1VARA

Mitochondrial manganese superoxide dismutase variant with ile 58 replaced by thr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQTALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Human mitochondrial manganese superoxide dismutase polymorphic variant Ile58Thr reduces activity by destabilizing the tetrameric interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 69
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 1996-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1varA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1varA02
4JYYA 1VARA 1D5NA 1XREA 5AG2A 1AP6A 2GDSA 1XDCA 3AK1A 3KKYA 5A9GA 1IXBA 4F6EA 1GN6A 2QKCA 3OT7A 1MSDA 1JA8A 2AW9A 1LUVA 1GN2A 1I0HA 4C7UA 1MMMA 3K9SA 1P7GA 3LSUA 4YIPA 4JZ2A 1EN4A 1WB7A 1BT8A 1AR5A 4E4EA 1AP5A 1JR9A 2P4KA 3DC5A 1EM1A 1KKCA 1PM9A 3MDSA 1ZLZA 3QVNA 1IX9A 1BSMA 1I08A 1GN3A 1EN5A 1N0NA 3AK3A 2RCVA 1PL4A 3IC9A 1XUQA 1AVMA 2ADPA 3RN4A 1ZTEA 3TJTA 4FFKA 1AR4A 4JZGA 1MNGA 1VEWA 1BS3A 1Y67A 1WB8A 4YIOA 3CEIA 1N0JA 1QNMA 3DC6A 1XILA 1SZXA 3C3TA 1LUWA 1EN6A 1ZUQA 4BR6A 4X9QA 1GN4A 1IDSA 2ADQB 4GUNA 2QKAA 1B06A 2CDYA 3EVKA 3C3SA 2CE4A 1ZSPA 3BFRA 3AK2A 1MA1A
chains in the Genus database with same CATH superfamily
4MVSA 3IC7A 1FJGO 1YEWA 2VRZA 1JFFB 2WLKA 2YICA 3W7TA 2KKWA 4B3TB 3CRQA 3WFVA 4IGGA 1H2NA 5CN0A 3CYOA 1M57C 2MW2B 4O2AA 2ZXWB 1Q5OA 4KFMA 2HJFC 2YIDA 4X65B 1KU9A 1JQ0A 3HKBB 1VQ4V 4DV3O 3EXAA 3K03A 3C90A 4X8AA 4DV1O 2PZSA 1K7DA 1R6NA 2WA3A 1IZ3A 5JJEB 1NTZH 2P7TC 4GX2A 2GV9A 2ZKOA 2W6JG 3LDDA 4ZOLA 2YIAA 4PA6A 2EILB 2WLNA 4FLZA 3LNMB 2RCVA 2CUGA 3ZMTA 2YIBA 4H33A 4OGQB 4X66O 1N36B 2DYRB 4ZHQB 2XOKG 2UXCB 5EBWC 1JVMA 2YS8A 2K1EA 3RVZA 2YXLA 5KX5B 1VQLV 4MVQA 4HAMA 3ZJZA 1SC5B 3CEIA 3ZMSA 1GRJA 4MT8A 5IYCO 3QO7A 5BZBA 5IJ0B 1LUWA 4I50B 1KYOF 1ZUQA 3BA9A 2X6BA 1YXBA 4DW0A 1HNZO 1KB9F 3F7VC 1ZWIC 2LW7A 4KUMA 4MS2A 3W7UA 1Q86W 1FXVA 4G28B 5JQGA 3BFRA 3GWKC 1DF4A 2F95B 1HWYA 1MA1A 3B2EE 4NXNB 4JF3A 2DWDC 3D3QA 3FAVA 5DM6V 1FXKB 2PGGA 2N04A 2NR5A 1A32A 4EB6B 3CCJV 4FMTA 2UXXA 4DR1B 2EIKC 3K0GA 3UT5B 3CJHB 1JA8A 3A8TA 2V1DA 3ZMUA 3X2QC 4TV9A 3LSSA 1TVKB 1AI4A 2O57A 2Q4PA 2HHHB 4LFAB 1XBLA 3DXRA 1J95A 2VS0A 5C93A 2EIMC 4CC5A 1HNXO 5LA6B 1URFA 1WB7A 2QSAA 4JTCB 3SYAA 1XMQO 4KHPO 4EEQA 5GTHZ 1H2GA 4LF5O 5KAIZ 5BR8B 2UUBB 2DYSC 2YDEA 3ZHQA 4JGSA 2XAHA 3A0RA 5JVDA 1BSMA 4IIJB 2CTPA 2XHBA 1G4YB 4J41A 1EN5A 4X62B 1KBHA 5L3DA 5B1NA 3TGUH 1PL4A 1CPYA 3BPZA 3OTOO 4LF6B 4LF9B 5JH7A 3ABKB 4X1IA 4I5SA 4LH6A 3I56V 5KA6A 1US6A 4Q6GA 3SJCC 1NR7A 4TQDA 3CS5A 3ETQA 1L0NH 1RP3B 2IJKA 2HLDG 3ASNB 3KCYA 3BVOA 2N74A 4DR5O 1YIJV 4RAIA 2Q8VA 4JI8B 3WU2Z 3OE7G 3SJBC 3ZX6A 3C3SA 2CE4A 1VQ5V 2ILMA 4O4IA 2EZOA 3N2KA 4P30A 2C2AA 2YI9A 2HJDA 5AG2A 3O9OA 3AG2C 3HKDA 2IJIA 4LBEC 1O9GA 2F43G 1IXBA 4RQEA 1OHHG 2A9HA 3K0DA 2Q0OC 2HP8A 2HVJC 1K33A 5JCOC 5LOVB 5CA1B 5B1AB 4I0XA 4HNAB 3AG4B 4PDVA 4F6RA 4X20A 1Y74A 2ZD9A 4HBNA 3A0HZ 2XT9A 3K3WA 1YSCA 3JYCA 4X64O 2Y48A 4XBFA 3MHSC 1F51A 4L8JA 2EIJB 3OMNB 2QKSA 4DUZB 3OM3B 4I9WA 4ZI7B 3TCUA 4XDLA 4KP4A 3MHHC 4UCUA 5C8YB 5KMGA 3VQYA 1Q82W 2QM4A 1Q8IA 3HKCA 3L74H 3JATA 4H13B 1WP8A 1L1FA 3T1CA 4ZIBA 4DR3B 4F4LA 3LDEA 1PNMA 1Y76A 2EZPA 3T1YB 1TAEA 4DV6B 3ASOB 1BQ0A 4X1KB 1SF9A 3CB2A 2WLIA 4IYIA 2K9PA 1LNQA 3SPHA 1IDSA 5BXZA 5LYJA 1B3QA 1VQKV 1K97A 2ZIMA 5LP6A 3K58A 1SETA 4RO2A 4PV1B 1UPGA 4ZBMA 1JCHA 1S3JA 1Q6HA 3OEHG 1XEQA 2A7WA 4QNHB 4WF9V 1K92A 1MSDA 4WBNA 2R9AA 5DEDA 4D6TH 4DK1A 1GN2A 2UUAO 4TUYA 2D2CB 4RWUA 4W4KA 4JPRA 1XMOB 3OR6C 1FAFA 2JJ1G 3RBZA 1E79G 2H94A 3CMAV 4YIPA 5A2QN 3L75H 5EBLC 4LNUA 1S5JA 1Z5WA 5LXTA 1GK9A 4LFCB 4R7CA 2E74B 2EBOA 2RJZA 1QVGU 3E89A 4YHHB 4YJ2B 2X7RB 2DN9A 1FS0G 3K5OA 4JI6O 1PM9A 2ITDC 3E22B 4ZKIA 1Q43A 5B1OA 5IT9N 5CMUA 1GN3A 2BOCC 4Z1MG 1VQOV 1VQPV 1N34O 2Y4TA 3JAWA 1VF5B 1XUQA 2BOBC 1NZ6A 1CP9A 2OTJV 3ICXA 3ETGA 5IY5C 3FB8C 3RN4A 1S76D 3TJTA 4JZGA 2Y69B 1BS3A 1PD3A 4JI3O 4TV8A 2JDIG 3CSXA 1WB8A 3CC4V 