1WB8A

Iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosine in the active site.
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
IQFKKYELPPLPYKIDALEPYISKDIIDVHYNGHHKGYVNGANSLLERLEKVVKGDLQTGQYDIQGIIRGLTFNINGHKLHALYWENMAPSGKGGGKPGGALADLINKQYGSFDRFKQVFTETANSLPGTGWAVLYYDTESGNLQIMTFENHFQNHIAEIPIILILDEFEHAYYLQYKNKRADYVNAWWNVVNWDAAEKKLQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [FE]
publication title Iron Superoxide Dismutase from the Archaeon Sulfolobus Solfataricus: Analysis of Structure and Thermostability
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 75
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2004-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1wb8A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1wb8A02
1N0NA 1MNGA 4F6EA 2AW9A 3KKYA 3K9SA 1EN4A 4X9QA 3IC9A 1XDCA 1ZUQA 2QKCA 3AK3A 3TJTA 4GUNA 4JYYA 1LUWA 3OT7A 1LUVA 3DC6A 1AP5A 1EN5A 3QVNA 2RCVA 1BT8A 3C3TA 1PL4A 1BSMA 1AVMA 1D5NA 1B06A 4YIPA 4FFKA 1BS3A 1QNMA 1XUQA 1XREA 1IDSA 5A9GA 1KKCA 2ADPA 3AK1A 1GN3A 4BR6A 1XILA 1ZSPA 3DC5A 3BFRA 1IX9A 3LSUA 3AK2A 2CE4A 3CEIA 3MDSA 2CDYA 1EM1A 1I08A 4YIOA 3RN4A 4E4EA 1GN6A 1PM9A 1EN6A 1AR4A 1N0JA 1P7GA 2P4KA 2ADQB 3EVKA 1AP6A 1IXBA 1SZXA 1JA8A 1MSDA 1ZLZA 1WB7A 1WB8A 1MMMA 4JZ2A 1ZTEA 1VARA 2QKAA 3C3SA 1JR9A 1I0HA 5AG2A 1GN4A 2GDSA 4C7UA 1MA1A 1VEWA 1AR5A 4JZGA 1Y67A 1GN2A
chains in the Genus database with same CATH superfamily
1AB3A 3CC4V 3KKYA 4DK0A 3RYCB 1H38A 5LOVB 1SZTA 2QKCA 3GWKC 2UXBO 4IL6Z 3ZN0A 5L3CA 1WPXA 4GX2A 2F4VO 1FS0G 1SKVA 3WG7B 2HVKC 2R9IA 4R50A 2HJDA 2RCVA 1FXKC 5FNVB 4U3JB 1M4UA 1S72V 5FPRA 2CGOA 1QLEC 2LJ2A 2XAQA 3QG5A 2E5LO 1SC5B 4ZIBA 1WA8A 5BR8O 4RAIA 2RNBA 1K3EA 3AG1C 4K35A 1GTOA 5J9PC 4UXNA 2UUCO 2QJ1A 2F23A 3K3WA 3H1HH 4DRXA 1Z5VA 5IYDO 2V4DA 1XL6A 3E22B 2EIMC 1RPRA 3JCUZ 3CEIA 5H6QA 2WLLB 1OV9A 3CRCA 3MDSA 1WPBA 4Z2WA 1GN6A 3G6EV 4KP4A 4HNAA 2P06A 4I4TA 3CWBH 3BHPA 4X62O 4GCZA 3CCLV 4G2KA 1K4CC 2B5UA 3WB1A 2Q68A 4JTAB 3BVOA 3CRMA 4JZ2A 1XNQO 1NKDA 2PI4A 4DV2O 3B8MA 4DUYB 2C2AA 2N04A 1BQ0A 2ZM6B 1YCIA 4FIPC 1GN4A 4X64B 3ICXA 4TV9A 2QDOA 1B3QA 1J5EB 1K34A 1SF9A 5K1PA 4J7ZA 4UFZA 1MZEA 3OMIB 2B1GA 1KD1W 1FJGO 1HDJA 5CBGA 3E8FA 1VQ9V 1PPJH 3B09A 3F5TA 4YJ3A 3SJCC 2P67A 5KHGA 4JASA 3K5MA 2R9AA 4WFBV 1VQ4V 4JI4O 1VQOV 1LUWA 3P30A 5EBMC 2NNUA 4DR2O 3ZHVA 1UFIA 2UUBO 5KAFZ 3FB8C 1JQ0A 4TT3G 3MHHC 1TVKB 5LP6C 3K04A 1KMIZ 4F4LA 3F7VC 2AZ0A 4HZ3A 3ZRXA 4DV0O 1JFFA 4JAAA 4JI7O 3E86A 4UV8A 3FYIB 1XUQA 4H33A 5A9GA 1XNRB 4LR3A 3RT3C 3HKBA 4NVPA 3D3QA 3N27A 3DTUB 4P9PA 4GYCB 3ZRWB 1AJNA 3S3XA 5JCOC 3JCZA 5LGNA 2Q7GA 1VF6A 1FXKB 4IT5A 5JCOA 2BTOA 1F51A 3RW0A 1WA8B 4MVUA 1W0KG 2JRIA 3D36A 4QE9A 5KMGA 4TWKA 2VWJA 4ICGA 5KA6A 1M1KW 2KB1A 2ZQMA 3OAAG 3AG1B 5F2VO 3RYFA 4CS3A 5H6RA 4CZZA 2UUAB 5EZYA 1KP2A 3FFQA 1WB7A 1WB8A 1QU7A 1SESA 3E89A 2LGWA 3VQYA 4DRXB 4OPAA 3ZMTA 5B66Z 1TUBB 1Y76A 3IAYA 5H5NA 1JVMA 3CPWU 3LNMB 4DV4B 2EIMB 2QM7A 5LYJA 3OUFA 4H0LB 1I5XA 1WNSA 3IFXA 4LNUA 1N33B 1K7DA 2R70A 4K8ZA 4OPHA 2ZT9B 3JARA 3ABLC 5HFMA 3CMEV 4FPPA 4FK5C 1LUVA 4LF7O 4CC5A 4G27B 1CP9A 2CK3G 4U7NA 1BSMA 4LF6B 3BA8A 5H2FZ 1K97A 3C90A 3T1YO 3CCEV 1EBOA 1S5JA 3KDRA 4O2BA 1YI2V 2ZD9A 1Q8IA 1IDSA 1M9NA 4CS2A 1YTFD 2ZINA 5J2TA 4I0XA 3ZX6A 1ORQC 4YJ2A 2PTMA 4MT8A 1SRYA 4GX0A 3PN1A 4Z1VA 2VWKA 1H2GA 1YVWA 2R9RB 3ZHQA 2DOSA 5IYZB 1PM9A 5TISZ 5LP6B 2K1EA 4QJFB 1H2KA 2DMXA 1Q90D 2HLDG 3G6BA 4KL1A 2FYUH 2F95B 4XDKA 4R7CA 1Q82W 3CRRA 2EIJC 1IBKB 2DE0X 1SQGA 3OEEG 5CN0A 1K5SA 3HKEA 3HR0A 5JJEB 4JZGA 4J9YB 4IIJA 2LGQA 4UVBA 3OMNB 3TETA 3K57A 1OZ0A 1FXHA 4DV5B 1SQFA 3U0ZA 1Y74B 4DUYO 5LBQA 5EZYB 2ZM6O 3CCMV 3SPIA 1EN5A 2IU0A 2DYRC 4X64O 2WLMA 1J5EO 1PP9H 4FMTA 5EBLC 1J95A 2QWRB 2CTRA 4ASUG 1SQPH 4MVMA 5DN6G 4KXRA 3U11A 5IJ0A 3G67A 3E8BA 3JD2A 4YY3B 4J10A 2QWOB 2GBOA 3GVMA 3ZN1A 2Q69A 5CA0B 4LH6A 4JI2B 4GZRB 1XREA 2D2CB 1URFA 2HJFC 3FB5C 4DR3B 4LNUB 4OGQB 1GN3A 3GWOA 1YHQV 1SA0A 1XILA 4TQFA 4GLXA 1SS3A 3NXSA 2Y4UA 1HNXO 3W7XA 1Y66A 4FZ1A 3I5DA 1LNQA 1W59A 1EZJA 3CXCU 3SPGA 1QBZA 2UU9O 2KQXA 2PUSA 3RN4A 3CCVV 2QTOA 1F4MA 2V1DA 3A0RA 4L87A 4NYKA 5EC2C 2ZXWB 