA 3ZMZA 2Q68A 2P90A 2VQFB 3CMAV 4I4TB 2YUAA 1NTMH 4CH6A 5E1AC 4A5UB 4E2LA 2R9AA 5ITZA 2VRZA 4R8CA 3ZHTA 5GONB 5LYJB 5KHGA 4LNUA 5LOVA 2AZ0A 1Y76A 2BTOA 1YTFD 1TUBB 1E1RG 2Q6AA 4B08A 3CC4V 1VIBA 2UXDO 2HP8A 2YIAA 4XBFA 2ZNJA 2XAHA 5BMVB 4CS3A 2CTPA 1GM9A 2IU0A 5IY5B 2ODMA 3E83A 3AK1A 2NNUA 3E8GA 3ABMB 3A2FA 4CC5A 5KHKA 2QSAA 1PL0A 1LR1A 2CGNA 3ZN1A 5IYDO 3SJAC 2IJJA 1ZLZA 1H2KA 4DV4B 1QVGU 3H1IH 4JZGA 5KHIA 4GCZA 3JALB 1MSDA 1Y67A 4B3MO 3A0BZ 4TQDA 2ZE5A 1H38A 4HZ3A 3LDEA 4LH7A 1J5EO 2UXCB 1VQ7V 4LH6A 1XHXA 1VQ8V 3UO3A 4WBNB 3CE2A 1IDSA 4ICGA 5EIBD 4Q6GA 3J81N 4YJ3B 2OIGA 2DWEC 4O4LA 4TOIA 4FFBA 2YI8A 1IVSA 4LF6B 1DLBA 2LP7A 4QE7A 1I94O 4JI1O 5B5EZ 4GKKO 3UQ8A 3OGIB 3SYPA 1M93A 4EKWA 2LW7A 2PYLA 3OEEG 4GYCB 4NXMB 1PM9A 5KUMA 1F4MA 3CRRA 3OFNG 1EM1A 4D7TA 2UUAB 3CJHA 1I7FA 1SS3A 3L75H 3E8BA 5IYBO 1XNQB 1S5LZ 2EIKC 3CCQV 3ASOB 2XUMA 3BRCA 1SESA 3HKBA 3HKEB 2YIBA 1FFXA 2GTSA 1VQOV 4X66O 5JVDB 3KCXA 2C2AA 1PD3A 2F93B 2ZXWC 2UUBO 4O4IA 4X88A 1QVFU 2IJKA 5H6RA 2JRIA 2GHYA 2DWDC 2HJFC 4GZRB 4TUYB 2BCCH 3D8CA 2DW4A 5KLVH 2P06A 4KHPB 5B3SC 3L74H 3LSSA 3BVOA 5JCOA 4DR4O 4JI0B 3BA9A 4JYBA 2XAFA 3K5OA 3B2EE 1JA8A 2ZE8A 4LR3A 4IIJB 3NXSA 4FZ1A 3C90A 1JVMA 1CP9A 1PV0A 1NVPD 3KDRA 4JI4O 4JI6O 1SRYA 4FLWA 3MHHC 4YY3O 2KKWA 1NR1A 1M56B 2Z3YA 3L73H 1US6A 4LBEC 1H2MA 4FK5C 1YIJV 1R6TA 3K0GA 1SC5B 4PDRA 1S76D 2E5LB 1M5IA 3TGUH 1NZ6A 4UCUA 3A8TA 5JJEB 4X65B 2CUGA 2EX3A 4D7SA 4H13B 1H8HG 3H1JH 1TVKB 4U7NA 2P7TC 2YEVA 3HKDA 3OEHG 5IJ9A 2DQ0A 2WPDG 4QGPA 2YSUB 3ZHUA 2WLJA 3F7VC 4U7OA 5CBFA 2ZIOA 3OTOB 4CH5A 1KP2A 3OR7C 1R73A 2W6JG 3F7YC 1KKDA 1VQLV 2V4DA 4TWKA 2JDIG 5EZYB 4EB6B 4MTFA 4DK1A 3ZCCA 4TQFA 1MNGA 4DV0O 2EIKB 3CCEV 1IBMB 3K79A 1KECA 1RM1B 2A3QA 5H6QA 2QTSA 4O4HB 4OPAA 2AGAA 2DN9A 1K7DA 4O2BA 4NB5A 4CZZA 2D2CB 1P49A 3JATB 1JQ0A 3AG2B 4Z1MG 2DE0X 1KMIZ 2P4KA 1XL6A 1SZXA 3ZHQA 4DR7B 3A0HZ 4DR1B 4I4TA 4KP4A 2HJDA 3KCYA 4IYIA 2MW2B 2A7WA 3HR0A 2KB1A 4I55B 4JI8B 1RFYA 4LF5B 2WA4A 3G80A 4CC6A 5LYJA 3K0DA 4NXNB 2LFRA 5B3SB 1BGYH 1DTOA 5FPRA 4J7ZA 4I9WA 3ABUA 4G28B 5J2UB 4MVQA 4H44B 1YI2V 2F43G 2E74B 3M99B 5L3EA 4Z1VA 1BMFG 3ZMUA 2PI5A 2XASA 3CMEV 1M4UA 4OGQB 4FLZA 4I50B 1WP8A 4YJ2A 3CXCU 4KXRA 5HFMA 1CPYA 1SKVA 1PNKA 4DUYO 1YHQV 1K97A 1BS3A 3JALA 3AG3C 5IYZA 3JSLA 1CEZA 1PP9H 4J9ZB 1FXKC 3PN1A 4UCRA 4DR6B 1G6UA 1BL8A 5H2FZ 2Q7EA 4WBNA 1VF6A 1E1QG 1BQZA 1YJNV 1YEWA 1GN2A 4AQYO 4P9PA 5LMNO 4YJ3A 3H1HH 3NR7A 4WFAV 3RVZA 4B3MB 3H9VA 1G4YB 4LF9O 1AB3A 2ZE7A 5K1PA 1XBLA 1J5EB 3S3XA 3L9DA 3B8NA 5LMUO 4O4LB 4FPPA 4MTXA 2YI9A 1IBLO 1W59A 2UXNA 1KU9A 4P9OA 3L71H 4MVOA 5H9CA 1I5XA 1SQXH 1M9NA 2EIMC 1NBMG 3D3QA 4WFHA 4JI1B 3G71V 5J2TB 3CPWU 3CCMV 1I94B 4GKKB 5BR8O 2PI4A 1LUWA 1ORQC 3HKEA 2WLHA 2CGOA 1H2SB 3CJHB 1D2DA 3QF7A 2GDSA 3CRCA 3ZS8C 2GV9A 2QTOA 1JMKC 1RPRA 4I5SA 5DN6G 1Q6IA 3ZHSA 3CCRV 5JVDA 3E22A 2ATKC 2ZE6A 1OCRC 1L0NH 4TSFG 1K73W 4I0XB 2ZINA 2PTMA 1AJPA 1QNMA 2EZOA 3OR6C 4TUYA 1WB7A 4ZOLA 4MW3A 2QWOB 1AR1B 1MZEA 4P2ZA 1JJOA 4X66B 1AI4A 3ETDA 5EIBC 4LF8O 4NYKA 2XAQA 2UUBB 3WB0A 1OCOB 4UVAA 2OWOA 1VF5B 2EBOA 4EFBA 4AI8A 4UV9A 3D36C 1VF7A 2PF4E 4F6EA 3ZMTA 2Q69A 3AG4C 3J80N 3SYOA 4IIJA 1GO3F 3W7SA 2FMLA 5FL7G 5FNVB 4R6ZA 1QCEA 1YJWV 2W0FC 1NKDA 4DR4B 1XMQO 2BOCC 1H8EG 1R3KC 1DF4A 2K1EA 5JJNB 1VQKV 2E5LO 3ZIAG 4X64O 4JI5O 1AP5A 4FM1A 4N23A 4KUMA 3M8AA 4DYLA 3I55V 4JF3A 4JI6B 4JI4B 2H8PC 4MVSA 3BHPA 3CP1A 4MVMA 2HLDG 4YY3B 3CC2V 2LO1A 1N36O 4TT3G 3OUFA 4DUZO 1TVKA 3T4ZA 2WAMA 2K9PA 1YTFB 1YSCA 2GTAA 4FJCC 5LGUA 5L3DA 2QM4A 4DV6B 4B3RO 2XNDG 3KKYA 4MTOA 4QNHB 2YEVB 3P30A 3ZRSA 1AJNA 4EB6A 5IJ9B 3J7AU 1JCHA 1N0JA 1BT8A 3JAWA 4FIPC 2Y0IA 4C7UA 4BIZA 1DK1A 1S5JA 3U10A 1I0HA 2Y69C 2OTLV 2W6IG 1M1KW 1VARA 1KD1W 2Q4PA 3ABLC 3JATA 4TV8A 5B1OA 3CC7V 1FYJA 1SQVH 4DR2O 2WWWA 4HAMA 1TA8A 5CA0A 3R66A 1FXVA 4FZ0A 1GK9A 1HP8A 4DRXA 3MAQA 4I55A 5LGNA 1QLEB 4YIOA 3FB5C 2EILC 4DR3O 4X62B 1Q90D 3OM3B 3CXHF 4I9QA 3CWBH 4WFGA 2HHHO 3FB8C 5KMGB 5J2UA 1Z5VA 