4EFEA 1KD1W 2L35A 2A0LA 1U96A 4DR7O 3CXHF 4CH6A 3AG7A 4NTXA 3ZHSA 2JJ2G 5EZYB 2IH1C 3S3WA 3ZRWB 3J7AU 1SA0A 2IBZH 3LDCA 3EFFK 2QKAA 1IBLB 1JOYA 4JI4O 4B3TO 3OR7C 4DO2A 1QLNA 3CRCA 3VQVA 1H2KA 3WG7B 4K0KB 1DF5A 5EC1C 3IJ4A 1E1RG 3SYQA 1L0LH 2P6JA 5K1XA 5IYZB 1BE3H 2F4VB 4U3FH 1R3KC 2GHYA 1KP2A 3GVMA 1B6QA 3UKMA 4IL6Z 4JAVA 3SYCA 3G80A 2AW9A 4I4TB 3KG2A 3FYIB 1LR1A 4ABMA 1BL8A 3WB1A 2IU0A 1OCOB 2QEXV 1P7GA 2ETNA 1V55B 1GMGA 2LGQA 2Q67A 2DQ0A 3CPWU 3STZC 5B3SB 2AXTZ 1P7BA 4E4EA 2LQTA 4HYOA 5KHGA 3OUSA 3JALA 2OCCC 1H2LA 3L72H 5JCOA 3ZCCA 1K3EA 3BHPA 3T2MA 4GT1A 4N23A 1N0NA 2UXDB 1MOFA 1GKFA 3K57A 2YXYA 2JS3A 3IC9A 3I55V 4B7KA 1F7YA 3VQWA 1OZ0A 4DV4B 5H6QA 2WAMA 5CB4A 4O4LA 3ABTA 4UV8A 5ITZA 2QWNB 1NTKH 4FFKA 3FYEB 4UVBA 5B1BC 4J42A 4OX9B 2YEVA 1BHAA 4LH7A 3ABLC 3RWRD 1N0JA 4RUFA 2NLJC 1V54B 5FNVA 2MK3A 1I5XA 5GONA 2E3CA 1NH2B 2EULA 4NYKA 4TV9B 3JCZA 5HFMA 2F66C 2W0XA 3FB6C 3SYPA 2FMLA 3DXRB 2OYQA 3UQ8A 1QBZA 2YSUB 1NJIW 4DR1O 5BY1A 1PP9H 2A06H 2Q7EA 1MABG 1M1KW 1YHQV 5TISZ 5IJ9B 2ZR2A 2GDSA 1D5AA 5EYPA 2HHHO 3CHXA 1XDCA 3OD4A 1N33B 4YXWG 1D2DA 5GTIZ 3OEEG 4NVPA 3H1KH 1Y4MA 1LUVA 1COWG 2W0FC 2IH3C 2H3OA 4I55B 2UUBO 3ZMZA 4JI7B 5JH7B 4J9YB 2WLLB 4J11A 2RNBA 3CE2A 4X62O 3B77A 1AP5A 3JAKA 4GKKB 4TQFA 2P4KA 1FFTB 4B3MB 2GTAA 4IT5A 3OUFA 5EBMC 4LF6O 4LF9O 1Q6UA 5H9CA 3OGCC 2DYRC 5LMNB 1IVSA 4DXWA 2QWPB 1DTOA 5CBGA 2BTOA 5H5NA 3ZS8C 2M6YA 1WA8A 1S0VA 1QU7A 3CMEV 1M93A 4DR6B 4FPPA 4JI8O 2B9ZA 1YDXA 3L71H 2NN4A 4FM2A 1XNQB 1OCRB 1AI7A 4OPAA 2ITCC 2R72A 2EJRA 5L3GA 3RT3C 2FKXA 1XL6A 4EKWA 3RYCA 1NH2D 1Q6IA 1Q3EA 5BMVA 3RYHA 5FPOA 4CC6A 3SYOA 4J7KA 2XAQA 4RUEA 1FXKC 4H0LB 2WPDG 4X20B 2ZINA 1M57B 2GBOA 1Y6XA 3JAMN 1D5NA 1XREA 3E8GA 4U3JB 2A3QA 5LP6C 3CRRA 1J5EB 2OWOA 3AK1A 3HPLC 2PI5A 3KKYA 3QO5A 4O2BB 1AROP 3ABUA 4IHJA 4E2LA 2X0LA 1XQ8A 5KMGB 2DOSA 2CTQA 3L9DA 5EC2C 3HKCB 1NTMH 2EJ7A 3T1HO 1W59A 2PYLA 1IJGA 5J2TA 4MVUA 1EN4A 4DUZO 1BT8A 2IJHA 4UB8Z 5LMUB 4ICGA 4QPJA 3U10A 3BCCH 1AJPA 1QCEA 5EK0A 2R9RB 2WLIB 3E8FA 4LWSB 2ZIOA 2Q7GA 4TOIA 1M4UA 2XAJA 4G27B 3K5NA 3E8BA 4DR3O 4GZRB 4J7JA 4WFGA 2Q68A 3JD1A 4DV6O 2UXNA 1AVMA 4PD4F 1I5YA 3ETEA 1QVFU 2ADPA 3Q4HB 4DV5O 4CH4A 4LF4O 1GH6A 4FFBB 1WLEA 3N2GA 1RSOA 1WPXA 3E83A 3IGAC 4UVCA 4BR6A 2RDCA 2UXBB 3SJQC 3JARA 4NXMB 1IBKB 4JI0B 4TUYB 2QJ1A 2QE7G 4MW3A 5HFLA 2B5UA 2EIKB 1U97A 1XI1A 3SJAC 4LNUB 2KG7B 4WCEV 5LXTB 3ETDA 4JI1B 4JTDB 1TGOA 3A0BZ 3X2QB 4UCOA 1ZAUA 4CS4A 1K34A 4K8XA 4WFBV 3CC2V 4P2ZA 2F1MA 4KXRA 1QLEC 1CXZB 1JFFA 1GN6A 2EIMB 3G6BA 1NQTA 5B1AC 2LO1A 3AG4C 1AR1B 3RYIB 4FLTA 2LFSA 2P06A 4YHHO 1OCCB 2H8PC 4LCUC 3U11A 2DYSB 4XDJA 4YJ3B 3LSUA 4MVZA 4DV1B 1RFYA 1SS3A 1VMGA 3OMIB 3A2FA 2ATKC 4GKJO 2ZCEA 1JNBA 5EIBD 4DUYB 4A5UB 1YJ9V 4B7EA 1FKAO 3FB7C 3SPJA 2CAZC 3AG3C 2Y4UA 4AI8A 1I08A 3QF7A 4H44B 4FLWA 3N27A 1TUBA 4PJ0Z 3RYFB 2ZDIC 2HEPA 3CWBH 1F4NA 1KMIZ 1ROPA 1VEWA 1RPRA 1H8EG 3D3IA 4PDRA 3U0ZA 4AQYO 1RPOA 3ZMVA 3QO8A 5L3FA 1UFIA 3FX7A 5KUKA 4MTGA 1HNZB 1YJWV 3LNNA 1FYJA 2WLMA 3P30A 4FZ1A 1EZJA 2JK5C 3BAAA 5IJ0A 1R6KA 2ADQB 2F4VO 1BMFG 1R3LC 2F23A 2ZE5A 4I50A 3W7WA 3AG2B 2GSMB 1FD9A 1B04A 1AJQA 4JASA 3PN1A 2GUZB 1OCZC 3BEHA 2GTSA 3R66A 1H5WA 4JYYA 4Q20A 1AP6A 4B3RB 4O4HA 1W0JG 4KL1A 2QWQB 4QPKA 2Q9LA 5IYBO 4CH3A 4DR2B 3OGIB 2QTSA 2EINB 1FXKA 4HZ3A 4EB6A 3IFXA 1XL4A 3UO3A 5IWAB 3UT5A 4KHPB 4DW1A 3G67A 4O4LB 4LF5B 1TVKA 3TXSA 1QHTA 3TXQA 1I94O 4FLYA 1AR5A 1ORQC 2CH7B 2VQEO 1AB3A 2UXDO 3PJSK 1K9MW 2BSKB 2VWJA 1EM1A 2OIEA 5LA6A 1BGYH 2V7QG 5FNVB 1ZL8B 2FL4A 3JASA 3QVNA 3H01A 2EX3A 3H9VA 5IDJA 2V4DA 1I7FA 1OJHA 2DJVA 4PA4A 3T4DA 3OFNG 2WSSG 5H2FZ 2UUCO 4RQFA 2Y69C 5CA0B 1R3IC 2IW5A 2WLJA 4JYCA 1W2BU 4O4JB 3W7SA 3JSNA 3CCLV 1HR0O 1ZTEA 2LJ2A 2PI4A 4JYBA 3GWOA 4WFAV 4JI5O 5EYPB 4YIOA 2DQ3A 4LF8B 3MAQA 1XILA 3K04A 1SERA 3SPGA 1FFXA 2FB5A 4YY3O 1JJOA 1EBOA 1WN7A 4DR5B 1L8DA 2DW4A 2E5LO 4X9QA 1YZBA 3K08A 1FPOA 5L3BA 3DTUB 1EFRG 3LSQA 4MW8A 1R73A 2L6LA 3JAKB 4LF7O 4JYAB 2E76B 5FL7G 