1XNRO 3T1CA 4O2BB 2PY5A 4LH7A 1AP6A 1IXBA 1FPOA 3UT5A 4BWAA 2AXTZ 5EYPA 2Q0OC 4UV9A 1ZTEA 2W6IG 4DUZO 5JVDA 3UO3A 4Z1MG 1NH2D 4I0XB 3NR7A 4C7UA 1SETA 1V55C 2HKOA 3RYCA 3JD3A 5CA1A 3THOA 5LOVA 3ABUA 1Y67A 1N8RW 3BRCA 1MSWD 3QNEA 1L8DA 4RQEA 2F66C 2RQ6A 1Y6XA 3SPJA 2UUAO 4IYIA 3K58A 3QO8A 1R73A 1GRJA 5EC1C 5IWAO 2WA4A 1NZ6A 1NQTA 2Y4TA 1PL0A 5IY5C 4J80A 5EBWC 4DV4O 1F23A 3ETEA 2EIJB 1D5NA 3BY6A 3HKEB 3UM7A 2IJJA 3L70H 4IIJB 3R66A 3AG4C 3UO2A 1YF2A 1N33O 3FAVA 4JAVA 1NS1A 2VQFB 4X66B 1GAXA 4AHCA 5KLVH 1BHAA 4PDVA 2QWQB 2QWPB 4NTWA 2PI5A 3BFRA 4QGPA 5D5PA 2QWNB 4I5SA 2YICA 2YI9A 4O4JA 2OTLV 4NXMO 4JI1B 2DYRB 4OXSA 5FLXN 2OWOA 4JPRA 5B1NA 4H13B 1U97A 1I7FA 3CCQV 4DV3B 4PELA 3CCJV 1Q6IA 4UVAA 1IVSA 5IYCO 1EN6A 1KECA 5IJ0B 2UXDB 5LA6A 3CCSV 2ZNJA 2ADQB 1XHXA 2EINC 2PZSA 3H1KH 2IW5A 4LFAB 2ITCC 5LGTA 1SA0B 1NR1A 4KHPO 1FFXB 1I0HA 4DV7B 4MVOA 3JD4A 3M8AA 4MVQA 1NVPB 3CSXA 3RVZA 2L6LA 3ETDA 2XAHA 3OTOB 3AG2C 2RJZA 2WLHA 2UXNA 3SYQA 4WFAV 2Q9LA 4UCVA 3UT5B 1YJWV 2H3OA 4ZBMA 2IBZH 2HVJC 3OT7A 2OTJV 1Q5OA 2E75B 1FXVA 2WSSG 1TVKA 1Q81W 1IBKO 1TGOA 4WF9V 3JASA 1Q3EA 4MVZA 3ZRSA 1AVMA 3QTCA 2WLKA 1XMOO 2OCCC 3LUTB 2LQTA 4FLTA 1K4DC 2M6YA 1KUQA 5CA1B 3ABKC 1V55B 3EXAA 2Q8VA 5EIBD 4DR5B 4DV5O 3CB2A 3ZRWA 1K5QA 3DXRB 3WFVA 2YXHA 2EBOA 3I56V 1VQLV 1Q6HA 2XAGA 1ZSPA 4BIOA 1FXKA 2P6JA 4H44B 1FKAO 2DQ0A 2Z5UA 3LSUA 1HNWB 1W2BU 2NR5A 5B3SB 3DGEA 4I55B 4JYBA 2CDYA 2JEUA 4RWUA 3CCRV 2YEVB 5IY5B 2A0LA 4YY3O 4JI2O 2OCHA 2QGNA 4LCUC 2R72A 1JX9A 4JI0B 3RVYA 4DR3O 2IM9A 3W7UA 3AG4B 4J7KA 3FAVB 2FL4A 1GKFA 1MMMA 1TUBA 4CH4A 1JOYA 2JGDA 2QKAA 4GX5A 4DYLA 1XEQA 4R8CA 1DF5A 1XMQB 5AG2A 4XBFA 1VF7A 3SJBC 1XBLA 2VS0A 2Y0PA 4O4JB 2CTQA 2QTSA 2N74A 4FLVA 4PA3A 2RDCA 4DW0A 1GK9A 3OGCC 3RFRA 4PD4F 1H2SB 4JV5B 1M90W 1QVFU 5LA6B 3IJ4A 1JMKC 2W6JG 1Q7YW 3OR7C 2EINB 4J9ZB 2XUMA 4W4LA 2A06H 3BAAA 3HB3B 2EILC 3E8HA 1E1RG 4X1IA 2AHYA 4I9WA 2GUZB 3ZEDA 3MAQA 1KQSU 3OTFA 1NR7A 3F7YC 2B9ZA 5LMUB 2EJRA 3UKMA 2Y69C 5D5QA 2JVDA 3AG2B 4DW1A 1UPGA 5B1AB 2LW7A 2JK5C 4MW8A 4CH5A 2YIDA 2ZE6A 5IYZA 5C93A 3JASB 1NTKH 3LSQA 5LP6A 1K9MW 3H1JH 5C8YB 2A7WA 1AJQA 1FAFA 1AI4A 1AR4A 1XL4A 1N0JA 2VQFO 2OIEA 4X66O 4G28B 2QKSA 1TAEA 3BABA 1NBMG 4N21A 4CBCA 2X7RB 3W7TA 1G8MA 2ZNIA 1VARA 4HYOA 1Q43A 3CRQA 4P30A 2VQEB 4JI1O 1MA1A 2YIBD 3RYHA 3A0HZ 1L0LH 1QLEB 4DV3O 3H01A 5B1OA 1FFTB 1M56C 3P3NA 2UXDO 1Y74A 3JAMN 2G38A 1IJGA 4XDJA 3ZCCA 4LF5B 4LFAO 4O4HB 3ML0A 2WAMA 4MTXA 1SQVH 4GT1A 4DV7O 2JGDB 3CMAV 3C3TA 3G4SV 2A79B 1XI1A 4W4KA 3D3IA 3PJSK 2ZDIC 2QA4V 4B3SB 3H1IH 5L3GA 5CA0A 1Q86W 4B3TB 1RP3B 4WCEV 3OTOO 4DR6B 3EFFK 4NXNB 1IBMB 2YI8A 4O2AA 4MS2A 2ADPA 1BGYH 3K08A 4P9OA 3APQA 4TV8A 1WP8A 1BMFG 1IX9A 2JS3A 4IHJB 4X1YA 4DR7B 4WFEA 3OMAB 4UVCA 3SYOA 3BA9A 1EM1A 2A9HA 5IJ9A 5EIBC 5GONB 4X1IB 1B04A 4DR5O 2EILB 3B77A 1BL8A 2Q6AA 2H8PC 1RM1C 1KP3A 2ITDC 4JTDB 1WAZA 3TXSA 3G71V 3OFNG 3CC7V 5B5EZ 2BE3A 4BW5A 2AHZA 3LDDA 1HNWO 2Y69B 3FYEB 1THZA 1Z5WA 2XNDG 2ZE5A 4QIWF 1EFRG 2WWWA 1PNKA 1YIJV 5DEDA 3ABTA 1GN2A 1N0NA 2BSKB 4JI0O 4DR1B 3UCSC 2GTAA 2KG7A 4UB8Z 2ZR3A 4TQDA 4QE7A 1YJ9V 3AK3A 2V7QG 3H9VA 3FB7C 2AZ2A 2ZKOA 4QPJA 4JI6B 4B7KA 4GKKB 3CC2V 4NR1A 1XMQO 1AP5A 3ETGA 2GTSA 4NKGB 4FVMA 5ITZB 1L0NH 4EFEA 3RYHB 1P7BA 1AI6A 1YZBA 3BPZA 2CTPA 4I9QA 4JV5O 3ABMC 5JWPA 4LF4B 1M56B 1T5EA 2QM8A 1KKCA 2JJ2G 2GSMB 1YJNV 1GO3F 2XHBA 1M93A 3B8NA 3J80N 3P3PA 4ZHQA 3SGIA 1R3LC 3LDCA 1BQZA 5JJNB 1VQPV 5LMUO 1KKDA 1P7GA 4X1KB 5LHHA 3I55V 1KYOF 4O2AB 1FFXA 1PV0A 3ABLB 1OCCC 2CTWA 4J42A 3CS5A 4ZI7A 2FKXA 1AI7A 3AG3C 2RN9A 4TV8B 3HPLC 3CCUV 2EJ7A 2UUCB 1E1QG 1ZX3A 4D6TH 3VQVA 4X1YB 2ATKC 5CA3A 1AR1B 1G4YB 1AR5A 1WJZA 5IJ9B 2X6CA 3E2EA 3VOUA 4KFMA 2WLIA 1OCOC 2P5OA 3SJQC 3TK1A 3K0GA 2E74B 2VQEO 3JAKA 3L9DA 2F93B 1MABG 1S0VA 2EIKC 2Q7EA 3K5NA 2CH7A 3CXHF 4I7ZB 3LDEA 4Q20A 3X2QC 1QLNA 1RSOB 5LXTB 5J2UA 3DXRA 1G6UA 1BS3A 4LF5O 3WU2Z 3K06A 2WLJA 1BCCH 4LF9B 2KG7B 2Q0AA 2Q4PA 3AK1A 4MTGA 5EK0A 1KU9A 2JS5A 2W0XA 1JPXA 1HR0B 2JIZG 1IURA 4I55A 3DC5A 1K8AW 2YXYA 1N4CA 5LHGA 5LGUA 1K73W 1G1XB 1NT2B 4B3SO 2YEVA 2W0FC 5LMNB 1H2MA 5K1XA 1QHTA 3K5LA 1N34B 4AQYB 4B3MB 4FLWA 1SQXH 3WB2A 4DR2B 1O9GA 