3JD2A 3CCJV 3I5DA 1R3IC 4NVPA 3OD4A 2OCCC 4U3FH 3OE7G 2ZR3A 3AG4B 5CBGA 5LA6B 4I50A 4MTGA 5B1BC 1K8AW 3IGAC 1TAEA 4J7KA 1ZTEA 1J95A 1V54B 3AG1C 1K4CC 1V55B 1NT2B 4IYHA 1OCCC 5KUKA 4DR6O 4DO2A 4X1KB 4YJ2B 4BIUA 4CH4A 3K59A 4F6RA 3ZRWA 1AI5A 4TV9B 3OT7A 1COWG 1ZL8B 2CTWA 4WFEA 3SPJA 3H01A 3OMNB 4XDJA 5IYZB 3FAVB 2ITDC 4DUYB 1GMGA 5EC2C 4WCEV 1UPGA 2X7RB 3LSUA 3LUTB 1SQFA 1OV9A 1XOUA 1YCIA 2HR3A 1F7YA 3OGCC 1P84F 2JS5A 1NH2D 4JTAB 1UFIA 4AQYB 3GWOA 2N74A 2JK5C 1R3JC 5LMNB 2Q0AA 3B4SA 3ZMVA 3DSQA 4LF9B 4W4LA 3DXRB 2DYRB 5DM6V 5J2TA 3N2KB 3K57A 2ADQB 1NVPB 5GW7A 1EN4A 2Y69B 5LMUB 3ZEDA 1GM8A 2AW9A 3F5WC 3HPLC 3K9AA 2BE3A 1IBLB 2B5UA 5IDJA 1VQNV 3RYHB 2QWPB 2HVJC 3TXSA 4WF9V 2D3OW 3IC7A 3JSNA 2JS3A 1V9PA 2FB5A 3CHXA 1D5AA 2A79B 5BR8B 4I0XA 1XI1A 1OJHA 1A32A 5KHJA 3QO7A 2EIJC 4O2AA 1MMMA 2EILB 3EXAA 1RPOA 3E22B 2JJ2G 3RYIA 1NQTA 1GAXA 4BAYA 3HKCA 2EZPA 2YIDA 4QPJA 4EFEA 3E35A 4ZOLB 1Z5WA 4IT5A 1N0NA 1SQBH 1BE3H 4DV7B 4CS4A 1EFRG 3IC9A 3O9OA 1BHBA 2E76B 1OHHG 1EN6A 1AR4A 2X6AA 3HB3B 1Q7YW 5FNVA 2ZKOA 4UCSA 1JR9A 3VQVA 2UUCB 2HEPA 3BA8A 4LF8B 4UCOA 2FL4A 4DV3O 1Q5OA 5K1XA 3K5NA 1BCCH 4DV5O 1XMOO 1OCCB 4LF4O 4LC1A 5B1AC 1KUQA 5BY1A 1FXKA 5E79Z 1HNXO 1JOYA 3QVNA 1VMGA 2WLMA 1Y74B 3RYCA 4RWUA 2BTQB 5DECA 1XMQB 4JI2O 3WG7C 5LP6C 1FJGO 1Q86W 3Q4HB 2P4VA 3RWRD 2CH7B 4X64B 4JI5B 4DV6O 4JYCA 4HNAB 3BEHA 1MG1A 5CMUA 4UV8A 3C3SA 1GM7A 1NU1H 1R3LC 3CCSV 4K0KO 3U11A 5D5QA 3W7XA 4L8JA 1N36B 4J42A 3JAMN 3LSQA 2F1MA 4DUZB 2FYUH 3CB2A 4K8ZA 2P22C 1BSMA 3ABKC 3FFQA 1MZFA 2FKXA 3CRAA 4FLUA 1N4CA 1XUQA 5IWAO 1URFA 4B3RB 1ZAUA 2VWKA 2B1IA 2OTJV 5A9GA 4OXSA 3JAWB 3TCUA 2M6YA 3T1HO 3QNEA 2HFEC 1M57C 3B40A 1VQMV 2E3CA 4JI7O 1YF2A 2VWJA 1S72V 1GN4A 2F4VO 4NTWA 4X62O 1XNRO 4TV8B 2R72A 4GX0A 1NTZH 3UCSC 2ZXWB 3MHSC 5CA0B 1L8DA 2YICA 2IBZH 4EEQA 4DRXB 3UO2A 2ZDIC 4DR2B 3IAYA 1SERA 4JAUA 3SYCA 5KMGA 2QKAA 2KQXA 4ZHQB 3D36A 1FS0G 4OX9B 4PA3A 4UXNA 1DF5A 3U0ZA 5IJ0A 4DR3B 5L3GA 3THOA 5LA6A 1I5YA 3APQA 4FLYA 1KQSU 2HHHB 3ASNC 1FFTB 2R70A 2ZQMA 4WFFA 1JNBA 1OCZC 1WPBA 5B1AB 5H5NA 5AG2A 2L35A 2HKOA 4X1KA 1XHZA 2EINC 2Z5UA 3A0RA 1N34O 4TV9A 3G6EV 2F23A 3CRQA 1VQ6V 3T4DA 4BR6A 1FKAO 1ZL8A 2NLJC 4R50A 1S5HC 4ZIBA 3S3WA 5LP6B 2RCVA 5L3BA 3ZHVA 3FAVA 5KX5A 5IYCO 4B3SO 1ZSPA 2QKCA 4F6RB 3ZRWB 1MABG 2ZIMA 4JGSA 1K3EA 2OIEA 1HR0O 1SZTA 2IH1C 2PUSA 4PA9A 5LBQA 3LNNA 2QM8A 3B77A 3RN4A 4MT8A 3JARA 2YXHA 5GTIZ 2QKSA 3JASB 2JVDA 4U3JA 3VQWA 1TGOA 3GVMA 2YXLA 1WPXA 1Y6XA 1S77D 1D5NA 4LP8A 1WP7A 4DR5B 3D3IA 5B1NA 4GX5A 4H0LB 3DXRA 2VS0A 3JCUZ 4NTYA 3N2KA 4WFBV 3APOA 4ZBMA 2FTKA 5LXTB 2R9IA 5EK0A 4PDLA 1K5QA 1Q3EA 1PNMA 5EC1C 4DK0A 4JYYA 3SPCA 3RYHA 4JASA 2JGDB 2QM7A 1GN6A 3EHBB 4MVUA 1Q82W 3BFRA 5CB4B 2WLIB 2LGWA 4IGGA 3CYOA 3AEIA 4LFAO 5CBHA 5DEDA 5F2VO 1FXHA 2QWQB 4KL1A 2XHBA 2Q0OC 3MDSA 4JPRA 5IT9N 1JFFA 2ZT9B 1SF9A 4KFMA 5FLXN 2RNBA 2Q9LA 3TETA 1YJ9V 4I7ZB 2DYSC 4RUEA 1W0JG 4DV7O 4O2AB 2RDCA 3SGIA 3RYIB 4RAIA 2P5OA 4X89A 3HKCB 1H2NA 2UUCO 1LNQA 3B8MA 3G67A 1FPOA 2UU9O 2ZR2A 4UVBA 2QDOA 1XILA 1WA8A 5LHIA 4XDLA 2LQTA 5J9PC 1OCZB 1WN7A 3QO8A 4GLXA 4X8AA 2IU3A 1G8MA 2CE4A 4JI3O 1Y74A 2CDYA 2A9HA 2BTQA 3AG3B 4DV3B 4D6TH 4CH3A 3Q4HA 2V7QG 2QR4A 1FXKB 4DV5B 2XT9A 1GH6A 4YHHO 1XMOB 4LFBO 2P6JA 3K08A 4UB6Z 4LF4B 1NR7A 3RYCB 2CH7A 3SYQA 5IY5C 1HNXB 2Q5ZA 4B3TO 4HNAA 3RBZA 4RUFA 2IJIA 2QGNA 2EULA 1XREA 2Q8VA 1Y66A 3ZX6A 4JI2B 2DMXA 1FJGB 3RW0A 1QHTA 1WB8A 3JYCA 1HNWO 3ML0A 2H3OA 3CCVV 2GSMB 3K58A 3UKMA 2YIBD 4W4KA 4DW0A 2QEXV 1H2GA 3UT5B 2W0XA 2ZCEA 4DW1A 4K0KB 2EIMB 4H33A 1B3QA 2AHYA 5JWPA 4F4LA 4QJFB 1F51A 3K06A 1VF6C 5B66Z 2EJRA 2XTAA 2B1GA 1BZKA 4Q20A 5LHHA 2NN4A 5EBWC 3LDCA 3AK2A 4GX2A 2QWNB 4J9YB 3CSXA 3E8FA 3ICXA 5IWAB 3H1KH 3OTFA 4B7EA 3CD6V 4Z2WA 1OCRB 2DJVA 3T1HB 2X6BA 3LNMB 4JI7B 1ENVA 1W0KG 4BW5A 4J11A 3WU2Z 4OX9O 2UXXA 2F66C 3VBBA 1AJQA 1N32O 3G6BA 3TK1A 4ZHQA 4DV1O 3RYFB 2F4VB 1XNRB 4CS2A 5HFLA 2LFSA 3ASOC 4FLVA 4LCUC 2YDEA 3CS5A 3X2QC 1NH2B 1L1FA 1VQ9V 