3CCVV 1VQ9V 1YITV 2P5OA 1M5IA 1WAZA 4O2AB 5CBFA 3CRMA 4I9QA 1PV0A 1M56C 1MMMA 2P90A 4PDMA 1S72V 3ZRVA 3JSLA 2ARHA 1QR9A 3SGIA 4UB6Z 3HB3B 5LOVA 5LMNO 1K5SA 2Q7HA 5CBHA 4HNAA 3J80N 4X65O 4EFBA 2OCHA 2FTKA 1SQVH 4ZOLB 3MDSA 5FLXN 1R3JC 1QQCA 2W6IG 1S5LZ 4DR6O 1RM1C 4DYLA 2DWEC 2Z5UA 3B40A 5BMVB 3RYHB 3D8CA 4BWAA 4PELA 2NNUA 3SPIA 3OW2U 1NBMG 1XNQO 4X1YA 5C8YA 4JV5B 2LP7A 1V54C 2DMXA 3AG1B 3BABA 1N36O 2ZM6B 1DLBA 2ZE7A 3M7MX 2UXCO 4N21A 3C3TA 3B09A 4JAUA 4W4LA 4IHJB 2ZDIA 3B4SA 1GN4A 1N4CA 4X1KA 4PI2A 5JQGB 1AI6A 2CK3G 1X59A 1SQBH 3KZIZ 3W7XA 4DR4B 4DV7B 4D7SA 2QDOA 3BRCA 1DGSA 2OTLV 3FAVB 3AK2A 2RN9A 4QE7A 1JJ2U 4UCTA 1VARA 2UU9B 3ABMC 4FLVA 5KHIA 1YF2A 4F6EA 2UUAB 4NXNO 2QKCA 2IJJA 4I7ZB 2BE3A 4MVMA 5LHGA 3WB2A 1DK1A 4DK0A 1SQPH 4JI2B 2AHYA 5LMUO 4J7ZA 5KAFZ 4DV0B 4AILC 3K9SA 3HR0A 4UUJC 4MTXA 3OTFA 1X4TA 1KP3A 4LFAO 5JVDB 2ZXWC 2QA4V 1RSOB 1KKCA 3BA8A 1N34B 2F93B 2LW1A 1HW7A 3K5LA 4YJ2A 1Z2GA 4BW9A 2AZ2A 5BR8O 3E2EA 4NTYA 3CCMV 1H2MA 2YIBD 2ZE6A 3ABLB 3M8AA 3H1LH 4FZ0A 1IBMB 2HVKC 1PPJH 4X1IB 5B5EZ 3DGEA 5J2UA 2ZNJA 3STLC 3ZHRA 5CA3A 3CCEV 2IU3A 4NXMO 2EILC 4DR7B 4JI0O 1O9HA 1Y67A 2YXHA 1HNWB 4LR3A 5D5QA 5K1PA 1HP8A 3VQXA 1XNRB 4JI4B 3HKEA 4JI1O 2BTQA 4IYHA 3RFRA 1SQQH 4P9OA 5KLVH 5LGUA 4O4IB 5EZYA 3N2KB 3ZRWA 5KA5A 4B3SB 1V9PA 5JWPA 1NS1A 1WNSA 1ZSPA 3HKDB 4TT3G 4BIZA 1VQ7V 2OT5A 3F5WC 3G71V 3M99B 2B1GA 2OIGA 1KC8W 3G4SV 3K79A 3P3NA 3QNEA 2AGAA 2QTOA 1JX9A 4Z2WA 4FK5C 3QTCA 5IYZA 5IE9A 4LC1A 1MZFA 2ODMA 2AZ0A 4I0XB 1Q90D 1TUBB 2AHZA 3T4ZA 3TETA 3QG5A 4F6RB 4DUYO 5EIBC 4WFFA 2N05A 1Y74B 4I4TA 4GX5A 4X88A 4PA7A 5L3EA 3E35A 1K4CC 3K06A 1K73W 2KSDA 4NB5A 2PY5A 4PI0A 3ZEDA 2JEUA 2Y0IA 2JGUA 2VQFB 5KHJA 3DC5A 2R9IA 3H1IH 1S77D 3LUTB 2M7WA 1G8MA 3EHBB 1IX9A 5LGNA 2ZT9B 4LP8A 5JJNB 1QR8A 2A79B 3JATB 4LFBB 4K8ZA 3P3PA 1VQ6V 1EZVH 3BY6A 2QGNA 3THOA 2P22C 1Y76B 2E75B 1N8RW 4X89A 1M90W 4O4HB 1YJNV 1K5QA 5IYDO 3ZBHA 4BIOA 3ABKC 5LYJB 1EN6A 3T1YO 3DSQA 3NXSA 1H38A 4B3RO 2JGDA 5LP6B 2HR3A 2ZR3A 3ZHVA 4DR2O 4UCRA 1N32B 3ASNC 2JRIA 4CS3A 4FJCC 5IWAO 4CBCA 2HG5C 4DRXA 1PNKA 4OXSA 4DV2B 1JMKC 3ZRSA 1THZA 4WBNB 3JASB 4GX0A 3IAYA 1OCCC 2XAFA 4UCVA 5IJ9A 3RGBA 3L73H 2CTWA 1JPXA 1FJGB 1VP7A 1UJWB 5J9PC 1GTOA 1H8HG 4R6ZA 1GM8A 2LGWA 1CEZA 2XTAA 5FPRA 2QR4A 5E79Z 4I55A 4OPHA 2YC0A 1XMOO 4MVOA 1VIBA 3ML0A 1M9NA 2ZQMA 2G38A 3ZN0A 5D5PA 2YUAA 2WLLA 2Z3YA 1FFXB 4LFCO 3JAWB 2XAGA 5DN6G 2Q5ZA 2PYJA 3F7YC 1Y66A 4NTWA 4DV3B 2Q6AA 2PUSA 1MSWD 2JVDA 4LF8O 3KCXA 1SQXH 1NU1H 3FKSG 4TV8B 3K9AA 1IXMA 2EIJC 4TSFG 3HKBA 1NR1A 3B8NA 3D36C 3CD6V 4CS2A 4GX1A 4X66B 1SA0B 5L3CA 3JCUZ 1FOUA 1NKDA 4BIUA 4JYAO 5LGTA 3H1HH 3TK1A 2ZE8A 2JS5A 1NT2B 3O65A 1BCCH 3ASOC 1VF6C 4UVAA 1QLEB 4ZHQA 1IBLO 1KQSU 2QWRB 1NVPB 3JD2A 3CCRV 2EINC 5KX5A 2DE0X 2QWOB 4K0KO 1VQ8V 1AJNA 2LFRA 3GB7C 4U3JA 4PA9A 4WFEA 4UV9A 4PHZA 2X6AA 3T1HB 4O2BA 3FFQA 3KDRA 2CTRA 4TWKA 1Z5VA 4UXNA 4X1YB 1HDJA 1SRYA 4MTOA 5LL6Y 3AG3B 3JALB 1Q7YW 3VOUA 3CCQV 1JR9A 3APQA 2QM8A 5F2VO 1WJZA 3OAAG 1SESA 1XHXA 1ZLZA 2Q0AA 5DECA 2HKOA 4JV5O 1HNXB 3SPCA 4JTAB 3CJHA 1XMQB 3I5DA 2ZM6O 4LWSA 2Q69A 5CB4B 3APOA 1BZKA 5ITZB 4GLXA 2QM7A 4DV5B 3FD9A 2JEXA 3UCSC 4LF4B 2YEVB 1GO3F 1YTFB 1E1QG 2P67A 2B1IA 1KUQA 1K4DC 4DV4O 2R70A 3JD4A 5GONB 2WWWA 3H1JH 3Q4HA 4DR4O 4J9ZB 1SQFA 4DV7O 4FFBA 1PNLA 3OTOB 4OX9O 1ENVA 1SZXA 3OMAB 2P4VA 4IIJA 1OCZB 3R65A 1T5EA 4NKGB 3UO2A 2Z0AA 2UU9O 3CRAA 1G1XB 5B66Z 1VQNV 4GCZA 4JI2O 2JIZG 4QE9A 5KHHA 3ZN1A 4DV0O 1NVPD 2KG7A 1PL0A 2WA4A 1FXHA 3FB5C 3NR7A 4QIWF 2HFEC 3WG7C 3WB0A 4MSWC 3OT7A 4FM0A 5KHKA 1BHBA 1P49A 2WLHA 3JD0A 1PKXA 1N33O 3CX5F 2ZNIA 1VQMV 3L70H 5J2UB 4GKJB 3RVYA 1MG1A 3CXCU 3RYIA 4D7TA 3CC7V 3SDLA 3ZHUA 1XOUA 4J10A 4YJ3A 4JI7O 1IBMO 5GW7A 1OCOC 3K59A 1V55C 1IURA 2IM9A 3MD0A 4J80A 1G6UA 4GKKO 5B3SC 2FYUH 3HKEB 1WPBA 4B3MO 2BTQB 4WFHA 1XHZA 4FM1A 1Q81W 5LHHA 1W0KG 3AG1C 2Y0PA 1WA8B 2XNDG 4MVRA 1H2SB 5LHIA 4MTFA 4R50A 4X64B 4FIPC 3VBBA 1HNWO 1SZTA 3CCSV 3UM7A 5CA1A 1MZEA 