4DR6O 4DK1A 4GKJB 4NXNO 1IBMO 3ZMVA 5KHHA 1XHZA 4PA6A 1U96A 4D7TA 4ZOLA 4I50A 4WFHA 1IBLB 2HG5C 1OHHG 5BZBA 4JI8B 4JTCB 2YSUB 2DYSC 3OUSA 4LF6O 2X0LA 1HWYA 4DR7O 2PGGA 3HKCB 3B4SA 1JJ2U 1WP7A 2B1IA 1X59A 4LFCB 4K3AA 2X6BA 4ZHQB 1RPOA 4TSFG 4JAUA 4YIPA 1R6TA 2O57A 1HNZB 2XAJA 2DJVA 3P32A 1F4NA 2EZOA 4X9QA 3IC9A 1XDCA 3HKDA 3VBBA 2P22C 3JAWA 3K5OA 3IGAC 5HFLA 4ZI7B 4TUYA 1QR9A 1S3JA 4FM0A 3RBZA 3ZMZA 1OCCB 2IH3C 3E83A 2ETNA 2GUZA 3AG3B 1AROP 3T4DA 2GV9A 3OEHG 4DR4B 2DWEC 4PA7A 1I94B 2ODMA 4DR1O 4LWSA 1P84F 4Q6GA 4FLYA 2XASA 4O4LA 1GM8A 2NN4A 4MW3A 1M57C 3ZHUA 4JI6O 3L75H 1OCZC 2F1MA 3SJAC 4GKKO 4PDMA 2WLIB 3M99B 4BR6A 2YDEA 1M5IA 3D8CA 3H1LH 1OCOB 2OIGA 1QCEA 4HAMA 5C8YA 3DSQA 3JAKB 2ARHA 3E8GA 4FM2A 3STLC 1VQMV 3VQXA 2HR3A 2CH7B 5GTHZ 3K79A 2EIKB 3KG2A 5J2UB 1FOUA 4LF4O 2QE7G 3X2QB 4DV6B 3T1HB 3BCCH 4WFFA 2OYQA 2EZPA 4DV1B 1OJHA 1YDXA 4PI0A 2UXXA 2P7TC 4LFBB 1YSCA 2XAFA 4F6RB 1N32B 4LP8A 2FB5A 2BTQA 1KB9F 3N2KA 1H8HG 1VF5B 4R6ZA 2WA3A 3AEIA 3L72H 5L3DA 5LL6Y 4O4HA 3UQ8A 4JYAB 4X20A 1YXBA 2CUGA 1AJPA 2K9PA 1DLBA 2LO1A 4ZOLB 4I50B 1R3IC 2Z3YA 3JSNA 4NTXA 3FX7A 4LF8B 3QF7A 3DC6A 4JI5B 1DF4A 1E79G 1PL4A 2DYSB 3TGUH 4RQFA 1NI8A 3GB7C 1V9PA 4FFBA 2PYLA 1Y4MA 3L73H 3KZIZ 1QNMA 2ZE8A 4YHHB 3JD1A 2Z0AA 5BXZA 2DN9A 1IZ3A 2LFSA 2A3QA 1YTFB 1PD3A 2IH1C 3B2EE 3HKDB 3JAWB 4JI3B 4IHJA 1ROPA 4AI8A 3OW2U 3SDLA 1UJWB 1OCRC 3OGIB 4TUYB 5GONA 3LSSA 3ETQA 2CE4A 4BIZA 1B6QA 1MG1A 5JH7A 3ZHRA 5KHKA 4YIOA 5KAIZ 4E4EA 1S5HC 4LWSB 4LF9O 1CPYA 2HFEC 5E79Z 5CBHA 4O4LB 4N23A 2UXCB 4K0KB 4BW9A 1HR0O 2MK3A 5CB4A 1M57B 4OX9B 1S77D 1SQBH 1GM9A 1OCZB 5KHJA 2DQ3A 3SR2C 3C3SA 4XDLA 5LMNO 3T4ZA 3Q4HB 1WN7A 5H9CA 1N34O 4B3MO 4AQYO 3LNNA 1ZL8A 2BSKA 5GW7A 5B1BC 4GKJO 1SQQH 2OCCB 3J81N 1NVPD 4MSWC 3ZIAG 1HNXB 3ABKB 2ZE7A 4F6EA 5KA5A 2AW9A 1IBLO 1ZWIC 5GTIZ 5KUMA 2UU9B 2ZR2A 1ZUQA 5KX5A 4JI8O 1DGSA 4PDRA 4JYYA 2JEXA 3ASOC 4J7JA 4J11A 5ITZA 1S5LZ 1W0JG 3S3WA 3ZJZA 3A8TA 4LFCO 4FJCC 1VMGA 2BTQB 3N2KB 4UCOA 1H8EG 3CP1A 4D7SA 1VF6C 4DUZB 5IE9A 2NLJC 2IU3A 4HBNA 1XOUA 4J41A 1HNZO 1ENVA 3B40A 4PJ0Z 4JGSA 3D36C 2YXLA 4X20B 3G80A 4JF3A 1VP7A 4X89A 2LFRA 1JNBA 5BMVA 4MTFA 3CX5F 2YIAA 5KUKA 1A32A 1US6A 3W7SA 4KUMA 1R6KA 1GH6A 2ZDIA 1VQ7V 4DR4O 1I94O 4X1KA 2BOCC 1I08A 2F43G 5IWAB 2H94A 4FFBB 1P49A 5L3EA 2JGUA 1NTZH 1LR1A 2L35A 2ZIOA 3EVKA 5CBFA 3M7MX 4UUJC 1SZXA 1QQCA 1AI5A 4DXWA 3N2GA 4HNAB 1JJOA 3MHSC 1NH2B 4I4TB 1FD9A 1N36B 2KKWA 1JR9A 4FM1A 4LC1A 4P2ZA 4MVRA 3ZMUA 2HHHB 1OCRB 3FD9A 4UCTA 4UCRA 4PA4A 3CD6V 3JALA 2QM4A 5JH7B 4DV6O 1XQ8A 3T1HO 2Q73A 4GX1A 4TV9B 1V54C 1MNGA 2ZXWC 4NXMB 4DV1O 1X4TA 1EN4A 1HW7A 1ZAUA 4LFBO 4FZ0A 1N32O 1GMGA 3A0BZ 1PNLA 3CRAA 5CB4B 1NTMH 4YJ3B 4FLZA 1MOFA 3QVNA 2DW4A 1BT8A 4QPKA 1RSOA 3TCUA 5LXTA 4B3RB 5A2QN 4CH6A 2Q7HA 2IJIA 1MZFA 4X65B 3U10A 3ZRVA 1QVGU 1ZL8B 2Y0IA 3ZHTA 1PKXA 2M7WA 4KHPB 5E1AC 1H5WA 4JYAO 2YS8A 5B1BB 3EHBB 4CH3A 3R65A 4NTYA 3OR6C 2Q67A 2LW1A 2P90A 4U3FH 5KX5B 4LF8O 1JFFB 3ZBHA 4JI5O 4UCUA 3BEHA 3ASOB 3ZMSA 3HKBB 4DO2A 2RMKB 1CEZA 5L3FA 1VIBA 1O9HA 1BE3H 5JQGA 2GHYA 3QO7A 3OM3B 4B7EA 4YHHO 4PHZA 4QNHB 3RGBA 2P4VA 3WB0A 1FYJA 1XMOB 1JCHA 4JI3O 2YUAA 3HKCA 1MSDA 5JJJB 2MW2B 4RUEA 3RYIA 1F7YA 3CYOA 2UXBB 5KMGB 3VQWA 2F4VB 2IJHA 5BMVB 1BZKA 2DWDC 2PF4E 3RYFB 5IYBO 4JYCA 4EB6A 3T2MA 1YITV 1K33A 4O4IA 1L1FA 3SYCA 2FMLA 2E5LB 3QO5A 4A5UB 2ZIMA 1Y76B 5BR8B 3K03A 4NB5A 4B08A 3RWRD 5LHIA 1IXMA 4X88A 3CJHA 2UXCO 4IGGA 4K0KO 2Q5ZA 3TJTA 5LYJB 4OX9O 4E2LA 3JATA 3SPHA 2HEPA 3IC7A 3KCYA 3N2GB 2QEXV 5DECA 3JARB 1S76D 5DM6V 1QR8A 1H2NA 3F5WC 1B06A 2CGNA 1TUEB 2OT5A 4WBNA 3JD0A 3JALB 1BHBA 5CMUA 1P4RA 3STZC 3MD0A 2E3CA 3E35A 1AILA 1RM1B 4FLXA 3SYPA 1D5AA 1V54B 4X62B 2D3OW 5IT9N 4CS4A 2QSAA 3L74H 4TOIA 1HP8A 2YIBA 1XNQB 2Y48A 5L3BA 4DV2B 3FKSG 3ASNC 3W7WA 4WFGA 3CHXA 5J2TB 1R6NA 2FTKA 4YJ2B 4PDLA 3JYCA 3K9AA 1VQ5V 4AILC 1CXZB 1H2LA 4F6RA 4MTOA 2P4KA 3WG7C 1FJGB 3J7AU 1JA8A 3SYAA 3ZHSA 2KSDA 2WPDG 2JDIG 2EX3A 4JI4B 5FNVA 4U3JA 4YXWG 4H37A 4B3TO 4PA9A 5B3SC 2UUBB 3APOA 5JQGB 2LP7A 1YEWA 1DK1A 1R3JC 1K92A 4PI2A 2CAZC 3ABMB 2N05A 3K9SA 1NU1H 4DV0B 2XOKG 2ZCEA 4RUFA 1VQKV 4JI7B 1DTOA 4GUNA 3A2FA 1PNMA 