1GRJA 2CTRA 3FKSG 3DC6A 1G1XB 1QQCA 4J41A 3ABTA 3VQXA 3P3NA 5KA6A 3EFFK 2DQ3A 1RSOA 2JJ1G 4HYOA 3VOUA 5IJ0B 1U96A 5JH7A 3SPHA 1FD9A 4ZKIA 1I08A 4MW8A 5KAIZ 1K5SA 2EJ7A 4O4JA 4QIWF 5LP6A 1AROP 3WFVA 2PY5A 3G4SV 4BIOA 2E75B 3JAKB 3LDDA 2NR5A 5CN0A 1B04A 3E89A 4PDMA 2Y48A 1KC8W 2Y4UA 5EBLC 4LWSB 2AXTZ 1N34B 4G27B 1K34A 4NTXA 5KX5B 3ETGA 3JASA 3CEIA 1EZJA 4DR5O 4J80A 2LGQA 5JJJB 4PA6A 4JYAO 1IXBA 1SETA 1QBZA 4B3SB 4MVRA 2LW1A 2ITCC 4B7KA 3JARB 1HR0B 1JJ2U 3ZN0A 1M56C 5CA1A 2B9ZA 4U3JB 2XAGA 2R9RB 5CA3A 5LXTA 1SQPH 1XDCA 5LHGA 2ILMA 2O57A 2QE7G 3AK3A 4LFCO 3T1YO 1SQQH 3W7UA 1XL4A 3CCUV 1WNSA 2JGDA 1VEWA 3IJ4A 4X20A 5CB4A 1Z2GA 2WLIA 1IX9A 5D5PA 3ABLB 3QO5A 3FX7A 3E8HA 3SJCC 3DTUB 1IBKO 4J10A 2XAJA 2ZDIA 1EBOA 5JQGB 2H94A 4H37A 2PZSA 4GKJB 1KBHA 4FMTA 4GUNA 4MS2A 2WLKA 2ZD9A 3BAAA 1JFFB 2A06H 1NS1A 4LFAB 1RM1C 2ZNIA 4UFZA 2MK3A 3X2QB 3SR2C 4ZI7B 1Q6UA 5L3CA 5C93A 2OCCB 3N27A 3SJBC 5EBMC 3AG2C 3N2GA 1THZA 1SQGA 2CK3G 1P7BA 2WLLA 5B1BB 2BSKA 1S0VA 1DGSA 4JTDB 2IM9A 2DOSA 4MSWC 4L87A 3F5TA 3AG1B 4RQEA 1GN3A 1R6NA 1YVWA 1WA8B 5TISZ 3B09A 2UU9B 3TXQA 2ARHA 3FB7C 3BPZA 4K35A 4QE9A 3BCCH 4LF7O 1KB9F 3OW2U 4IHJB 3AG7A 2JGUA 1H5WA 4JTCB 4JI3B 1VQPV 3QTCA 4PV1B 1HNZB 4FLTA 4JV5O 4YIPA 1R6KA 1OZ0A 3K9SA 1YXBA 1QLNA 5L3FA 2VQEO 1IJGA 4YHHB 3TJTA 4LFBB 4PA7A 4YXWG 4B3TB 4ABMA 2ETNA 1QU7A 2KG7A 3RFRA 3UT5A 2JIZG 4R7CA 3W7TA 5C8YB 3ETEA 4PA4A 2IH3C 3ZBHA 1NTKH 4DV2O 1HNWB 2V1DA 1YZBA 4NKGB 4X1YB 2UXBB 5KAFZ 3K04A 1KP3A 3OMIB 1HW7A 3WB2A 2ZM6B 4AHCA 2N05A 1B06A 4G2KA 4GX1A 2GUZB 1LUVA 2EIJB 3P32A 1AI7A 5KHHA 3RT3C 3RYFA 4X1IA 5LGTA 3EVKA 1IXMA 3STLC 1SA0B 2VQFO 2Q73A 3JD3A 1PL4A 5EYPB 1HWYA 1VP7A 5FPOA 2WSSG 1N32B 2ADPA 3T2MA 1WJZA 4DV1B 1ZWIC 3ETQA 1N33B 3SDLA 5GONA 1KKCA 1RSOB 3CCLV 1M90W 2CAZC 5A2QN 3JCZA 1TUBA 2A0LA 2BOBC 5JH7B 2OT5A 5ITZB 3CRMA 3PJSK 3JAKA 1OCOC 1P4RA 4LNUB 2JEUA 5BMVA 2Z0AA 5LOVB 1Y76B 4O4JB 3WG7B 3I56V 2YS8A 4LWSA 5JCOC 1FOUA 1ROPA 4DV4O 4JAAA 4RQFA 4K3AA 1GTOA 3O65A 2UXDB 3W7WA 1YDXA 1PPJH 2M7WA 4FFKA 3GB7C 1MOFA 2UXCO 2IW5A 2WA3A 3RVYA 5BZBA 4BW9A 3JD1A 1PKXA 2PYJA 3IFXA 1AILA 1O9HA 3JD4A 2Q7HA 4JYAB 1BHAA 4PDVA 5CA1B 3ABKB 2Y0PA 4LF6O 3P3PA 1JPXA 3ZHRA 4UVCA 2P67A 3SPIA 4NXMO 4K8XA 2CTQA 3FD9A 3DGEA 1M57B 1QR8A 2AZ2A 1PNLA 1JX9A 1WLEA 4AILC 3L72H 2UUAO 4GKJO 4LFCB 3T1YB 4FFBB 4X20B 5JQGA 1XNQO 4PD4F 2F95B 1MSWD 5GTHZ 3BABA 5LL6Y 4FM2A 3ZRXA 1ZX3A 2JEXA 4FLXA 1IURA 1K9MW 3ZRVA 1WAZA 4ZI7A 1IBKB 1CXZB 3K5MA 2X6CA 1ZUQA 2GBOA 1AVMA 1S3JA 4NR1A 1F23A 3SYAA 4FM0A 3BY6A 4N21A 4UB8Z 2LJ2A 3M7MX 4CBCA 3WB1A 1E79G 3HKBB 2L6LA 4DXWA 1UJWB 1FFXB 3E2EA 3FYEB 4KHPO 4E4EA 1KYOF 3K03A 3ASNB 1EZVH 1QLEC 3N2GB 2OCHA 3DC5A 3H1LH 1K4DC 1Y4MA 4J7JA 4O4IB 4JI0O 2XOKG 1HDJA 1XQ8A 2WLLB 2BSKB 3VQYA 2EINB 4PHZA 2OYQA 4HBNA 4UCVA 3K3WA 2PGGA 3SPGA 4IHJA 1HNZO 4P30A 2YC0A 1T5EA 1QR9A 4OPHA 1AP6A 4GT1A 4JZ2A 2HVKC 2QWRB 1Q6HA 4JAVA 1K92A 3CX5F 3OMAB 4LF7B 2AHZA 1V54C 4BWAA 3ABMC 1TUEB 3JD0A 1V55C 1EN5A 1FAFA 4PJ0Z 1X59A 3OUSA 1BQ0A 1R1BA 4X65O 3ZJZA 4JV5B 2IJHA 2WLNA 1N8RW 5C8YA 3T1CA 2N04A 1NJIW 3R65A 2Q7GA 1YITV 2VQEB 1VQ4V 4PI2A 2UXBO 4PI0A 1XEQA 3FB6C 2KG7B 2HG5C 4X1YA 3UM7A 4UUJC 5KA5A 3L70H 1GKFA 4UCTA 3OTOO 2ZM6O 4QPKA 3SJQC 2KSDA 2Y4TA 3MD0A 4RO2A 3E86A 3FYIB 2QJ1A 2YXYA 1U97A 3HKDB 1IBMO 2GUZA 5EZYA 4DV2B 4X9QA 4FVMA 4IL6Z 1RP3B 1Q8IA 2DYRC 3GWKC 2RJZA 4O4HA 3STZC 1AI6A 1NI8A 5IE9A 3KZIZ 1P7GA 2DYSB 3OAAG 1X4TA 2RMKB 1Q81W 3RGBA 1SA0A 2QA4V 2G38A 1H2LA 4DR7O 4PELA 4XDKA 1F4NA 4DR1O 1L0LH 5EYPA 2Q67A 1IZ3A 2RN9A 4X1IB 4JI8O 3ZMSA 2X0LA 4LF5O 3KG2A 4O2BB 1N33O 3C3TA 4DV0B 1MA1A 1AR5A 3QG5A 4MVZA 1O9GA 1Q43A 3K5LA 4ASUG 4NXNO 1VQ5V 2RQ6A 1W2BU 1K33A
chains in the Genus database with same CATH topology