1GM9A 4AQYB 1XNRO 4FVMA 1YTFD 4XDKA 1R1BA 1YCIA 3RYFA 4BW5A 3G6EV 5IY5B 1BQZA 4FLUA 3RYCB 4B3SO 1NI8A 4NR1A 3B8MA 4GYCB 2XUMA 4L87A 4ZI7A 1AI5A 1AILA 4GUNA 3D36A 3CCUV 4ASUG 2CDYA 4B08A 1GAXA 2BCCH 3F5TA 3J81N 4Z1VA 4U7NA 2GUZA 3E8HA 1M56B 1TA8A 4U7OA 5A9GA 4K35A 1VF6A 5KUMA 1J5EO 4CH5A 1YI2V 1KKDA 4JAAA 4P9PA 3S3XA 2VQFO 1I0HA 5J2TB 5LBQA 1SQGA 3AEIA 4C7UA 1I94B 4K3AA 2VQEB 4PA3A 2KB1A 4JZ2A 2RMKB 2D3OW 4R8CA 4PDLA 2RQ6A 2CGOA 3CP1A 4LFBO 1RM1B 1ZX3A 1S5HC 1KECA 1OV9A 3P32A 2VWKA 2CH7A 2UUCB 2BSKA 3RW0A 2Q73A 1YVWA 1F4MA 1ZL8A 4CZZA 3AK3A 1GM7A 2OCCB 2JGDB 1HR0B 2XASA 2PF4E 1F23A 4JI6B 3E86A 4AHCA 4JI5B 3N2GB 2X6CA 2KQXA 1AR4A 3SR2C 5CA0A 1MNGA 1SKVA 4YY3B 1K8AW 1P4RA 4O4JA 4DRXB 1TUEB 2E5LB 4QGPA 1QNMA 3DC6A 3JARB 5B1BB 3E22A 3K5MA 4QJFB 4UCSA 2PTMA 1N32O 3JD3A 5E1AC 3ZRXA 5H6RA 1R6TA 4JI3B 3ABMB 4DV2O 2YI8A 1WP7A 4FLXA 1B06A 5JJJB 4BAYA 4LF7B 2UXBO 3EVKA 3ZHTA 1OCRC 1IBKO 4H37A 3ZIAG 2CGNA 4UFZA 1VF7A 1P84F 4G2KA
chains in the Genus database with same CATH topology
4JYYA 1VARA 1D5NA 1XREA 5AG2A 1AP6A 2GDSA 1XDCA 3AK1A 3KKYA 5A9GA 1IXBA 4F6EA 1GN6A 2QKCA 3OT7A 1MSDA 1JA8A 2AW9A 1LUVA 1GN2A 1I0HA 3KDRA 4C7UA 1MMMA 3K9SA 1P7GA 3LSUA 4YIPA 4JZ2A 1EN4A 1WB7A 1BT8A 1AR5A 4E4EA 1AP5A 1JR9A 2P4KA 3DC5A 1EM1A 1KKCA 1PM9A 3MDSA 1ZLZA 3QVNA 1IX9A 1BSMA 1I08A 1GN3A 1EN5A 1N0NA 3AK3A 2RCVA 1PL4A 3IC9A 1XUQA 1AVMA 2ADPA 3RN4A 1ZTEA 3TJTA 4FFKA 1AR4A 4JZGA 1MNGA 1VEWA 1BS3A 1Y67A 1WB8A 4YIOA 3CEIA 1N0JA 1QNMA 3DC6A 1XILA 1SZXA 3C3TA 1LUWA 1EN6A 1ZUQA 4BR6A 4X9QA 1GN4A 1IDSA 2ADQB 4GUNA 2QKAA 1B06A 2CDYA 3EVKA 3C3SA 2CE4A 1ZSPA 3BFRA 3AK2A 1MA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYY A;  1VAR A;  1D5N A;  1XRE A;  5AG2 A;  1AP6 A;  2GDS A;  1XDC A;  3AK1 A;  3KKY A;  5A9G A;  1IXB A;  4F6E A;  1GN6 A;  2QKC A;  3OT7 A;  1MSD A;  1JA8 A;  2AW9 A;  1LUV A;  1GN2 A;  1I0H A;  4C7U A;  1MMM A;  3K9S A;  1P7G A;  3LSU A;  4YIP A;  4JZ2 A;  1EN4 A;  1WB7 A;  1BT8 A;  1AR5 A;  4E4E A;  1AP5 A;  1JR9 A;  2P4K A;  3DC5 A;  1EM1 A;  1KKC A;  1PM9 A;  3MDS A;  1ZLZ A;  3QVN A;  1IX9 A;  1BSM A;  1I08 A;  1GN3 A;  1EN5 A;  1N0N A;  3AK3 A;  2RCV A;  1PL4 A;  3IC9 A;  1XUQ A;  1AVM A;  2ADP A;  3RN4 A;  1ZTE A;  3TJT A;  4FFK A;  1AR4 A;  4JZG A;  1MNG A;  1VEW A;  1BS3 A;  1Y67 A;  1WB8 A;  4YIO A;  3CEI A;  1N0J A;  1QNM A;  3DC6 A;  1XIL A;  1SZX A;  3C3T A;  1LUW A;  1EN6 A;  1ZUQ A;  4BR6 A;  4X9Q A;  1GN4 A;  1IDS A;  2ADQ B;  4GUN A;  2QKA A;  1B06 A;  2CDY A;  3EVK A;  3C3S A;  2CE4 A;  1ZSP A;  3BFR A;  3AK2 A;  1MA1 A; 
#chains in the Genus database with same CATH topology
 4MVS A;  3IC7 A;  1FJG O;  1YEW A;  2VRZ A;  1JFF B;  2WLK A;  2YIC A;  3W7T A;  2KKW A;  4B3T B;  3CRQ A;  3WFV A;  4IGG A;  1H2N A;  5CN0 A;  3CYO A;  1M57 C;  2MW2 B;  4O2A A;  2ZXW B;  1Q5O A;  4KFM A;  2HJF C;  2YID A;  4X65 B;  1KU9 A;  1JQ0 A;  3HKB B;  1VQ4 V;  4DV3 O;  3EXA A;  3K03 A;  3C90 A;  4X8A A;  4DV1 O;  2PZS A;  1K7D A;  1R6N A;  2WA3 A;  1IZ3 A;  5JJE B;  1NTZ H;  2P7T C;  4GX2 A;  2GV9 A;  2ZKO A;  2W6J G;  3LDD A;  4ZOL A;  2YIA A;  4PA6 A;  2EIL B;  2WLN A;  4FLZ A;  3LNM B;  2RCV A;  2CUG A;  3ZMT A;  2YIB A;  4H33 A;  4OGQ B;  4X66 O;  1N36 B;  2DYR B;  4ZHQ B;  2XOK G;  2UXC B;  5EBW C;  1JVM A;  2YS8 A;  2K1E A;  3RVZ A;  2YXL A;  5KX5 B;  1VQL V;  4MVQ A;  4HAM A;  3ZJZ A;  1SC5 B;  3CEI A;  3ZMS A;  1GRJ A;  4MT8 A;  5IYC O;  3QO7 A;  5BZB A;  5IJ0 B;  1LUW A;  4I50 B;  1KYO F;  1ZUQ A;  3BA9 A;  2X6B A;  1YXB A;  4DW0 A;  1HNZ O;  1KB9 F;  3F7V C;  1ZWI C;  2LW7 A;  4KUM A;  4MS2 A;  3W7U A;  1Q86 W;  1FXV A;  4G28 B;  5JQG A;  3BFR A;  3GWK C;  1DF4 A;  2F95 B;  1HWY A;  1MA1 A;  3B2E E;  4NXN B;  4JF3 A;  2DWD C;  3D3Q A;  3FAV A;  5DM6 V;  1FXK B;  2PGG A;  2N04 A;  2NR5 A;  1A32 A;  4EB6 B;  3CCJ V;  4FMT A;  2UXX A;  4DR1 B;  2EIK C;  3K0G A;  3UT5 B;  3CJH B;  1JA8 A;  3A8T A;  2V1D A;  3ZMU A;  3X2Q