4BAYA 1N36O 1TA8A 4UB6Z 2XT9A 4EKWA 3RYIB 1KBHA 2ILMA 4FLUA 3O65A 1Q6UA 3E22A 4CC6A 4IYHA 4ZKIA 2HHHO 2WLLA 3OD4A 3SPCA 5KHIA 2HP8A 2X6AA 4EB6B 4O4IB 5IDJA 2JJ1G 3L71H 1GM7A 4FFKA 3KCXA 4K8XA 2E76B 3K0DA 1VQNV 3CJHB 2VRZA 2IJKA 5BY1A 2PYJA 1Z2GA 1I5YA 2XTAA 1KC8W 3JATB 4B3RO 4U7OA 2BCCH 3ZS8C 3TXQA 3K59A 4X65O 4L8JA 3AK2A 4RO2A 1NJIW 3OE7G 1SERA 4PV1B 1VQ8V 4WBNB 4ABMA 1R1BA 1R3KC 4X8AA 2BOBC 3CE2A 2YC0A 3Q4HA 5FPOA 5B1AC 1ZLZA 2AGAA 2EULA 2WLNA 4UCSA 1WLEA 1RFYA 3FB6C 2QR4A 1D2DA 5EYPB 4BIUA 4LF7B 3AG7A 2GDSA 5FL7G 4EFBA 4MVSA 5JVDB 3O9OA 1VEWA 4LBEC 3ASNB 4EEQA 1COWG 1EZVH 3JSLA 1VQ6V 3T1YB
chains in the Genus database with same CATH topology
1N0NA 1MNGA 4F6EA 2AW9A 3KKYA 3K9SA 1EN4A 4X9QA 3IC9A 1XDCA 1ZUQA 2QKCA 3AK3A 3TJTA 4GUNA 4JYYA 1LUWA 3OT7A 1LUVA 3DC6A 1AP5A 1EN5A 3QVNA 2RCVA 1BT8A 3C3TA 1PL4A 1BSMA 1AVMA 1D5NA 1B06A 4YIPA 4FFKA 1BS3A 3KDRA 1QNMA 1XUQA 1XREA 1IDSA 5A9GA 1KKCA 2ADPA 3AK1A 1GN3A 4BR6A 1XILA 1ZSPA 3DC5A 3BFRA 1IX9A 3LSUA 3AK2A 2CE4A 3CEIA 3MDSA 2CDYA 1EM1A 1I08A 4YIOA 3RN4A 4E4EA 1GN6A 1PM9A 1EN6A 1AR4A 1N0JA 1P7GA 2P4KA 2ADQB 3EVKA 1AP6A 1IXBA 1SZXA 1JA8A 1MSDA 1ZLZA 1WB7A 1WB8A 1MMMA 4JZ2A 1ZTEA 1VARA 2QKAA 3C3SA 1JR9A 1I0HA 5AG2A 1GN4A 2GDSA 4C7UA 1MA1A 1VEWA 1AR5A 4JZGA 1Y67A 1GN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0N A;  1MNG A;  4F6E A;  2AW9 A;  3KKY A;  3K9S A;  1EN4 A;  4X9Q A;  3IC9 A;  1XDC A;  1ZUQ A;  2QKC A;  3AK3 A;  3TJT A;  4GUN A;  4JYY A;  1LUW A;  3OT7 A;  1LUV A;  3DC6 A;  1AP5 A;  1EN5 A;  3QVN A;  2RCV A;  1BT8 A;  3C3T A;  1PL4 A;  1BSM A;  1AVM A;  1D5N A;  1B06 A;  4YIP A;  4FFK A;  1BS3 A;  1QNM A;  1XUQ A;  1XRE A;  1IDS A;  5A9G A;  1KKC A;  2ADP A;  3AK1 A;  1GN3 A;  4BR6 A;  1XIL A;  1ZSP A;  3DC5 A;  3BFR A;  1IX9 A;  3LSU A;  3AK2 A;  2CE4 A;  3CEI A;  3MDS A;  2CDY A;  1EM1 A;  1I08 A;  4YIO A;  3RN4 A;  4E4E A;  1GN6 A;  1PM9 A;  1EN6 A;  1AR4 A;  1N0J A;  1P7G A;  2P4K A;  2ADQ B;  3EVK A;  1AP6 A;  1IXB A;  1SZX A;  1JA8 A;  1MSD A;  1ZLZ A;  1WB7 A;  1WB8 A;  1MMM A;  4JZ2 A;  1ZTE A;  1VAR A;  2QKA A;  3C3S A;  1JR9 A;  1I0H A;  5AG2 A;  1GN4 A;  2GDS A;  4C7U A;  1MA1 A;  1VEW A;  1AR5 A;  4JZG A;  1Y67 A;  1GN2 A; 
#chains in the Genus database with same CATH topology
 1AB3 A;  3CC4 V;  3KKY A;  4DK0 A;  3RYC B;  1H38 A;  5LOV B;  1SZT A;  2QKC A;  3GWK C;  2UXB O;  4IL6 Z;  3ZN0 A;  5L3C A;  1WPX A;  4GX2 A;  2F4V O;  1FS0 G;  1SKV A;  3WG7 B;  2HVK C;  2R9I A;  4R50 A;  2HJD A;  2RCV A;  1FXK C;  5FNV B;  4U3J B;  1M4U A;  1S72 V;  5FPR A;  2CGO A;  1QLE C;  2LJ2 A;  2XAQ A;  3QG5 A;  2E5L O;  1SC5 B;  4ZIB A;  1WA8 A;  5BR8 O;  4RAI A;  2RNB A;  1K3E A;  3AG1 C;  4K35 A;  1GTO A;  5J9P C;  4UXN A;  2UUC O;  2QJ1 A;  2F23 A;  3K3W A;  3H1H H;  4DRX A;  1Z5V A;  5IYD O;  2V4D A;  1XL6 A;  3E22 B;  2EIM C;  1RPR A;  3JCU Z;  3CEI A;  5H6Q A;  2WLL B;  1OV9 A;  3CRC A;  3MDS A;  1WPB A;  4Z2W A;  1GN6 A;  3G6E V;  4KP4 A;  4HNA A;  2P06 A;  4I4T A;  3CWB H;  3BHP A;  4X62 O;  4GCZ A;  3CCL V;  4G2K A;  1K4C C;  2B5U A;  3WB1 A;  2Q68 A;  4JTA B;  3BVO A;  3CRM A;  4JZ2 A;  1XNQ O;  1NKD A;  2PI4 A;  4DV2 O;  3B8M A;  4DUY B;  2C2A A;  2N04 A;  1BQ0 A;  2ZM6 B;  1YCI A;  4FIP C;  1GN4 A;  4X64 B;  3ICX A;  4TV9 A;  2QDO A;  1B3Q A;  1J5E B;  1K34 A;  1SF9 A;  5K1P A;  4J7Z A;  4UFZ A;  1MZE A;  3OMI B;  2B1G A;  1KD1 W;  1FJG O;  1HDJ A;  5CBG A;  3E8F A;  1VQ9 V;  1PPJ H;  3B09 A;  3F5T A;  4YJ3 A;  3SJC C;  2P67 A;  5KHG A;  4JAS A;  3K5M A;  2R9A A;  4WFB V;  1VQ4 V;  4JI4 O;  1VQO V;  1LUW A;  3P30 A;  5EBM C;  2NNU A;  4DR2 O;  3ZHV A;  1UFI A;  2UUB O;  5KAF Z;  3FB8 C;  1JQ0 A;  4TT3 G;  3MHH C;  1TVK B;  5LP6 C;  3K04 A;  1KMI Z;  4F4L A;  3F7V C;  2AZ0 A;  4HZ3 A;  3ZRX A;  4DV0 O;  1JFF A;  4JAA A;  4JI7 O;  3E86 A;  4UV8 A;  3FYI B;  1XUQ A;  4H33 A;  5A9G A;  1XNR B;  4LR3 A;  3RT3 C;  3HKB A;  4NVP A;  3D3Q A;  3N27 A;  3DTU B;  4P9P A;  4GYC B;  3ZRW B;  1AJN A;  3S3X A;  5JCO C;  3JCZ A;  5LGN A;  2Q7G A;  1VF6 A;  1FXK B;  4IT5 A;  5JCO A;  2BTO A;  1F51 A;  3RW0 A;  1WA8 B;  4MVU