1GN6A 1EM1A 1B06A 3BFRA 4JZ2A 1I0HA 1LUVA 1VARA 3QVNA 3MDSA 1BS3A 1EN5A 3EVKA 3CEIA 1GN3A 4F6EA 1IXBA 4YIOA 5AG2A 1PL4A 2ADQB 1EN4A 3AK2A 2AW9A 3C3SA 1GN2A 2ADPA 1MNGA 4BR6A 3AK1A 1XDCA 2RCVA 3AK3A 1KKCA 1ZSPA 2QKCA 4YIPA 1XILA 1AP5A 3K9SA 1BSMA 1ZUQA 1ZLZA 1AVMA 1VEWA 1MMMA 4JZGA 3TJTA 2P4KA 1XUQA 1SZXA 1IX9A 1MSDA 1Y67A 3RN4A 2CE4A 1ZTEA 5A9GA 4X9QA 2CDYA 1JA8A 3DC6A 4E4EA 1D5NA 1LUWA 1N0NA 3DC5A 1P7GA 3KDRA 1GN4A 2GDSA 3IC9A 1IDSA 4GUNA 1EN6A 1AR4A 4FFKA 3KKYA 3OT7A 1JR9A 1XREA 3C3TA 1MA1A 1N0JA 1AR5A 1BT8A 1I08A 4JYYA 1QNMA 2QKAA 4C7UA 3LSUA 1PM9A 1WB7A 1WB8A 1AP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN6 A;  1EM1 A;  1B06 A;  3BFR A;  4JZ2 A;  1I0H A;  1LUV A;  1VAR A;  3QVN A;  3MDS A;  1BS3 A;  1EN5 A;  3EVK A;  3CEI A;  1GN3 A;  4F6E A;  1IXB A;  4YIO A;  5AG2 A;  1PL4 A;  2ADQ B;  1EN4 A;  3AK2 A;  2AW9 A;  3C3S A;  1GN2 A;  2ADP A;  1MNG A;  4BR6 A;  3AK1 A;  1XDC A;  2RCV A;  3AK3 A;  1KKC A;  1ZSP A;  2QKC A;  4YIP A;  1XIL A;  1AP5 A;  3K9S A;  1BSM A;  1ZUQ A;  1ZLZ A;  1AVM A;  1VEW A;  1MMM A;  4JZG A;  3TJT A;  2P4K A;  1XUQ A;  1SZX A;  1IX9 A;  1MSD A;  1Y67 A;  3RN4 A;  2CE4 A;  1ZTE A;  5A9G A;  4X9Q A;  2CDY A;  1JA8 A;  3DC6 A;  4E4E A;  1D5N A;  1LUW A;  1N0N A;  3DC5 A;  1P7G A;  1GN4 A;  2GDS A;  3IC9 A;  1IDS A;  4GUN A;  1EN6 A;  1AR4 A;  4FFK A;  3KKY A;  3OT7 A;  1JR9 A;  1XRE A;  3C3T A;  1MA1 A;  1N0J A;  1AR5 A;  1BT8 A;  1I08 A;  4JYY A;  1QNM A;  2QKA A;  4C7U A;  3LSU A;  1PM9 A;  1WB7 A;  1WB8 A;  1AP6 A; 
#chains in the Genus database with same CATH topology
 5BXZ A;  1B6Q A;  3ZMZ A;  2Q68 A;  2P90 A;  2VQF B;  3CMA V;  4I4T B;  2YUA A;  1NTM H;  4CH6 A;  5E1A C;  4A5U B;  4E2L A;  2R9A A;  5ITZ A;  2VRZ A;  4R8C A;  3ZHT A;  5GON B;  5LYJ B;  5KHG A;  4LNU A;  5LOV A;  2AZ0 A;  1Y76 A;  2BTO A;  1YTF D;  1TUB B;  1E1R G;  2Q6A A;  4B08 A;  3CC4 V;  1VIB A;  2UXD O;  2HP8 A;  2YIA A;  4XBF A;  2ZNJ A;  2XAH A;  5BMV B;  4CS3 A;  2CTP A;  1GM9 A;  2IU0 A;  5IY5 B;  2ODM A;  3E83 A;  3AK1 A;  2NNU A;  3E8G A;  3ABM B;  3A2F A;  4CC5 A;  5KHK A;  2QSA A;  1PL0 A;  1LR1 A;  2CGN A;  3ZN1 A;  5IYD O;  3SJA C;  2IJJ A;  1ZLZ A;  1H2K A;  4DV4 B;  1QVG U;  3H1I H;  4JZG A;  5KHI A;  4GCZ A;  3JAL B;  1MSD A;  1Y67 A;  4B3M O;  3A0B Z;  4TQD A;  2ZE5 A;  1H38 A;  4HZ3 A;  3LDE A;  4LH7 A;  1J5E O;  2UXC B;  1VQ7 V;  4LH6 A;  1XHX A;  1VQ8 V;  3UO3 A;  4WBN B;  3CE2 A;  1IDS A;  4ICG A;  5EIB D;  4Q6G A;  3J81 N;  4YJ3 B;  2OIG A;  2DWE C;  4O4L A;  4TOI A;  4FFB A;  2YI8 A;  1IVS A;  4LF6 B;  1DLB A;  2LP7 A;  4QE7 A;  1I94 O;  4JI1 O;  5B5E Z;  4GKK O;  3UQ8 A;  3OGI B;  3SYP A;  1M93 A;  4EKW A;  2LW7 A;  2PYL A;  3OEE G;  4GYC B;  4NXM B;  1PM9 A;  5KUM A;  1F4M A;  3CRR A;  3OFN G;  1EM1 A;  4D7T A;  2UUA B;  3CJH A;  1I7F A;  1SS3 A;  3L75 H;  3E8B A;  5IYB O;  1XNQ B;  1S5L Z;  2EIK C;  3CCQ V;  3ASO B;  2XUM A;  3BRC A;  1SES A;  3HKB A;  3HKE B;  2YIB A;  1FFX A;  2GTS A;  1VQO V;  4X66 O;  5JVD B;  3KCX A;  2C2A A;  1PD3 A;  2F93 B;  2ZXW C;  2UUB O;  4O4I A;  4X88 A;  1QVF U;  2IJK A;  5H6R A;  2JRI A;  2GHY A;  2DWD C;  2HJF C;  4GZR B;  4TUY B;  2BCC H;  3D8C A;  2DW4 A;  5KLV H;  2P06 A;  4KHP B;  5B3S C;  3L74 H;  3LSS A;  3BVO A;  5JCO A;  4DR4 O;  4JI0 B;  3BA9 A;  4JYB A;  2XAF A;  3K5O A;  3B2E E;  1JA8 A;  2ZE8 A;  4LR3 A;  4IIJ B;  3NXS A;  4FZ1 A;  3C90 A;  1JVM A;  1CP9 A;  1PV0 A;  1NVP D;  3KDR A;  4JI4 O;  4JI6 O;  1SRY A;  4FLW A;  3MHH C;  4YY3 O;  2KKW A;  1NR1 A;  1M56 B;  2Z3Y A;  3L73 H;  1US6 A;  4LBE C;  1H2M A;  4FK5 C;  1YIJ V;  1R6T A;  3K0G A;  1SC5 B;  4PDR A;  1S76 D;  2E5L B;  1M5I A;  3TGU H;  1NZ6 A;  4UCU A;  3A8T A;  5JJE B;  4X65 B;  2CUG A;  2EX3 A;  4D7S A;  4H13 B;  1H8H G;  3H1J H;  1TVK B;  4U7N A;  2P7T C;  2YEV A;  3HKD A;  3OEH G;  5IJ9 A;  2DQ0 A;  2WPD G;  4QGP A;  2YSU B;  3ZHU A;  2WLJ A;  3F7V C;  4U7O A;  5CBF A;  2ZIO A;  3OTO B;  4CH5 A;  1KP2 A;  3OR7 C;  1R73 A;  2W6J G;  3F7Y C;  1KKD A;  1VQL V;  2V4D A;  4TWK A;  2JDI G;  5EZY B;  4EB6 B;  4MTF A;  4DK1 A;  3ZCC A;  4TQF A;  1MNG A;  4DV0 O;  2EIK B;  3CCE V;  1IBM