C;  4TV9 A;  3LSS A;  1TVK B;  1AI4 A;  2O57 A;  2Q4P A;  2HHH B;  4LFA B;  1XBL A;  3DXR A;  1J95 A;  2VS0 A;  5C93 A;  2EIM C;  4CC5 A;  1HNX O;  5LA6 B;  1URF A;  1WB7 A;  2QSA A;  4JTC B;  3SYA A;  1XMQ O;  4KHP O;  4EEQ A;  5GTH Z;  1H2G A;  4LF5 O;  5KAI Z;  5BR8 B;  2UUB B;  2DYS C;  2YDE A;  3ZHQ A;  4JGS A;  2XAH A;  3A0R A;  5JVD A;  1BSM A;  4IIJ B;  2CTP A;  2XHB A;  1G4Y B;  4J41 A;  1EN5 A;  4X62 B;  1KBH A;  5L3D A;  5B1N A;  3TGU H;  1PL4 A;  1CPY A;  3BPZ A;  3OTO O;  4LF6 B;  4LF9 B;  5JH7 A;  3ABK B;  4X1I A;  4I5S A;  4LH6 A;  3I56 V;  5KA6 A;  1US6 A;  4Q6G A;  3SJC C;  1NR7 A;  4TQD A;  3CS5 A;  3ETQ A;  1L0N H;  1RP3 B;  2IJK A;  2HLD G;  3ASN B;  3KCY A;  3BVO A;  2N74 A;  4DR5 O;  1YIJ V;  4RAI A;  2Q8V A;  4JI8 B;  3WU2 Z;  3OE7 G;  3SJB C;  3ZX6 A;  3C3S A;  2CE4 A;  1VQ5 V;  2ILM A;  4O4I A;  2EZO A;  3N2K A;  4P30 A;  2C2A A;  2YI9 A;  2HJD A;  5AG2 A;  3O9O A;  3AG2 C;  3HKD A;  2IJI A;  4LBE C;  1O9G A;  2F43 G;  1IXB A;  4RQE A;  1OHH G;  2A9H A;  3K0D A;  2Q0O C;  2HP8 A;  2HVJ C;  1K33 A;  5JCO C;  5LOV B;  5CA1 B;  5B1A B;  4I0X A;  4HNA B;  3AG4 B;  4PDV A;  4F6R A;  4X20 A;  1Y74 A;  2ZD9 A;  4HBN A;  3A0H Z;  2XT9 A;  3K3W A;  1YSC A;  3JYC A;  4X64 O;  2Y48 A;  4XBF A;  3MHS C;  1F51 A;  4L8J A;  2EIJ B;  3OMN B;  2QKS A;  4DUZ B;  3OM3 B;  4I9W A;  4ZI7 B;  3TCU A;  4XDL A;  4KP4 A;  3MHH C;  4UCU A;  5C8Y B;  5KMG A;  3VQY A;  1Q82 W;  2QM4 A;  1Q8I A;  3HKC A;  3L74 H;  3JAT A;  4H13 B;  1WP8 A;  1L1F A;  3T1C A;  4ZIB A;  4DR3 B;  4F4L A;  3LDE A;  1PNM A;  1Y76 A;  2EZP A;  3T1Y B;  1TAE A;  4DV6 B;  3ASO B;  1BQ0 A;  4X1K B;  1SF9 A;  3CB2 A;  2WLI A;  4IYI A;  2K9P A;  1LNQ A;  3SPH A;  1IDS A;  5BXZ A;  5LYJ A;  1B3Q A;  1VQK V;  1K97 A;  2ZIM A;  5LP6 A;  3K58 A;  1SET A;  4RO2 A;  4PV1 B;  1UPG A;  4ZBM A;  1JCH A;  1S3J A;  1Q6H A;  3OEH G;  1XEQ A;  2A7W A;  4QNH B;  4WF9 V;  1K92 A;  1MSD A;  4WBN A;  2R9A A;  5DED A;  4D6T H;  4DK1 A;  1GN2 A;  2UUA O;  4TUY A;  2D2C B;  4RWU A;  4W4K A;  4JPR A;  1XMO B;  3OR6 C;  1FAF A;  2JJ1 G;  3RBZ A;  1E79 G;  2H94 A;  3CMA V;  4YIP A;  5A2Q N;  3L75 H;  5EBL C;  4LNU A;  1S5J A;  1Z5W A;  5LXT A;  1GK9 A;  4LFC B;  4R7C A;  2E74 B;  2EBO A;  2RJZ A;  1QVG U;  3E89 A;  4YHH B;  4YJ2 B;  2X7R B;  2DN9 A;  1FS0 G;  3K5O A;  4JI6 O;  1PM9 A;  2ITD C;  3E22 B;  4ZKI A;  1Q43 A;  5B1O A;  5IT9 N;  5CMU A;  1GN3 A;  2BOC C;  4Z1M G;  1VQO V;  1VQP V;  1N34 O;  2Y4T A;  3JAW A;  1VF5 B;  1XUQ A;  2BOB C;  1NZ6 A;  1CP9 A;  2OTJ V;  3ICX A;  3ETG A;  5IY5 C;  3FB8 C;  3RN4 A;  1S76 D;  3TJT A;  4JZG A;  2Y69 B;  1BS3 A;  1PD3 A;  4JI3 O;  4TV8 A;  2JDI G;  3CSX A;  1WB8 A;  3CC4 V;  4EFE A;  1KD1 W;  2L35 A;  2A0L A;  1U96 A;  4DR7 O;  3CXH F;  4CH6 A;  3AG7 A;  4NTX A;  3ZHS A;  2JJ2 G;  5EZY B;  2IH1 C;  3S3W A;  3ZRW B;  3J7A U;  1SA0 A;  2IBZ H;  3LDC A;  3EFF K;  2QKA A;  1IBL B;  1JOY A;  4JI4 O;  4B3T O;  3OR7 C;  4DO2 A;  1QLN A;  3CRC A;  3VQV A;  1H2K A;  3WG7 B;  4K0K B;  1DF5 A;  5EC1 C;  3IJ4 A;  1E1R G;  3SYQ A;  1L0L H;  2P6J A;  5K1X A;  5IYZ B;  1BE3 H;  2F4V B;  4U3F H;  1R3K C;  2GHY A;  1KP2 A;  3GVM A;  1B6Q A;  3UKM A;  4IL6 Z;  4JAV A;  3SYC A;  3G80 A;  2AW9 A;  4I4T B;  3KG2 A;  3FYI B;  1LR1 A;  4ABM A;  1BL8 A;  3WB1 A;  2IU0 A;  1OCO B;  2QEX V;  1P7G A;  2ETN A;  1V55 B;  1GMG A;  2LGQ A;  2Q67 A;  2DQ0 A;  3CPW U;  3STZ C;  5B3S B;  2AXT Z;  1P7B A;  4E4E A;  2LQT A;  4HYO A;  5KHG A;  3OUS A;  3JAL A;  2OCC C;  1H2L A;  3L72 H;  5JCO A;  3ZCC A;  1K3E A;  3BHP A;  3T2M A;  4GT1 A;  4N23 A;  1N0N A;  2UXD B;  1MOF A;  1GKF A;  3K57 A;  2YXY A;  2JS3 A;  3IC9 A;  3I55 V;  4B7K A;  1F7Y A;  3VQW A;  1OZ0 A;  4DV4 B;  5H6Q A;  2WAM A;  5CB4 A;  4O4L A;  3ABT A;  4UV8 A;  5ITZ A;  2QWN B;  1NTK H;  4FFK A;  3FYE B;  4UVB A;  5B1B C;  4J42 A;  4OX9 B;  2YEV A;  1BHA A;  4LH7 A;  3ABL C;  3RWR D;  