A;  1W0K G;  2JRI A;  3D36 A;  4QE9 A;  5KMG A;  4TWK A;  2VWJ A;  4ICG A;  5KA6 A;  1M1K W;  2KB1 A;  2ZQM A;  3OAA G;  3AG1 B;  5F2V O;  3RYF A;  4CS3 A;  5H6R A;  4CZZ A;  2UUA B;  5EZY A;  1KP2 A;  3FFQ A;  1WB7 A;  1WB8 A;  1QU7 A;  1SES A;  3E89 A;  2LGW A;  3VQY A;  4DRX B;  4OPA A;  3ZMT A;  5B66 Z;  1TUB B;  1Y76 A;  3IAY A;  5H5N A;  1JVM A;  3CPW U;  3LNM B;  4DV4 B;  2EIM B;  2QM7 A;  5LYJ A;  3OUF A;  4H0L B;  1I5X A;  1WNS A;  3IFX A;  4LNU A;  1N33 B;  1K7D A;  2R70 A;  4K8Z A;  4OPH A;  2ZT9 B;  3JAR A;  3ABL C;  5HFM A;  3CME V;  4FPP A;  4FK5 C;  1LUV A;  4LF7 O;  4CC5 A;  4G27 B;  1CP9 A;  2CK3 G;  4U7N A;  1BSM A;  4LF6 B;  3BA8 A;  5H2F Z;  1K97 A;  3C90 A;  3T1Y O;  3CCE V;  1EBO A;  1S5J A;  3KDR A;  4O2B A;  1YI2 V;  2ZD9 A;  1Q8I A;  1IDS A;  1M9N A;  4CS2 A;  1YTF D;  2ZIN A;  5J2T A;  4I0X A;  3ZX6 A;  1ORQ C;  4YJ2 A;  2PTM A;  4MT8 A;  1SRY A;  4GX0 A;  3PN1 A;  4Z1V A;  2VWK A;  1H2G A;  1YVW A;  2R9R B;  3ZHQ A;  2DOS A;  5IYZ B;  1PM9 A;  5TIS Z;  5LP6 B;  2K1E A;  4QJF B;  1H2K A;  2DMX A;  1Q90 D;  2HLD G;  3G6B A;  4KL1 A;  2FYU H;  2F95 B;  4XDK A;  4R7C A;  1Q82 W;  3CRR A;  2EIJ C;  1IBK B;  2DE0 X;  1SQG A;  3OEE G;  5CN0 A;  1K5S A;  3HKE A;  3HR0 A;  5JJE B;  4JZG A;  4J9Y B;  4IIJ A;  2LGQ A;  4UVB A;  3OMN B;  3TET A;  3K57 A;  1OZ0 A;  1FXH A;  4DV5 B;  1SQF A;  3U0Z A;  1Y74 B;  4DUY O;  5LBQ A;  5EZY B;  2ZM6 O;  3CCM V;  3SPI A;  1EN5 A;  2IU0 A;  2DYR C;  4X64 O;  2WLM A;  1J5E O;  1PP9 H;  4FMT A;  5EBL C;  1J95 A;  2QWR B;  2CTR A;  4ASU G;  1SQP H;  4MVM A;  5DN6 G;  4KXR A;  3U11 A;  5IJ0 A;  3G67 A;  3E8B A;  3JD2 A;  4YY3 B;  4J10 A;  2QWO B;  2GBO A;  3GVM A;  3ZN1 A;  2Q69 A;  5CA0 B;  4LH6 A;  4JI2 B;  4GZR B;  1XRE A;  2D2C B;  1URF A;  2HJF C;  3FB5 C;  4DR3 B;  4LNU B;  4OGQ B;  1GN3 A;  3GWO A;  1YHQ V;  1SA0 A;  1XIL A;  4TQF A;  4GLX A;  1SS3 A;  3NXS A;  2Y4U A;  1HNX O;  3W7X A;  1Y66 A;  4FZ1 A;  3I5D A;  1LNQ A;  1W59 A;  1EZJ A;  3CXC U;  3SPG A;  1QBZ A;  2UU9 O;  2KQX A;  2PUS A;  3RN4 A;  3CCV V;  2QTO A;  1F4M A;  2V1D A;  3A0R A;  4L87 A;  4NYK A;  5EC2 C;  2ZXW B;  1XNR O;  3T1C A;  4O2B B;  2PY5 A;  4LH7 A;  1AP6 A;  1IXB A;  1FPO A;  3UT5 A;  4BWA A;  2AXT Z;  5EYP A;  2Q0O C;  4UV9 A;  1ZTE A;  2W6I G;  4DUZ O;  5JVD A;  3UO3 A;  4Z1M G;  1NH2 D;  4I0X B;  3NR7 A;  4C7U A;  1SET A;  1V55 C;  2HKO A;  3RYC A;  3JD3 A;  5CA1 A;  3THO A;  5LOV A;  3ABU A;  1Y67 A;  1N8R W;  3BRC A;  1MSW D;  3QNE A;  1L8D A;  4RQE A;  2F66 C;  2RQ6 A;  1Y6X A;  3SPJ A;  2UUA O;  4IYI A;  3K58 A;  3QO8 A;  1R73 A;  1GRJ A;  5EC1 C;  5IWA O;  2WA4 A;  1NZ6 A;  1NQT A;  2Y4T A;  1PL0 A;  5IY5 C;  4J80 A;  5EBW C;  4DV4 O;  1F23 A;  3ETE A;  2EIJ B;  1D5N A;  3BY6 A;  3HKE B;  3UM7 A;  2IJJ A;  3L70 H;  4IIJ B;  3R66 A;  3AG4 C;  3UO2 A;  1YF2 A;  1N33 O;  3FAV A;  4JAV A;  1NS1 A;  2VQF B;  4X66 B;  1GAX A;  4AHC A;  5KLV H;  1BHA A;  4PDV A;  2QWQ B;  2QWP B;  4NTW A;  2PI5 A;  3BFR A;  4QGP A;  5D5P A;  2QWN B;  4I5S A;  2YIC A;  2YI9 A;  4O4J A;  2OTL V;  4NXM O;  4JI1 B;  2DYR B;  4OXS A;  5FLX N;  2OWO A;  4JPR A;  5B1N A;  4H13 B;  1U97 A;  1I7F A;  3CCQ V;  4DV3 B;  4PEL A;  3CCJ V;  1Q6I A;  4UVA A;  1IVS A;  5IYC O;  1EN6 A;  1KEC A;  5IJ0 B;  2UXD B;  5LA6 A;  3CCS V;  2ZNJ A;  2ADQ B;  1XHX A;  2EIN C;  2PZS A;  3H1K H;  2IW5 A;  4LFA B;  2ITC C;  5LGT A;  1SA0 B;  1NR1 A;  4KHP O;  1FFX B;  1I0H A;  4DV7 B;  4MVO A;  3JD4 A;  3M8A A;  4MVQ A;  1NVP B;  3CSX A;  3RVZ A;  2L6L A;  3ETD A;  2XAH A;  3OTO B;  3AG2 C;  2RJZ A;  2WLH A;  2UXN A;  3SYQ A;  4WFA V;  2Q9L A;  4UCV A;  3UT5 B;  1YJW V;  2H3O A;  4ZBM A;  2IBZ H;  2HVJ C;  3OT7 A;  2OTJ V;  1Q5O A;  2E75 B;  1FXV A;  2WSS G;  1TVK A;  1Q81 W;  1IBK O;  1TGO A;  4WF9 V;  3JAS A;  1Q3E A;  4MVZ A;  3ZRS A;  1AVM A;  3QTC A;  2WLK A;  1XMO O;  2OCC C;  3LUT B;  2LQT A;  4FLT A;  1K4D C;  2M6Y A;  1KUQ A;  5CA1 B;  3ABK C;  1V55 B;  3EXA A;  2Q8V A;  5EIB D;  4DR5 B;  4DV5 O;  3CB2 A;  3ZRW A;  1K5Q A;  3DXR B;  3WFV A;  2YXH A;  2EBO A;  3I56 V;  1VQL V;  1Q6H