B;  3K79 A;  1KEC A;  1RM1 B;  2A3Q A;  5H6Q A;  2QTS A;  4O4H B;  4OPA A;  2AGA A;  2DN9 A;  1K7D A;  4O2B A;  4NB5 A;  4CZZ A;  2D2C B;  1P49 A;  3JAT B;  1JQ0 A;  3AG2 B;  4Z1M G;  2DE0 X;  1KMI Z;  2P4K A;  1XL6 A;  1SZX A;  3ZHQ A;  4DR7 B;  3A0H Z;  4DR1 B;  4I4T A;  4KP4 A;  2HJD A;  3KCY A;  4IYI A;  2MW2 B;  2A7W A;  3HR0 A;  2KB1 A;  4I55 B;  4JI8 B;  1RFY A;  4LF5 B;  2WA4 A;  3G80 A;  4CC6 A;  5LYJ A;  3K0D A;  4NXN B;  2LFR A;  5B3S B;  1BGY H;  1DTO A;  5FPR A;  4J7Z A;  4I9W A;  3ABU A;  4G28 B;  5J2U B;  4MVQ A;  4H44 B;  1YI2 V;  2F43 G;  2E74 B;  3M99 B;  5L3E A;  4Z1V A;  1BMF G;  3ZMU A;  2PI5 A;  2XAS A;  3CME V;  1M4U A;  4OGQ B;  4FLZ A;  4I50 B;  1WP8 A;  4YJ2 A;  3CXC U;  4KXR A;  5HFM A;  1CPY A;  1SKV A;  1PNK A;  4DUY O;  1YHQ V;  1K97 A;  1BS3 A;  3JAL A;  3AG3 C;  5IYZ A;  3JSL A;  1CEZ A;  1PP9 H;  4J9Z B;  1FXK C;  3PN1 A;  4UCR A;  4DR6 B;  1G6U A;  1BL8 A;  5H2F Z;  2Q7E A;  4WBN A;  1VF6 A;  1E1Q G;  1BQZ A;  1YJN V;  1YEW A;  1GN2 A;  4AQY O;  4P9P A;  5LMN O;  4YJ3 A;  3H1H H;  3NR7 A;  4WFA V;  3RVZ A;  4B3M B;  3H9V A;  1G4Y B;  4LF9 O;  1AB3 A;  2ZE7 A;  5K1P A;  1XBL A;  1J5E B;  3S3X A;  3L9D A;  3B8N A;  5LMU O;  4O4L B;  4FPP A;  4MTX A;  2YI9 A;  1IBL O;  1W59 A;  2UXN A;  1KU9 A;  4P9O A;  3L71 H;  4MVO A;  5H9C A;  1I5X A;  1SQX H;  1M9N A;  2EIM C;  1NBM G;  3D3Q A;  4WFH A;  4JI1 B;  3G71 V;  5J2T B;  3CPW U;  3CCM V;  1I94 B;  4GKK B;  5BR8 O;  2PI4 A;  1LUW A;  1ORQ C;  3HKE A;  2WLH A;  2CGO A;  1H2S B;  3CJH B;  1D2D A;  3QF7 A;  2GDS A;  3CRC A;  3ZS8 C;  2GV9 A;  2QTO A;  1JMK C;  1RPR A;  4I5S A;  5DN6 G;  1Q6I A;  3ZHS A;  3CCR V;  5JVD A;  3E22 A;  2ATK C;  2ZE6 A;  1OCR C;  1L0N H;  4TSF G;  1K73 W;  4I0X B;  2ZIN A;  2PTM A;  1AJP A;  1QNM A;  2EZO A;  3OR6 C;  4TUY A;  1WB7 A;  4ZOL A;  4MW3 A;  2QWO B;  1AR1 B;  1MZE A;  4P2Z A;  1JJO A;  4X66 B;  1AI4 A;  3ETD A;  5EIB C;  4LF8 O;  4NYK A;  2XAQ A;  2UUB B;  3WB0 A;  1OCO B;  4UVA A;  2OWO A;  1VF5 B;  2EBO A;  4EFB A;  4AI8 A;  4UV9 A;  3D36 C;  1VF7 A;  2PF4 E;  4F6E A;  3ZMT A;  2Q69 A;  3AG4 C;  3J80 N;  3SYO A;  4IIJ A;  1GO3 F;  3W7S A;  2FML A;  5FL7 G;  5FNV B;  4R6Z A;  1QCE A;  1YJW V;  2W0F C;  1NKD A;  4DR4 B;  1XMQ O;  2BOC C;  1H8E G;  1R3K C;  1DF4 A;  2K1E A;  5JJN B;  1VQK V;  2E5L O;  3ZIA G;  4X64 O;  4JI5 O;  1AP5 A;  4FM1 A;  4N23 A;  4KUM A;  3M8A A;  4DYL A;  3I55 V;  4JF3 A;  4JI6 B;  4JI4 B;  2H8P C;  4MVS A;  3BHP A;  3CP1 A;  4MVM A;  2HLD G;  4YY3 B;  3CC2 V;  2LO1 A;  1N36 O;  4TT3 G;  3OUF A;  4DUZ O;  1TVK A;  3T4Z A;  2WAM A;  2K9P A;  1YTF B;  1YSC A;  2GTA A;  4FJC C;  5LGU A;  5L3D A;  2QM4 A;  4DV6 B;  4B3R O;  2XND G;  3KKY A;  4MTO A;  4QNH B;  2YEV B;  3P30 A;  3ZRS A;  1AJN A;  4EB6 A;  5IJ9 B;  3J7A U;  1JCH A;  1N0J A;  1BT8 A;  3JAW A;  4FIP C;  2Y0I A;  4C7U A;  4BIZ A;  1DK1 A;  1S5J A;  3U10 A;  1I0H A;  2Y69 C;  2OTL V;  2W6I G;  1M1K W;  1VAR A;  1KD1 W;  2Q4P A;  3ABL C;  3JAT A;  4TV8 A;  5B1O A;  3CC7 V;  1FYJ A;  1SQV H;  4DR2 O;  2WWW A;  4HAM A;  1TA8 A;  5CA0 A;  3R66 A;  1FXV A;  4FZ0 A;  1GK9 A;  1HP8 A;  4DRX A;  3MAQ A;  4I55 A;  5LGN A;  1QLE B;  4YIO A;  3FB5 C;  2EIL C;  4DR3 O;  4X62 B;  1Q90 D;  3OM3 B;  3CXH F;  4I9Q A;  3CWB H;  4WFG A;  2HHH O;  3FB8 C;  5KMG B;  5J2U A;  1Z5V A;  3JD2 A;  3CCJ V;  3I5D A;  1R3I C;  4NVP A;  3OD4 A;  2OCC C;  4U3F H;  3OE7 G;  2ZR3 A;  3AG4 B;  5CBG A;  5LA6 B;  4I50 A;  4MTG A;  5B1B C;  1K8A W;  3IGA C;  1TAE A;  4J7K A;  1ZTE A;  1J95 A;  1V54 B;  3AG1 C;  1K4C C;  1V55 B;  1NT2 B;  4IYH A;  1OCC C;  5KUK A;  4DR6 O;  4DO2 A;  4X1K B;  4YJ2 B;  4BIU A;  4CH4 A;  3K59 A;  4F6R A;  3ZRW A;  1AI5 A;  4TV9 B;  3OT7 A;  1COW G;  1ZL8 B;  2CTW A;  4WFE A;  3SPJ A;  3H01 A;  3OMN B;  4XDJ A;  5IYZ B;  3FAV B;  2ITD C;  4DUY B;  1GMG A;  5EC2 C;  4WCE V;  1UPG A;  2X7R B;  3LSU A;  3LUT B;  1SQF