1N0J A;  4RUF A;  2NLJ C;  1V54 B;  5FNV A;  2MK3 A;  1I5X A;  5GON A;  2E3C A;  1NH2 B;  2EUL A;  4NYK A;  4TV9 B;  3JCZ A;  5HFM A;  2F66 C;  2W0X A;  3FB6 C;  3SYP A;  2FML A;  3DXR B;  2OYQ A;  3UQ8 A;  1QBZ A;  2YSU B;  1NJI W;  4DR1 O;  5BY1 A;  1PP9 H;  2A06 H;  2Q7E A;  1MAB G;  1M1K W;  1YHQ V;  5TIS Z;  5IJ9 B;  2ZR2 A;  2GDS A;  1D5A A;  5EYP A;  2HHH O;  3CHX A;  1XDC A;  3OD4 A;  1N33 B;  4YXW G;  1D2D A;  5GTI Z;  3OEE G;  4NVP A;  3H1K H;  1Y4M A;  1LUV A;  1COW G;  2W0F C;  2IH3 C;  2H3O A;  4I55 B;  2UUB O;  3ZMZ A;  4JI7 B;  5JH7 B;  4J9Y B;  2WLL B;  4J11 A;  2RNB A;  3CE2 A;  4X62 O;  3B77 A;  1AP5 A;  3JAK A;  4GKK B;  4TQF A;  2P4K A;  1FFT B;  4B3M B;  2GTA A;  4IT5 A;  3OUF A;  5EBM C;  4LF6 O;  4LF9 O;  1Q6U A;  5H9C A;  3OGC C;  2DYR C;  5LMN B;  1IVS A;  4DXW A;  2QWP B;  1DTO A;  5CBG A;  2BTO A;  5H5N A;  3ZS8 C;  2M6Y A;  1WA8 A;  1S0V A;  1QU7 A;  3CME V;  1M93 A;  4DR6 B;  4FPP A;  4JI8 O;  2B9Z A;  1YDX A;  3L71 H;  2NN4 A;  4FM2 A;  1XNQ B;  1OCR B;  1AI7 A;  4OPA A;  2ITC C;  2R72 A;  2EJR A;  5L3G A;  3RT3 C;  2FKX A;  1XL6 A;  4EKW A;  3RYC A;  1NH2 D;  1Q6I A;  1Q3E A;  5BMV A;  3RYH A;  5FPO A;  4CC6 A;  3SYO A;  4J7K A;  2XAQ A;  4RUE A;  1FXK C;  4H0L B;  2WPD G;  4X20 B;  2ZIN A;  1M57 B;  2GBO A;  1Y6X A;  3JAM N;  1D5N A;  1XRE A;  3E8G A;  4U3J B;  2A3Q A;  5LP6 C;  3CRR A;  1J5E B;  2OWO A;  3AK1 A;  3HPL C;  2PI5 A;  3KKY A;  3QO5 A;  4O2B B;  1ARO P;  3ABU A;  4IHJ A;  4E2L A;  2X0L A;  1XQ8 A;  5KMG B;  2DOS A;  2CTQ A;  3L9D A;  5EC2 C;  3HKC B;  1NTM H;  2EJ7 A;  3T1H O;  1W59 A;  2PYL A;  1IJG A;  5J2T A;  4MVU A;  1EN4 A;  4DUZ O;  1BT8 A;  2IJH A;  4UB8 Z;  5LMU B;  4ICG A;  4QPJ A;  3U10 A;  3BCC H;  1AJP A;  1QCE A;  5EK0 A;  2R9R B;  2WLI B;  3E8F A;  4LWS B;  2ZIO A;  2Q7G A;  4TOI A;  1M4U A;  2XAJ A;  4G27 B;  3K5N A;  3E8B A;  4DR3 O;  4GZR B;  4J7J A;  4WFG A;  2Q68 A;  3JD1 A;  4DV6 O;  2UXN A;  1AVM A;  4PD4 F;  1I5Y A;  3ETE A;  1QVF U;  2ADP A;  3Q4H B;  4DV5 O;  4CH4 A;  4LF4 O;  1GH6 A;  4FFB B;  1WLE A;  3N2G A;  1RSO A;  1WPX A;  3E83 A;  3IGA C;  4UVC A;  4BR6 A;  2RDC A;  2UXB B;  3SJQ C;  3JAR A;  4NXM B;  1IBK B;  4JI0 B;  4TUY B;  2QJ1 A;  2QE7 G;  4MW3 A;  5HFL A;  2B5U A;  2EIK B;  1U97 A;  1XI1 A;  3SJA C;  4LNU B;  2KG7 B;  4WCE V;  5LXT B;  3ETD A;  4JI1 B;  4JTD B;  1TGO A;  3A0B Z;  3X2Q B;  4UCO A;  1ZAU A;  4CS4 A;  1K34 A;  4K8X A;  4WFB V;  3CC2 V;  4P2Z A;  2F1M A;  4KXR A;  1QLE C;  1CXZ B;  1JFF A;  1GN6 A;  2EIM B;  3G6B A;  1NQT A;  5B1A C;  2LO1 A;  3AG4 C;  1AR1 B;  3RYI B;  4FLT A;  2LFS A;  2P06 A;  4YHH O;  1OCC B;  2H8P C;  4LCU C;  3U11 A;  2DYS B;  4XDJ A;  4YJ3 B;  3LSU A;  4MVZ A;  4DV1 B;  1RFY A;  1SS3 A;  1VMG A;  3OMI B;  3A2F A;  2ATK C;  4GKJ O;  2ZCE A;  1JNB A;  5EIB D;  4DUY B;  4A5U B;  1YJ9 V;  4B7E A;  1FKA O;  3FB7 C;  3SPJ A;  2CAZ C;  3AG3 C;  2Y4U A;  4AI8 A;  1I08 A;  3QF7 A;  4H44 B;  4FLW A;  3N27 A;  1TUB A;  4PJ0 Z;  3RYF B;  2ZDI C;  2HEP A;  3CWB H;  1F4N A;  1KMI Z;  1ROP A;  1VEW A;  1RPR A;  1H8E G;  3D3I A;  4PDR A;  3U0Z A;  4AQY O;  1RPO A;  3ZMV A;  3QO8 A;  5L3F A;  1UFI A;  3FX7 A;  5KUK A;  4MTG A;  1HNZ B;  1YJW V;  3LNN A;  1FYJ A;  2WLM A;  3P30 A;  4FZ1 A;  1EZJ A;  2JK5 C;  3BAA A;  5IJ0 A;  1R6K A;  2ADQ B;  2F4V O;  1BMF G;  1R3L C;  2F23 A;  2ZE5 A;  4I50 A;  3W7W A;  3AG2 B;  2GSM B;  1FD9 A;  1B04 A;  1AJQ A;  4JAS A;  3PN1 A;  2GUZ B;  1OCZ C;  3BEH A;  2GTS A;  3R66 A;  1H5W A;  4JYY A;  4Q20 A;  1AP6 A;  4B3R B;  4O4H A;  1W0J G;  4KL1 A;  2QWQ B;  4QPK A;  2Q9L A;  5IYB O;  4CH3 A;  4DR2 B;  3OGI B;  2QTS A;  2EIN B;  1FXK A;  4HZ3 A;  4EB6 A;  3IFX A;  1XL4 A;  3UO3 A;  5IWA B;  3UT5 A;  4KHP B;  4DW1 A;  3G67 A;  4O4L B;  4LF5 B;  1TVK A;  3TXS A;  1QHT A;  3TXQ A;  1I94 O;  4FLY A;  1AR5 A;  1ORQ C;  2CH7 B;  2VQE O;  1AB3 A;  2UXD O;  3PJS K;  1K9M W;  