A;  2XAG A;  1ZSP A;  4BIO A;  1FXK A;  2P6J A;  4H44 B;  1FKA O;  2DQ0 A;  2Z5U A;  3LSU A;  1HNW B;  1W2B U;  2NR5 A;  5B3S B;  3DGE A;  4I55 B;  4JYB A;  2CDY A;  2JEU A;  4RWU A;  3CCR V;  2YEV B;  5IY5 B;  2A0L A;  4YY3 O;  4JI2 O;  2OCH A;  2QGN A;  4LCU C;  2R72 A;  1JX9 A;  4JI0 B;  3RVY A;  4DR3 O;  2IM9 A;  3W7U A;  3AG4 B;  4J7K A;  3FAV B;  2FL4 A;  1GKF A;  1MMM A;  1TUB A;  4CH4 A;  1JOY A;  2JGD A;  2QKA A;  4GX5 A;  4DYL A;  1XEQ A;  4R8C A;  1DF5 A;  1XMQ B;  5AG2 A;  4XBF A;  1VF7 A;  3SJB C;  1XBL A;  2VS0 A;  2Y0P A;  4O4J B;  2CTQ A;  2QTS A;  2N74 A;  4FLV A;  4PA3 A;  2RDC A;  4DW0 A;  1GK9 A;  3OGC C;  3RFR A;  4PD4 F;  1H2S B;  4JV5 B;  1M90 W;  1QVF U;  5LA6 B;  3IJ4 A;  1JMK C;  2W6J G;  1Q7Y W;  3OR7 C;  2EIN B;  4J9Z B;  2XUM A;  4W4L A;  2A06 H;  3BAA A;  3HB3 B;  2EIL C;  3E8H A;  1E1R G;  4X1I A;  2AHY A;  4I9W A;  2GUZ B;  3ZED A;  3MAQ A;  1KQS U;  3OTF A;  1NR7 A;  3F7Y C;  2B9Z A;  5LMU B;  2EJR A;  3UKM A;  2Y69 C;  5D5Q A;  2JVD A;  3AG2 B;  4DW1 A;  1UPG A;  5B1A B;  2LW7 A;  2JK5 C;  4MW8 A;  4CH5 A;  2YID A;  2ZE6 A;  5IYZ A;  5C93 A;  3JAS B;  1NTK H;  3LSQ A;  5LP6 A;  1K9M W;  3H1J H;  5C8Y B;  2A7W A;  1AJQ A;  1FAF A;  1AI4 A;  1AR4 A;  1XL4 A;  1N0J A;  2VQF O;  2OIE A;  4X66 O;  4G28 B;  2QKS A;  1TAE A;  3BAB A;  1NBM G;  4N21 A;  4CBC A;  2X7R B;  3W7T A;  1G8M A;  2ZNI A;  1VAR A;  4HYO A;  1Q43 A;  3CRQ A;  4P30 A;  2VQE B;  4JI1 O;  1MA1 A;  2YIB D;  3RYH A;  3A0H Z;  1L0L H;  1QLE B;  4DV3 O;  3H01 A;  5B1O A;  1FFT B;  1M56 C;  3P3N A;  2UXD O;  1Y74 A;  3JAM N;  2G38 A;  1IJG A;  4XDJ A;  3ZCC A;  4LF5 B;  4LFA O;  4O4H B;  3ML0 A;  2WAM A;  4MTX A;  1SQV H;  4GT1 A;  4DV7 O;  2JGD B;  3CMA V;  3C3T A;  3G4S V;  2A79 B;  1XI1 A;  4W4K A;  3D3I A;  3PJS K;  2ZDI C;  2QA4 V;  4B3S B;  3H1I H;  5L3G A;  5CA0 A;  1Q86 W;  4B3T B;  1RP3 B;  4WCE V;  3OTO O;  4DR6 B;  3EFF K;  4NXN B;  1IBM B;  2YI8 A;  4O2A A;  4MS2 A;  2ADP A;  1BGY H;  3K08 A;  4P9O A;  3APQ A;  4TV8 A;  1WP8 A;  1BMF G;  1IX9 A;  2JS3 A;  4IHJ B;  4X1Y A;  4DR7 B;  4WFE A;  3OMA B;  4UVC A;  3SYO A;  3BA9 A;  1EM1 A;  2A9H A;  5IJ9 A;  5EIB C;  5GON B;  4X1I B;  1B04 A;  4DR5 O;  2EIL B;  3B77 A;  1BL8 A;  2Q6A A;  2H8P C;  1RM1 C;  1KP3 A;  2ITD C;  4JTD B;  1WAZ A;  3TXS A;  3G71 V;  3OFN G;  3CC7 V;  5B5E Z;  2BE3 A;  4BW5 A;  2AHZ A;  3LDD A;  1HNW O;  2Y69 B;  3FYE B;  1THZ A;  1Z5W A;  2XND G;  2ZE5 A;  4QIW F;  1EFR G;  2WWW A;  1PNK A;  1YIJ V;  5DED A;  3ABT A;  1GN2 A;  1N0N A;  2BSK B;  4JI0 O;  4DR1 B;  3UCS C;  2GTA A;  2KG7 A;  4UB8 Z;  2ZR3 A;  4TQD A;  4QE7 A;  1YJ9 V;  3AK3 A;  2V7Q G;  3H9V A;  3FB7 C;  2AZ2 A;  2ZKO A;  4QPJ A;  4JI6 B;  4B7K A;  4GKK B;  3CC2 V;  4NR1 A;  1XMQ O;  1AP5 A;  3ETG A;  2GTS A;  4NKG B;  4FVM A;  5ITZ B;  1L0N H;  4EFE A;  3RYH B;  1P7B A;  1AI6 A;  1YZB A;  3BPZ A;  2CTP A;  4I9Q A;  4JV5 O;  3ABM C;  5JWP A;  4LF4 B;  1M56 B;  1T5E A;  2QM8 A;  1KKC A;  2JJ2 G;  2GSM B;  1YJN V;  1GO3 F;  2XHB A;  1M93 A;  3B8N A;  3J80 N;  3P3P A;  4ZHQ A;  3SGI A;  1R3L C;  3LDC A;  1BQZ A;  5JJN B;  1VQP V;  5LMU O;  1KKD A;  1P7G A;  4X1K B;  5LHH A;  3I55 V;  1KYO F;  4O2A B;  1FFX A;  1PV0 A;  3ABL B;  1OCC C;  2CTW A;  4J42 A;  3CS5 A;  4ZI7 A;  2FKX A;  1AI7 A;  3AG3 C;  2RN9 A;  4TV8 B;  3HPL C;  3CCU V;  2EJ7 A;  2UUC B;  1E1Q G;  1ZX3 A;  4D6T H;  3VQV A;  4X1Y B;  2ATK C;  5CA3 A;  1AR1 B;  1G4Y B;  1AR5 A;  1WJZ A;  5IJ9 B;  2X6C A;  3E2E A;  3VOU A;  4KFM A;  2WLI A;  1OCO C;  2P5O A;  3SJQ C;  3TK1 A;  3K0G A;  2E74 B;  2VQE O;  3JAK A;  3L9D A;  2F93 B;  1MAB G;  1S0V A;  2EIK C;  2Q7E A;  3K5N A;  2CH7 A;  3CXH F;  4I7Z B;  3LDE A;  4Q20 A;  3X2Q C;  1QLN A;  1RSO B;  5LXT B;  5J2U A;  3DXR A;  1G6U A;  1BS3 A;  4LF5 O;  3WU2 Z;  3K06 A;  2WLJ A;  1BCC H;  4LF9 B;  2KG7 B;  2Q0A A;  2Q4P A;  3AK1 A;  4MTG A;  5EK0 A;  1KU9 A;  2JS5 A;  2W0X A;  1JPX A;  1HR0 B;  2JIZ G;  1IUR A;  4I55 A;  3DC5 A;  1K8A W;  2YXY A;  1N4C A;  5LHG A;  5LGU A;  1K73 W;  1G1X B;  1NT2 B;  4B3S O;  2YEV A;  2W0F C;  5LMN B;  