A;  1OV9 A;  1XOU A;  1YCI A;  2HR3 A;  1F7Y A;  3OGC C;  1P84 F;  2JS5 A;  1NH2 D;  4JTA B;  1UFI A;  4AQY B;  3GWO A;  2N74 A;  2JK5 C;  1R3J C;  5LMN B;  2Q0A A;  3B4S A;  3ZMV A;  3DSQ A;  4LF9 B;  4W4L A;  3DXR B;  2DYR B;  5DM6 V;  5J2T A;  3N2K B;  3K57 A;  2ADQ B;  1NVP B;  5GW7 A;  1EN4 A;  2Y69 B;  5LMU B;  3ZED A;  1GM8 A;  2AW9 A;  3F5W C;  3HPL C;  3K9A A;  2BE3 A;  1IBL B;  2B5U A;  5IDJ A;  1VQN V;  3RYH B;  2QWP B;  2HVJ C;  3TXS A;  4WF9 V;  2D3O W;  3IC7 A;  3JSN A;  2JS3 A;  1V9P A;  2FB5 A;  3CHX A;  1D5A A;  2A79 B;  5BR8 B;  4I0X A;  1XI1 A;  1OJH A;  1A32 A;  5KHJ A;  3QO7 A;  2EIJ C;  4O2A A;  1MMM A;  2EIL B;  3EXA A;  1RPO A;  3E22 B;  2JJ2 G;  3RYI A;  1NQT A;  1GAX A;  4BAY A;  3HKC A;  2EZP A;  2YID A;  4QPJ A;  4EFE A;  3E35 A;  4ZOL B;  1Z5W A;  4IT5 A;  1N0N A;  1SQB H;  1BE3 H;  4DV7 B;  4CS4 A;  1EFR G;  3IC9 A;  3O9O A;  1BHB A;  2E76 B;  1OHH G;  1EN6 A;  1AR4 A;  2X6A A;  3HB3 B;  1Q7Y W;  5FNV A;  2ZKO A;  4UCS A;  1JR9 A;  3VQV A;  2UUC B;  2HEP A;  3BA8 A;  4LF8 B;  4UCO A;  2FL4 A;  4DV3 O;  1Q5O A;  5K1X A;  3K5N A;  1BCC H;  4DV5 O;  1XMO O;  1OCC B;  4LF4 O;  4LC1 A;  5B1A C;  1KUQ A;  5BY1 A;  1FXK A;  5E79 Z;  1HNX O;  1JOY A;  3QVN A;  1VMG A;  2WLM A;  1Y74 B;  3RYC A;  4RWU A;  2BTQ B;  5DEC A;  1XMQ B;  4JI2 O;  3WG7 C;  5LP6 C;  1FJG O;  1Q86 W;  3Q4H B;  2P4V A;  3RWR D;  2CH7 B;  4X64 B;  4JI5 B;  4DV6 O;  4JYC A;  4HNA B;  3BEH A;  1MG1 A;  5CMU A;  4UV8 A;  3C3S A;  1GM7 A;  1NU1 H;  1R3L C;  3CCS V;  4K0K O;  3U11 A;  5D5Q A;  3W7X A;  4L8J A;  1N36 B;  4J42 A;  3JAM N;  3LSQ A;  2F1M A;  4DUZ B;  2FYU H;  3CB2 A;  4K8Z A;  2P22 C;  1BSM A;  3ABK C;  3FFQ A;  1MZF A;  2FKX A;  3CRA A;  4FLU A;  1N4C A;  1XUQ A;  5IWA O;  1URF A;  4B3R B;  1ZAU A;  2VWK A;  2B1I A;  2OTJ V;  5A9G A;  4OXS A;  3JAW B;  3TCU A;  2M6Y A;  3T1H O;  3QNE A;  2HFE C;  1M57 C;  3B40 A;  1VQM V;  2E3C A;  4JI7 O;  1YF2 A;  2VWJ A;  1S72 V;  1GN4 A;  2F4V O;  4NTW A;  4X62 O;  1XNR O;  4TV8 B;  2R72 A;  4GX0 A;  1NTZ H;  3UCS C;  2ZXW B;  3MHS C;  5CA0 B;  1L8D A;  2YIC A;  2IBZ H;  4EEQ A;  4DRX B;  3UO2 A;  2ZDI C;  4DR2 B;  3IAY A;  1SER A;  4JAU A;  3SYC A;  5KMG A;  2QKA A;  2KQX A;  4ZHQ B;  3D36 A;  1FS0 G;  4OX9 B;  4PA3 A;  4UXN A;  1DF5 A;  3U0Z A;  5IJ0 A;  4DR3 B;  5L3G A;  3THO A;  5LA6 A;  1I5Y A;  3APQ A;  4FLY A;  1KQS U;  2HHH B;  3ASN C;  1FFT B;  2R70 A;  2ZQM A;  4WFF A;  1JNB A;  1OCZ C;  1WPB A;  5B1A B;  5H5N A;  5AG2 A;  2L35 A;  2HKO A;  4X1K A;  1XHZ A;  2EIN C;  2Z5U A;  3A0R A;  1N34 O;  4TV9 A;  3G6E V;  2F23 A;  3CRQ A;  1VQ6 V;  3T4D A;  4BR6 A;  1FKA O;  1ZL8 A;  2NLJ C;  4R50 A;  1S5H C;  4ZIB A;  3S3W A;  5LP6 B;  2RCV A;  5L3B A;  3ZHV A;  3FAV A;  5KX5 A;  5IYC O;  4B3S O;  1ZSP A;  2QKC A;  4F6R B;  3ZRW B;  1MAB G;  2ZIM A;  4JGS A;  1K3E A;  2OIE A;  1HR0 O;  1SZT A;  2IH1 C;  2PUS A;  4PA9 A;  5LBQ A;  3LNN A;  2QM8 A;  3B77 A;  3RN4 A;  4MT8 A;  3JAR A;  2YXH A;  5GTI Z;  2QKS A;  3JAS B;  2JVD A;  4U3J A;  3VQW A;  1TGO A;  3GVM A;  2YXL A;  1WPX A;  1Y6X A;  1S77 D;  1D5N A;  4LP8 A;  1WP7 A;  4DR5 B;  3D3I A;  5B1N A;  4GX5 A;  4H0L B;  3DXR A;  2VS0 A;  3JCU Z;  4NTY A;  3N2K A;  4WFB V;  3APO A;  4ZBM A;  2FTK A;  5LXT B;  2R9I A;  5EK0 A;  4PDL A;  1K5Q A;  1Q3E A;  1PNM A;  5EC1 C;  4DK0 A;  4JYY A;  3SPC A;  3RYH A;  4JAS A;  2JGD B;  2QM7 A;  1GN6 A;  3EHB B;  4MVU A;  1Q82 W;  3BFR A;  5CB4 B;  2WLI B;  2LGW A;  4IGG A;  3CYO A;  3AEI A;  4LFA O;  5CBH A;  5DED A;  5F2V O;  1FXH A;  2QWQ B;  4KL1 A;  2XHB A;  2Q0O C;  3MDS A;  4JPR A;  5IT9 N;  1JFF A;  2ZT9 B;  1SF9 A;  4KFM A;  5FLX N;  2RNB A;  2Q9L A;  3TET A;  1YJ9 V;  4I7Z B;  2DYS C;  4RUE A;  1W0J G;  4DV7 O;  4O2A B;  2RDC A;  3SGI A;  3RYI B;  4RAI A;  2P5O A;  4X89 A;  3HKC B;  1H2N A;  2UUC O;  1LNQ A;  3B8M A;  3G67 A;  1FPO A;  2UU9 O;  2ZR2 A;  4UVB A;  2QDO A;  