2BSK B;  2VWJ A;  1EM1 A;  2OIE A;  5LA6 A;  1BGY H;  2V7Q G;  5FNV B;  1ZL8 B;  2FL4 A;  3JAS A;  3QVN A;  3H01 A;  2EX3 A;  3H9V A;  5IDJ A;  2V4D A;  1I7F A;  1OJH A;  2DJV A;  4PA4 A;  3T4D A;  3OFN G;  2WSS G;  5H2F Z;  2UUC O;  4RQF A;  2Y69 C;  5CA0 B;  1R3I C;  2IW5 A;  2WLJ A;  4JYC A;  1W2B U;  4O4J B;  3W7S A;  3JSN A;  3CCL V;  1HR0 O;  1ZTE A;  2LJ2 A;  2PI4 A;  4JYB A;  3GWO A;  4WFA V;  4JI5 O;  5EYP B;  4YIO A;  2DQ3 A;  4LF8 B;  3MAQ A;  1XIL A;  3K04 A;  1SER A;  3SPG A;  1FFX A;  2FB5 A;  4YY3 O;  1JJO A;  1EBO A;  1WN7 A;  4DR5 B;  1L8D A;  2DW4 A;  2E5L O;  4X9Q A;  1YZB A;  3K08 A;  1FPO A;  5L3B A;  3DTU B;  1EFR G;  3LSQ A;  4MW8 A;  1R73 A;  2L6L A;  3JAK B;  4LF7 O;  4JYA B;  2E76 B;  5FL7 G;  3CCV V;  1VQ9 V;  1YIT V;  2P5O A;  1M5I A;  1WAZ A;  4O2A B;  5CBF A;  3CRM A;  4I9Q A;  1PV0 A;  1M56 C;  1MMM A;  2P90 A;  4PDM A;  1S72 V;  3ZRV A;  3JSL A;  2ARH A;  1QR9 A;  3SGI A;  4UB6 Z;  3HB3 B;  5LOV A;  5LMN O;  1K5S A;  2Q7H A;  5CBH A;  4HNA A;  3J80 N;  4X65 O;  4EFB A;  2OCH A;  2FTK A;  1SQV H;  4ZOL B;  3MDS A;  5FLX N;  1R3J C;  1QQC A;  2W6I G;  1S5L Z;  4DR6 O;  1RM1 C;  4DYL A;  2DWE C;  2Z5U A;  3B40 A;  5BMV B;  3RYH B;  3D8C A;  4BWA A;  4PEL A;  2NNU A;  3SPI A;  3OW2 U;  1NBM G;  1XNQ O;  4X1Y A;  5C8Y A;  4JV5 B;  2LP7 A;  1V54 C;  2DMX A;  3AG1 B;  3BAB A;  1N36 O;  2ZM6 B;  1DLB A;  2ZE7 A;  3M7M X;  2UXC O;  4N21 A;  3C3T A;  3B09 A;  4JAU A;  4W4L A;  4IHJ B;  2ZDI A;  3B4S A;  1GN4 A;  1N4C A;  4X1K A;  4PI2 A;  5JQG B;  1AI6 A;  2CK3 G;  1X59 A;  1SQB H;  3KZI Z;  3W7X A;  4DR4 B;  4DV7 B;  4D7S A;  2QDO A;  3BRC A;  1DGS A;  2OTL V;  3FAV B;  3AK2 A;  2RN9 A;  4QE7 A;  1JJ2 U;  4UCT A;  1VAR A;  2UU9 B;  3ABM C;  4FLV A;  5KHI A;  1YF2 A;  4F6E A;  2UUA B;  4NXN O;  2QKC A;  2IJJ A;  4I7Z B;  2BE3 A;  4MVM A;  5LHG A;  3WB2 A;  1DK1 A;  4DK0 A;  1SQP H;  4JI2 B;  2AHY A;  5LMU O;  4J7Z A;  5KAF Z;  4DV0 B;  4AIL C;  3K9S A;  3HR0 A;  4UUJ C;  4MTX A;  3OTF A;  1X4T A;  1KP3 A;  4LFA O;  5JVD B;  2ZXW C;  2QA4 V;  1RSO B;  1KKC A;  3BA8 A;  1N34 B;  2F93 B;  2LW1 A;  1HW7 A;  3K5L A;  4YJ2 A;  1Z2G A;  4BW9 A;  2AZ2 A;  5BR8 O;  3E2E A;  4NTY A;  3CCM V;  1H2M A;  2YIB D;  2ZE6 A;  3ABL B;  3M8A A;  3H1L H;  4FZ0 A;  1IBM B;  2HVK C;  1PPJ H;  4X1I B;  5B5E Z;  3DGE A;  5J2U A;  2ZNJ A;  3STL C;  3ZHR A;  5CA3 A;  3CCE V;  2IU3 A;  4NXM O;  2EIL C;  4DR7 B;  4JI0 O;  1O9H A;  1Y67 A;  2YXH A;  1HNW B;  4LR3 A;  5D5Q A;  5K1P A;  1HP8 A;  3VQX A;  1XNR B;  4JI4 B;  3HKE A;  4JI1 O;  2BTQ A;  4IYH A;  3RFR A;  1SQQ H;  4P9O A;  5KLV H;  5LGU A;  4O4I B;  5EZY A;  3N2K B;  3ZRW A;  5KA5 A;  4B3S B;  1V9P A;  5JWP A;  1NS1 A;  1WNS A;  1ZSP A;  3HKD B;  4TT3 G;  4BIZ A;  1VQ7 V;  2OT5 A;  3F5W C;  3G71 V;  3M99 B;  2B1G A;  2OIG A;  1KC8 W;  3G4S V;  3K79 A;  3P3N A;  3QNE A;  2AGA A;  2QTO A;  1JX9 A;  4Z2W A;  4FK5 C;  3QTC A;  5IYZ A;  5IE9 A;  4LC1 A;  1MZF A;  2ODM A;  2AZ0 A;  4I0X B;  1Q90 D;  1TUB B;  2AHZ A;  3T4Z A;  3TET A;  3QG5 A;  4F6R B;  4DUY O;  5EIB C;  4WFF A;  2N05 A;  1Y74 B;  4I4T A;  4GX5 A;  4X88 A;  4PA7 A;  5L3E A;  3E35 A;  1K4C C;  3K06 A;  1K73 W;  2KSD A;  4NB5 A;  2PY5 A;  4PI0 A;  3ZED A;  2JEU A;  2Y0I A;  2JGU A;  2VQF B;  5KHJ A;  3DC5 A;  2R9I A;  3H1I H;  1S77 D;  3LUT B;  2M7W A;  1G8M A;  3EHB B;  1IX9 A;  5LGN A;  2ZT9 B;  4LP8 A;  5JJN B;  1QR8 A;  2A79 B;  3JAT B;  4LFB B;  4K8Z A;  3P3P A;  1VQ6 V;  1EZV H;  3BY6 A;  2QGN A;  3THO A;  2P22 C;  1Y76 B;  2E75 B;  1N8R W;  4X89 A;  1M90 W;  4O4H B;  1YJN V;  1K5Q A;  5IYD O;  3ZBH A;  4BIO A;  3ABK C;  5LYJ B;  1EN6 A;  3T1Y O;  3DSQ A;  3NXS A;  1H38 A;  4B3R O;  2JGD A;  5LP6 B;  2HR3 A;  2ZR3 A;  3ZHV A;  4DR2 O;  4UCR A;  1N32 B;  3ASN C;  2JRI A;  4CS3 A;  4FJC C;  5IWA O;  4CBC A;  2HG5 C;  4DRX A;  1PNK A;  4OXS A;  4DV2 B;  1JMK C;  3ZRS A;  1THZ A;  4WBN B;  3JAS