1H2M A;  5K1X A;  1QHT A;  3K5L A;  1N34 B;  4AQY B;  4B3M B;  4FLW A;  1SQX H;  3WB2 A;  4DR2 B;  1O9G A;  4DR6 O;  4DK1 A;  4GKJ B;  4NXN O;  1IBM O;  3ZMV A;  5KHH A;  1XHZ A;  4PA6 A;  1U96 A;  4D7T A;  4ZOL A;  4I50 A;  4WFH A;  1IBL B;  2HG5 C;  1OHH G;  5BZB A;  4JI8 B;  4JTC B;  2YSU B;  2DYS C;  3OUS A;  4LF6 O;  2X0L A;  1HWY A;  4DR7 O;  2PGG A;  3HKC B;  3B4S A;  1JJ2 U;  1WP7 A;  2B1I A;  1X59 A;  4LFC B;  4K3A A;  2X6B A;  4ZHQ B;  1RPO A;  4TSF G;  4JAU A;  4YIP A;  1R6T A;  2O57 A;  1HNZ B;  2XAJ A;  2DJV A;  3P32 A;  1F4N A;  2EZO A;  4X9Q A;  3IC9 A;  1XDC A;  3HKD A;  3VBB A;  2P22 C;  3JAW A;  3K5O A;  3IGA C;  5HFL A;  4ZI7 B;  4TUY A;  1QR9 A;  1S3J A;  4FM0 A;  3RBZ A;  3ZMZ A;  1OCC B;  2IH3 C;  3E83 A;  2ETN A;  2GUZ A;  3AG3 B;  1ARO P;  3T4D A;  2GV9 A;  3OEH G;  4DR4 B;  2DWE C;  4PA7 A;  1I94 B;  2ODM A;  4DR1 O;  4LWS A;  1P84 F;  4Q6G A;  4FLY A;  2XAS A;  4O4L A;  1GM8 A;  2NN4 A;  4MW3 A;  1M57 C;  3ZHU A;  4JI6 O;  3L75 H;  1OCZ C;  2F1M A;  3SJA C;  4GKK O;  4PDM A;  2WLI B;  3M99 B;  4BR6 A;  2YDE A;  1M5I A;  3D8C A;  3H1L H;  1OCO B;  2OIG A;  1QCE A;  4HAM A;  5C8Y A;  3DSQ A;  3JAK B;  2ARH A;  3E8G A;  4FM2 A;  3STL C;  1VQM V;  3VQX A;  2HR3 A;  2CH7 B;  5GTH Z;  3K79 A;  2EIK B;  3KG2 A;  5J2U B;  1FOU A;  4LF4 O;  2QE7 G;  3X2Q B;  4DV6 B;  3T1H B;  3BCC H;  4WFF A;  2OYQ A;  2EZP A;  4DV1 B;  1OJH A;  1YDX A;  4PI0 A;  2UXX A;  2P7T C;  4LFB B;  1YSC A;  2XAF A;  4F6R B;  1N32 B;  4LP8 A;  2FB5 A;  2BTQ A;  1KB9 F;  3N2K A;  1H8H G;  1VF5 B;  4R6Z A;  2WA3 A;  3AEI A;  3L72 H;  5L3D A;  5LL6 Y;  4O4H A;  3UQ8 A;  4JYA B;  4X20 A;  1YXB A;  2CUG A;  1AJP A;  2K9P A;  1DLB A;  2LO1 A;  4ZOL B;  4I50 B;  1R3I C;  2Z3Y A;  3JSN A;  4NTX A;  3FX7 A;  4LF8 B;  3QF7 A;  3DC6 A;  4JI5 B;  1DF4 A;  1E79 G;  1PL4 A;  2DYS B;  3TGU H;  4RQF A;  1NI8 A;  3GB7 C;  1V9P A;  4FFB A;  2PYL A;  1Y4M A;  3L73 H;  3KZI Z;  1QNM A;  2ZE8 A;  4YHH B;  3JD1 A;  2Z0A A;  5BXZ A;  2DN9 A;  1IZ3 A;  2LFS A;  2A3Q A;  1YTF B;  1PD3 A;  2IH1 C;  3B2E E;  3HKD B;  3JAW B;  4JI3 B;  4IHJ A;  1ROP A;  4AI8 A;  3OW2 U;  3SDL A;  1UJW B;  1OCR C;  3OGI B;  4TUY B;  5GON A;  3LSS A;  3ETQ A;  2CE4 A;  4BIZ A;  1B6Q A;  1MG1 A;  5JH7 A;  3ZHR A;  5KHK A;  4YIO A;  5KAI Z;  4E4E A;  1S5H C;  4LWS B;  4LF9 O;  1CPY A;  2HFE C;  5E79 Z;  5CBH A;  4O4L B;  4N23 A;  2UXC B;  4K0K B;  4BW9 A;  1HR0 O;  2MK3 A;  5CB4 A;  1M57 B;  4OX9 B;  1S77 D;  1SQB H;  1GM9 A;  1OCZ B;  5KHJ A;  2DQ3 A;  3SR2 C;  3C3S A;  4XDL A;  5LMN O;  3T4Z A;  3Q4H B;  1WN7 A;  5H9C A;  1N34 O;  4B3M O;  4AQY O;  3LNN A;  1ZL8 A;  2BSK A;  5GW7 A;  5B1B C;  4GKJ O;  1SQQ H;  2OCC B;  3J81 N;  1NVP D;  4MSW C;  3ZIA G;  1HNX B;  3ABK B;  2ZE7 A;  4F6E A;  5KA5 A;  2AW9 A;  1IBL O;  1ZWI C;  5GTI Z;  5KUM A;  2UU9 B;  2ZR2 A;  1ZUQ A;  5KX5 A;  4JI8 O;  1DGS A;  4PDR A;  4JYY A;  2JEX A;  3ASO C;  4J7J A;  4J11 A;  5ITZ A;  1S5L Z;  1W0J G;  3S3W A;  3ZJZ A;  3A8T A;  4LFC O;  4FJC C;  1VMG A;  2BTQ B;  3N2K B;  4UCO A;  1H8E G;  3CP1 A;  4D7S A;  1VF6 C;  4DUZ B;  5IE9 A;  2NLJ C;  2IU3 A;  4HBN A;  1XOU A;  4J41 A;  1HNZ O;  1ENV A;  3B40 A;  4PJ0 Z;  4JGS A;  3D36 C;  2YXL A;  4X20 B;  3G80 A;  4JF3 A;  1VP7 A;  4X89 A;  2LFR A;  1JNB A;  5BMV A;  4MTF A;  3CX5 F;  2YIA A;  5KUK A;  1A32 A;  1US6 A;  3W7S A;  4KUM A;  1R6K A;  1GH6 A;  2ZDI A;  1VQ7 V;  4DR4 O;  1I94 O;  4X1K A;  2BOC C;  1I08 A;  2F43 G;  5IWA B;  2H94 A;  4FFB B;  1P49 A;  5L3E A;  2JGU A;  1NTZ H;  1LR1 A;  2L35 A;  2ZIO A;  3EVK A;  5CBF A;  3M7M X;  4UUJ C;  1SZX A;  1QQC A;  1AI5 A;  4DXW A;  3N2G A;  4HNA B;  1JJO A;  3MHS C;  1NH2 B;  4I4T B;  1FD9 A;  1N36 B;  2KKW A;  1JR9 A;  4FM1 A;  4LC1 A;  4P2Z A;  4MVR A;  3ZMU A;  2HHH B;  1OCR B;  3FD9 A;  4UCT A;  4UCR A;  4PA4 A;  3CD6 V;  3JAL A;  2QM4 A;  5JH7 B;  4DV6 O;  1XQ8 A;  3T1H O;  2Q73 A;  4GX1 A;  4TV9 B;  1V54 C;  1MNG A;  2ZXW C;  4NXM B;  4DV1 O;  1X4T A;  1EN4 A;  1HW7 A;  1ZAU A;  4LFB O;  4FZ0 A;  1N32 O;  1GMG A;  3A0B Z;  1PNL A;  3CRA A;  5CB4 B;  1NTM H;  