1XIL A;  1WA8 A;  5LHI A;  4XDL A;  2LQT A;  5J9P C;  1OCZ B;  1WN7 A;  3QO8 A;  4GLX A;  4X8A A;  2IU3 A;  1G8M A;  2CE4 A;  4JI3 O;  1Y74 A;  2CDY A;  2A9H A;  2BTQ A;  3AG3 B;  4DV3 B;  4D6T H;  4CH3 A;  3Q4H A;  2V7Q G;  2QR4 A;  1FXK B;  4DV5 B;  2XT9 A;  1GH6 A;  4YHH O;  1XMO B;  4LFB O;  2P6J A;  3K08 A;  4UB6 Z;  4LF4 B;  1NR7 A;  3RYC B;  2CH7 A;  3SYQ A;  5IY5 C;  1HNX B;  2Q5Z A;  4B3T O;  4HNA A;  3RBZ A;  4RUF A;  2IJI A;  2QGN A;  2EUL A;  1XRE A;  2Q8V A;  1Y66 A;  3ZX6 A;  4JI2 B;  2DMX A;  1FJG B;  3RW0 A;  1QHT A;  1WB8 A;  3JYC A;  1HNW O;  3ML0 A;  2H3O A;  3CCV V;  2GSM B;  3K58 A;  3UKM A;  2YIB D;  4W4K A;  4DW0 A;  2QEX V;  1H2G A;  3UT5 B;  2W0X A;  2ZCE A;  4DW1 A;  4K0K B;  2EIM B;  4H33 A;  1B3Q A;  2AHY A;  5JWP A;  4F4L A;  4QJF B;  1F51 A;  3K06 A;  1VF6 C;  5B66 Z;  2EJR A;  2XTA A;  2B1G A;  1BZK A;  4Q20 A;  5LHH A;  2NN4 A;  5EBW C;  3LDC A;  3AK2 A;  4GX2 A;  2QWN B;  4J9Y B;  3CSX A;  3E8F A;  3ICX A;  5IWA B;  3H1K H;  3OTF A;  4B7E A;  3CD6 V;  4Z2W A;  1OCR B;  2DJV A;  3T1H B;  2X6B A;  3LNM B;  4JI7 B;  1ENV A;  1W0K G;  4BW5 A;  4J11 A;  3WU2 Z;  4OX9 O;  2UXX A;  2F66 C;  3VBB A;  1AJQ A;  1N32 O;  3G6B A;  3TK1 A;  4ZHQ A;  4DV1 O;  3RYF B;  2F4V B;  1XNR B;  4CS2 A;  5HFL A;  2LFS A;  3ASO C;  4FLV A;  4LCU C;  2YDE A;  3CS5 A;  3X2Q C;  1NH2 B;  1L1F A;  1VQ9 V;  1GRJ A;  2CTR A;  3FKS G;  3DC6 A;  1G1X B;  1QQC A;  4J41 A;  3ABT A;  3VQX A;  3P3N A;  5KA6 A;  3EFF K;  2DQ3 A;  1RSO A;  2JJ1 G;  4HYO A;  3VOU A;  5IJ0 B;  1U96 A;  5JH7 A;  3SPH A;  1FD9 A;  4ZKI A;  1I08 A;  4MW8 A;  5KAI Z;  1K5S A;  2EJ7 A;  4O4J A;  4QIW F;  5LP6 A;  1ARO P;  3WFV A;  2PY5 A;  3G4S V;  4BIO A;  2E75 B;  3JAK B;  3LDD A;  2NR5 A;  5CN0 A;  1B04 A;  3E89 A;  4PDM A;  2Y48 A;  1KC8 W;  2Y4U A;  5EBL C;  4LWS B;  2AXT Z;  1N34 B;  4G27 B;  1K34 A;  4NTX A;  5KX5 B;  3ETG A;  3JAS A;  3CEI A;  1EZJ A;  4DR5 O;  4J80 A;  2LGQ A;  5JJJ B;  4PA6 A;  4JYA O;  1IXB A;  1SET A;  1QBZ A;  4B3S B;  4MVR A;  2LW1 A;  2ITC C;  4B7K A;  3JAR B;  1HR0 B;  1JJ2 U;  3ZN0 A;  1M56 C;  5CA1 A;  2B9Z A;  4U3J B;  2XAG A;  2R9R B;  5CA3 A;  5LXT A;  1SQP H;  1XDC A;  5LHG A;  2ILM A;  2O57 A;  2QE7 G;  3AK3 A;  4LFC O;  3T1Y O;  1SQQ H;  3W7U A;  1XL4 A;  3CCU V;  1WNS A;  2JGD A;  1VEW A;  3IJ4 A;  4X20 A;  5CB4 A;  1Z2G A;  2WLI A;  1IX9 A;  5D5P A;  3ABL B;  3QO5 A;  3FX7 A;  3E8H A;  3SJC C;  3DTU B;  1IBK O;  4J10 A;  2XAJ A;  2ZDI A;  1EBO A;  5JQG B;  2H94 A;  4H37 A;  2PZS A;  4GKJ B;  1KBH A;  4FMT A;  4GUN A;  4MS2 A;  2WLK A;  2ZD9 A;  3BAA A;  1JFF B;  2A06 H;  1NS1 A;  4LFA B;  1RM1 C;  2ZNI A;  4UFZ A;  2MK3 A;  3X2Q B;  3SR2 C;  4ZI7 B;  1Q6U A;  5L3C A;  5C93 A;  2OCC B;  3N27 A;  3SJB C;  5EBM C;  3AG2 C;  3N2G A;  1THZ A;  1SQG A;  2CK3 G;  1P7B A;  2WLL A;  5B1B B;  2BSK A;  1S0V A;  1DGS A;  4JTD B;  2IM9 A;  2DOS A;  4MSW C;  4L87 A;  3F5T A;  3AG1 B;  4RQE A;  1GN3 A;  1R6N A;  1YVW A;  1WA8 B;  5TIS Z;  3B09 A;  2UU9 B;  3TXQ A;  2ARH A;  3FB7 C;  3BPZ A;  4K35 A;  4QE9 A;  3BCC H;  4LF7 O;  1KB9 F;  3OW2 U;  4IHJ B;  3AG7 A;  2JGU A;  1H5W A;  4JTC B;  4JI3 B;  1VQP V;  3QTC A;  4PV1 B;  1HNZ B;  4FLT A;  4JV5 O;  4YIP A;  1R6K A;  1OZ0 A;  3K9S A;  1YXB A;  1QLN A;  5L3F A;  2VQE O;  1IJG A;  4YHH B;  3TJT A;  4LFB B;  4PA7 A;  4YXW G;  4B3T B;  4ABM A;  2ETN A;  1QU7 A;  2KG7 A;  3RFR A;  3UT5 A;  2JIZ G;  4R7C A;  3W7T A;  5C8Y B;  3ETE A;  4PA4 A;  2IH3 C;  3ZBH A;  1NTK H;  4DV2 O;  1HNW B;  2V1D A;  1YZB A;  4NKG B;  4X1Y B;  2UXB B;  5KAF Z;  3K04 A;  1KP3 A;  3OMI B;  1HW7 A;  3WB2 A;  2ZM6 B;  4AHC A;  2N05 A;  1B06 A;  4G2K A;  4GX1 A;  2GUZ B;  1LUV A;  2EIJ B;  3P32 A;  1AI7 A;  5KHH A;  3RT3 C;  3RYF A;  4X1I A;  5LGT A;  3EVK A;  1IXM A;  3STL C;  1SA0 B;  2VQF O;  2Q73 A;  3JD3 A;  1PL4 A;  5EYP B;  1HWY A;  1VP7 A;  5FPO A;  2WSS G;  1N32 B;  2ADP A;  3T2M