4YJ3 B;  4FLZ A;  1MOF A;  3QVN A;  2DW4 A;  1BT8 A;  4QPK A;  1RSO A;  3TCU A;  5LXT A;  4B3R B;  5A2Q N;  4CH6 A;  2Q7H A;  2IJI A;  1MZF A;  4X65 B;  3U10 A;  3ZRV A;  1QVG U;  1ZL8 B;  2Y0I A;  3ZHT A;  1PKX A;  2M7W A;  4KHP B;  5E1A C;  1H5W A;  4JYA O;  2YS8 A;  5B1B B;  3EHB B;  4CH3 A;  3R65 A;  4NTY A;  3OR6 C;  2Q67 A;  2LW1 A;  2P90 A;  4U3F H;  5KX5 B;  4LF8 O;  1JFF B;  3ZBH A;  4JI5 O;  4UCU A;  3BEH A;  3ASO B;  3ZMS A;  3HKB B;  4DO2 A;  2RMK B;  1CEZ A;  5L3F A;  1VIB A;  1O9H A;  1BE3 H;  5JQG A;  2GHY A;  3QO7 A;  3OM3 B;  4B7E A;  4YHH O;  4PHZ A;  4QNH B;  3RGB A;  2P4V A;  3WB0 A;  1FYJ A;  1XMO B;  1JCH A;  4JI3 O;  2YUA A;  3HKC A;  1MSD A;  5JJJ B;  2MW2 B;  4RUE A;  3RYI A;  1F7Y A;  3CYO A;  2UXB B;  5KMG B;  3VQW A;  2F4V B;  2IJH A;  5BMV B;  1BZK A;  2DWD C;  2PF4 E;  3RYF B;  5IYB O;  4JYC A;  4EB6 A;  3T2M A;  1YIT V;  1K33 A;  4O4I A;  1L1F A;  3SYC A;  2FML A;  2E5L B;  3QO5 A;  4A5U B;  2ZIM A;  1Y76 B;  5BR8 B;  3K03 A;  4NB5 A;  4B08 A;  3RWR D;  5LHI A;  1IXM A;  4X88 A;  3CJH A;  2UXC O;  4IGG A;  4K0K O;  2Q5Z A;  3TJT A;  5LYJ B;  4OX9 O;  4E2L A;  3JAT A;  3SPH A;  2HEP A;  3IC7 A;  3KCY A;  3N2G B;  2QEX V;  5DEC A;  3JAR B;  1S76 D;  5DM6 V;  1QR8 A;  1H2N A;  3F5W C;  1B06 A;  2CGN A;  1TUE B;  2OT5 A;  4WBN A;  3JD0 A;  3JAL B;  1BHB A;  5CMU A;  1P4R A;  3STZ C;  3MD0 A;  2E3C A;  3E35 A;  1AIL A;  1RM1 B;  4FLX A;  3SYP A;  1D5A A;  1V54 B;  4X62 B;  2D3O W;  5IT9 N;  4CS4 A;  2QSA A;  3L74 H;  4TOI A;  1HP8 A;  2YIB A;  1XNQ B;  2Y48 A;  5L3B A;  4DV2 B;  3FKS G;  3ASN C;  3W7W A;  4WFG A;  3CHX A;  5J2T B;  1R6N A;  2FTK A;  4YJ2 B;  4PDL A;  3JYC A;  3K9A A;  1VQ5 V;  4AIL C;  1CXZ B;  1H2L A;  4F6R A;  4MTO A;  2P4K A;  3WG7 C;  1FJG B;  3J7A U;  1JA8 A;  3SYA A;  3ZHS A;  2KSD A;  2WPD G;  2JDI G;  2EX3 A;  4JI4 B;  5FNV A;  4U3J A;  4YXW G;  4H37 A;  4B3T O;  4PA9 A;  5B3S C;  2UUB B;  3APO A;  5JQG B;  2LP7 A;  1YEW A;  1DK1 A;  1R3J C;  1K92 A;  4PI2 A;  2CAZ C;  3ABM B;  2N05 A;  3K9S A;  1NU1 H;  4DV0 B;  2XOK G;  2ZCE A;  4RUF A;  1VQK V;  4JI7 B;  1DTO A;  4GUN A;  3A2F A;  1PNM A;  4BAY A;  1N36 O;  1TA8 A;  4UB6 Z;  2XT9 A;  4EKW A;  3RYI B;  1KBH A;  2ILM A;  4FLU A;  3O65 A;  1Q6U A;  3E22 A;  4CC6 A;  4IYH A;  4ZKI A;  2HHH O;  2WLL A;  3OD4 A;  3SPC A;  5KHI A;  2HP8 A;  2X6A A;  4EB6 B;  4O4I B;  5IDJ A;  2JJ1 G;  3L71 H;  1GM7 A;  4FFK A;  3KCX A;  4K8X A;  2E76 B;  3K0D A;  1VQN V;  3CJH B;  2VRZ A;  2IJK A;  5BY1 A;  2PYJ A;  1Z2G A;  1I5Y A;  2XTA A;  1KC8 W;  3JAT B;  4B3R O;  4U7O A;  2BCC H;  3ZS8 C;  3TXQ A;  3K59 A;  4X65 O;  4L8J A;  3AK2 A;  4RO2 A;  1NJI W;  3OE7 G;  1SER A;  4PV1 B;  1VQ8 V;  4WBN B;  4ABM A;  1R1B A;  1R3K C;  4X8A A;  2BOB C;  3CE2 A;  2YC0 A;  3Q4H A;  5FPO A;  5B1A C;  1ZLZ A;  2AGA A;  2EUL A;  2WLN A;  4UCS A;  1WLE A;  1RFY A;  3FB6 C;  2QR4 A;  1D2D A;  5EYP B;  4BIU A;  4LF7 B;  3AG7 A;  2GDS A;  5FL7 G;  4EFB A;  4MVS A;  5JVD B;  3O9O A;  1VEW A;  4LBE C;  3ASN B;  4EEQ A;  1COW G;  1EZV H;  3JSL A;  1VQ6 V;  3T1Y B; 
#chains in the Genus database with same CATH homology
 1N0N A;  1MNG A;  4F6E A;  2AW9 A;  3KKY A;  3K9S A;  1EN4 A;  4X9Q A;  3IC9 A;  1XDC A;  1ZUQ A;  2QKC A;  3AK3 A;  3TJT A;  4GUN A;  4JYY A;  1LUW A;  3OT7 A;  1LUV A;  3DC6 A;  1AP5 A;  1EN5 A;  3QVN A;  2RCV A;  1BT8 A;  3C3T A;  1PL4 A;  1BSM A;  1AVM A;  1D5N A;  1B06 A;  4YIP A;  4FFK A;  1BS3 A;  3KDR A;  1QNM A;  1XUQ A;  1XRE A;  1IDS A;  5A9G A;  1KKC A;  2ADP A;  3AK1 A;  1GN3 A;  4BR6 A;  1XIL A;  1ZSP A;  3DC5 A;  3BFR A;  1IX9 A;  3LSU A;  3AK2 A;  2CE4 A;  3CEI A;  3MDS A;  2CDY A;  1EM1 A;  1I08 A;  4YIO A;  3RN4 A;  4E4E A;  1GN6 A;  1PM9 A;  1EN6 A;  1AR4 A;  1N0J A;  1P7G A;  2P4K A;  2ADQ B;  3EVK A;  1AP6 A;  1IXB A;  1SZX A;  1JA8 A;  1MSD A;  1ZLZ A;  1WB7 A;  1WB8 A;  1MMM A;  4JZ2 A;  1ZTE A;  1VAR A;  2QKA A;  3C3S A;  1JR9 A;  1I0H A;  5AG2 A;  1GN4 A;  2GDS A;  4C7U A;  1MA1 A;  1VEW A;  1AR5 A;  4JZG A;  1Y67 A;  1GN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...