A;  1WJZ A;  4DV1 B;  1ZWI C;  3ETQ A;  1N33 B;  3SDL A;  5GON A;  1KKC A;  1RSO B;  3CCL V;  1M90 W;  2CAZ C;  5A2Q N;  3JCZ A;  1TUB A;  2A0L A;  2BOB C;  5JH7 B;  2OT5 A;  5ITZ B;  3CRM A;  3PJS K;  3JAK A;  1OCO C;  1P4R A;  4LNU B;  2JEU A;  5BMV A;  2Z0A A;  5LOV B;  1Y76 B;  4O4J B;  3WG7 B;  3I56 V;  2YS8 A;  4LWS A;  5JCO C;  1FOU A;  1ROP A;  4DV4 O;  4JAA A;  4RQF A;  4K3A A;  1GTO A;  3O65 A;  2UXD B;  3W7W A;  1YDX A;  1PPJ H;  2M7W A;  4FFK A;  3GB7 C;  1MOF A;  2UXC O;  2IW5 A;  2WA3 A;  3RVY A;  5BZB A;  4BW9 A;  3JD1 A;  1PKX A;  2PYJ A;  3IFX A;  1AIL A;  1O9H A;  3JD4 A;  2Q7H A;  4JYA B;  1BHA A;  4PDV A;  5CA1 B;  3ABK B;  2Y0P A;  4LF6 O;  3P3P A;  1JPX A;  3ZHR A;  4UVC A;  2P67 A;  3SPI A;  4NXM O;  4K8X A;  2CTQ A;  3FD9 A;  3DGE A;  1M57 B;  1QR8 A;  2AZ2 A;  1PNL A;  1JX9 A;  1WLE A;  4AIL C;  3L72 H;  2UUA O;  4GKJ O;  4LFC B;  3T1Y B;  4FFB B;  4X20 B;  5JQG A;  1XNQ O;  4PD4 F;  2F95 B;  1MSW D;  5GTH Z;  3BAB A;  5LL6 Y;  4FM2 A;  3ZRX A;  1ZX3 A;  2JEX A;  4FLX A;  1IUR A;  1K9M W;  3ZRV A;  1WAZ A;  4ZI7 A;  1IBK B;  1CXZ B;  3K5M A;  2X6C A;  1ZUQ A;  2GBO A;  1AVM A;  1S3J A;  4NR1 A;  1F23 A;  3SYA A;  4FM0 A;  3BY6 A;  4N21 A;  4UB8 Z;  2LJ2 A;  3M7M X;  4CBC A;  3WB1 A;  1E79 G;  3HKB B;  2L6L A;  4DXW A;  1UJW B;  1FFX B;  3E2E A;  3FYE B;  4KHP O;  4E4E A;  1KYO F;  3K03 A;  3ASN B;  1EZV H;  1QLE C;  3N2G B;  2OCH A;  3DC5 A;  3H1L H;  1K4D C;  1Y4M A;  4J7J A;  4O4I B;  4JI0 O;  2XOK G;  1HDJ A;  1XQ8 A;  2WLL B;  2BSK B;  3VQY A;  2EIN B;  4PHZ A;  2OYQ A;  4HBN A;  4UCV A;  3K3W A;  2PGG A;  3SPG A;  4IHJ A;  1HNZ O;  4P30 A;  2YC0 A;  1T5E A;  1QR9 A;  4OPH A;  1AP6 A;  4GT1 A;  4JZ2 A;  2HVK C;  2QWR B;  1Q6H A;  4JAV A;  1K92 A;  3CX5 F;  3OMA B;  4LF7 B;  2AHZ A;  1V54 C;  4BWA A;  3ABM C;  1TUE B;  3JD0 A;  1V55 C;  1EN5 A;  1FAF A;  4PJ0 Z;  1X59 A;  3OUS A;  1BQ0 A;  1R1B A;  4X65 O;  3ZJZ A;  4JV5 B;  2IJH A;  2WLN A;  1N8R W;  5C8Y A;  3T1C A;  2N04 A;  1NJI W;  3R65 A;  2Q7G A;  1YIT V;  2VQE B;  1VQ4 V;  4PI2 A;  2UXB O;  4PI0 A;  1XEQ A;  3FB6 C;  2KG7 B;  2HG5 C;  4X1Y A;  3UM7 A;  4UUJ C;  5KA5 A;  3L70 H;  1GKF A;  4UCT A;  3OTO O;  2ZM6 O;  4QPK A;  3SJQ C;  2KSD A;  2Y4T A;  3MD0 A;  4RO2 A;  3E86 A;  3FYI B;  2QJ1 A;  2YXY A;  1U97 A;  3HKD B;  1IBM O;  2GUZ A;  5EZY A;  4DV2 B;  4X9Q A;  4FVM A;  4IL6 Z;  1RP3 B;  1Q8I A;  2DYR C;  3GWK C;  2RJZ A;  4O4H A;  3STZ C;  1AI6 A;  1NI8 A;  5IE9 A;  3KZI Z;  1P7G A;  2DYS B;  3OAA G;  1X4T A;  2RMK B;  1Q81 W;  3RGB A;  1SA0 A;  2QA4 V;  2G38 A;  1H2L A;  4DR7 O;  4PEL A;  4XDK A;  1F4N A;  4DR1 O;  1L0L H;  5EYP A;  2Q67 A;  1IZ3 A;  2RN9 A;  4X1I B;  4JI8 O;  3ZMS A;  2X0L A;  4LF5 O;  3KG2 A;  4O2B B;  1N33 O;  3C3T A;  4DV0 B;  1MA1 A;  1AR5 A;  3QG5 A;  4MVZ A;  1O9G A;  1Q43 A;  3K5L A;  4ASU G;  4NXN O;  1VQ5 V;  2RQ6 A;  1W2B U;  1K33 A; 
#chains in the Genus database with same CATH homology
 1GN6 A;  1EM1 A;  1B06 A;  3BFR A;  4JZ2 A;  1I0H A;  1LUV A;  1VAR A;  3QVN A;  3MDS A;  1BS3 A;  1EN5 A;  3EVK A;  3CEI A;  1GN3 A;  4F6E A;  1IXB A;  4YIO A;  5AG2 A;  1PL4 A;  2ADQ B;  1EN4 A;  3AK2 A;  2AW9 A;  3C3S A;  1GN2 A;  2ADP A;  1MNG A;  4BR6 A;  3AK1 A;  1XDC A;  2RCV A;  3AK3 A;  1KKC A;  1ZSP A;  2QKC A;  4YIP A;  1XIL A;  1AP5 A;  3K9S A;  1BSM A;  1ZUQ A;  1ZLZ A;  1AVM A;  1VEW A;  1MMM A;  4JZG A;  3TJT A;  2P4K A;  1XUQ A;  1SZX A;  1IX9 A;  1MSD A;  1Y67 A;  3RN4 A;  2CE4 A;  1ZTE A;  5A9G A;  4X9Q A;  2CDY A;  1JA8 A;  3DC6 A;  4E4E A;  1D5N A;  1LUW A;  1N0N A;  3DC5 A;  1P7G A;  3KDR A;  1GN4 A;  2GDS A;  3IC9 A;  1IDS A;  4GUN A;  1EN6 A;  1AR4 A;  4FFK A;  3KKY A;  3OT7 A;  1JR9 A;  1XRE A;  3C3T A;  1MA1 A;  1N0J A;  1AR5 A;  1BT8 A;  1I08 A;  4JYY A;  1QNM A;  2QKA A;  4C7U A;  3LSU A;  1PM9 A;  1WB7 A;  1WB8 A;  1AP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...