B;  4GX0 A;  3IAY A;  1OCC C;  2XAF A;  4UCV A;  5IJ9 A;  3RGB A;  3L73 H;  2CTW A;  1JPX A;  1FJG B;  1VP7 A;  1UJW B;  5J9P C;  1GTO A;  1H8H G;  4R6Z A;  1GM8 A;  2LGW A;  1CEZ A;  2XTA A;  5FPR A;  2QR4 A;  5E79 Z;  4I55 A;  4OPH A;  2YC0 A;  1XMO O;  4MVO A;  1VIB A;  3ML0 A;  1M9N A;  2ZQM A;  2G38 A;  3ZN0 A;  5D5P A;  2YUA A;  2WLL A;  2Z3Y A;  1FFX B;  4LFC O;  3JAW B;  2XAG A;  5DN6 G;  2Q5Z A;  2PYJ A;  3F7Y C;  1Y66 A;  4NTW A;  4DV3 B;  2Q6A A;  2PUS A;  1MSW D;  2JVD A;  4LF8 O;  3KCX A;  1SQX H;  1NU1 H;  3FKS G;  4TV8 B;  3K9A A;  1IXM A;  2EIJ C;  4TSF G;  3HKB A;  1NR1 A;  3B8N A;  3D36 C;  3CD6 V;  4CS2 A;  4GX1 A;  4X66 B;  1SA0 B;  5L3C A;  3JCU Z;  1FOU A;  1NKD A;  4BIU A;  4JYA O;  5LGT A;  3H1H H;  3TK1 A;  2ZE8 A;  2JS5 A;  1NT2 B;  3O65 A;  1BCC H;  3ASO C;  1VF6 C;  4UVA A;  1QLE B;  4ZHQ A;  1IBL O;  1KQS U;  2QWR B;  1NVP B;  3JD2 A;  3CCR V;  2EIN C;  5KX5 A;  2DE0 X;  2QWO B;  4K0K O;  1VQ8 V;  1AJN A;  2LFR A;  3GB7 C;  4U3J A;  4PA9 A;  4WFE A;  4UV9 A;  4PHZ A;  2X6A A;  3T1H B;  4O2B A;  3FFQ A;  3KDR A;  2CTR A;  4TWK A;  1Z5V A;  4UXN A;  4X1Y B;  1HDJ A;  1SRY A;  4MTO A;  5LL6 Y;  3AG3 B;  3JAL B;  1Q7Y W;  3VOU A;  3CCQ V;  1JR9 A;  3APQ A;  2QM8 A;  5F2V O;  1WJZ A;  3OAA G;  1SES A;  1XHX A;  1ZLZ A;  2Q0A A;  5DEC A;  2HKO A;  4JV5 O;  1HNX B;  3SPC A;  4JTA B;  3CJH A;  1XMQ B;  3I5D A;  2ZM6 O;  4LWS A;  2Q69 A;  5CB4 B;  3APO A;  1BZK A;  5ITZ B;  4GLX A;  2QM7 A;  4DV5 B;  3FD9 A;  2JEX A;  3UCS C;  4LF4 B;  2YEV B;  1GO3 F;  1YTF B;  1E1Q G;  2P67 A;  2B1I A;  1KUQ A;  1K4D C;  4DV4 O;  2R70 A;  3JD4 A;  5GON B;  2WWW A;  3H1J H;  3Q4H A;  4DR4 O;  4J9Z B;  1SQF A;  4DV7 O;  4FFB A;  1PNL A;  3OTO B;  4OX9 O;  1ENV A;  1SZX A;  3OMA B;  2P4V A;  4IIJ A;  1OCZ B;  3R65 A;  1T5E A;  4NKG B;  3UO2 A;  2Z0A A;  2UU9 O;  3CRA A;  1G1X B;  5B66 Z;  1VQN V;  4GCZ A;  4JI2 O;  2JIZ G;  4QE9 A;  5KHH A;  3ZN1 A;  4DV0 O;  1NVP D;  2KG7 A;  1PL0 A;  2WA4 A;  1FXH A;  3FB5 C;  3NR7 A;  4QIW F;  2HFE C;  3WG7 C;  3WB0 A;  4MSW C;  3OT7 A;  4FM0 A;  5KHK A;  1BHB A;  1P49 A;  2WLH A;  3JD0 A;  1PKX A;  1N33 O;  3CX5 F;  2ZNI A;  1VQM V;  3L70 H;  5J2U B;  4GKJ B;  3RVY A;  1MG1 A;  3CXC U;  3RYI A;  4D7T A;  3CC7 V;  3SDL A;  3ZHU A;  1XOU A;  4J10 A;  4YJ3 A;  4JI7 O;  1IBM O;  5GW7 A;  1OCO C;  3K59 A;  1V55 C;  1IUR A;  2IM9 A;  3MD0 A;  4J80 A;  1G6U A;  4GKK O;  5B3S C;  2FYU H;  3HKE B;  1WPB A;  4B3M O;  2BTQ B;  4WFH A;  1XHZ A;  4FM1 A;  1Q81 W;  5LHH A;  1W0K G;  3AG1 C;  2Y0P A;  1WA8 B;  2XND G;  4MVR A;  1H2S B;  5LHI A;  4MTF A;  4R50 A;  4X64 B;  4FIP C;  3VBB A;  1HNW O;  1SZT A;  3CCS V;  3UM7 A;  5CA1 A;  1MZE A;  1GM9 A;  4AQY B;  1XNR O;  4FVM A;  1YTF D;  4XDK A;  1R1B A;  1YCI A;  3RYF A;  4BW5 A;  3G6E V;  5IY5 B;  1BQZ A;  4FLU A;  3RYC B;  4B3S O;  1NI8 A;  4NR1 A;  3B8M A;  4GYC B;  2XUM A;  4L87 A;  4ZI7 A;  1AI5 A;  1AIL A;  4GUN A;  3D36 A;  3CCU V;  4ASU G;  2CDY A;  4B08 A;  1GAX A;  2BCC H;  3F5T A;  3J81 N;  4Z1V A;  4U7N A;  2GUZ A;  3E8H A;  1M56 B;  1TA8 A;  4U7O A;  5A9G A;  4K35 A;  1VF6 A;  5KUM A;  1J5E O;  4CH5 A;  1YI2 V;  1KKD A;  4JAA A;  4P9P A;  3S3X A;  2VQF O;  1I0H A;  5J2T B;  5LBQ A;  1SQG A;  3AEI A;  4C7U A;  1I94 B;  4K3A A;  2VQE B;  4PA3 A;  2KB1 A;  4JZ2 A;  2RMK B;  2D3O W;  4R8C A;  4PDL A;  2RQ6 A;  2CGO A;  3CP1 A;  4LFB O;  1RM1 B;  1ZX3 A;  1S5H C;  1KEC A;  1OV9 A;  3P32 A;  2VWK A;  2CH7 A;  2UUC B;  2BSK A;  3RW0 A;  2Q73 A;  1YVW A;  1F4M A;  1ZL8 A;  4CZZ A;  3AK3 A;  1GM7 A;  2OCC B;  2JGD B;  1HR0 B;  2XAS A;  2PF4 E;  1F23 A;  4JI6 B;  3E86 A;  4AHC A;  4JI5 B;  3N2G B;  2X6C A;  2KQX A;  1AR4 A;  3SR2 C;  5CA0 A;  1MNG A;  1SKV A;  4YY3 B;  1K8A W;  1P4R A;  4O4J A;  4DRX B;  1TUE B;  2E5L B;  4QGP A;  1QNM A;  3DC6 A;  3JAR B;  5B1B B;  3E22 A;  3K5M A;  4QJF B;  4UCS A;  2PTM A;  1N32 O;  3JD3 A;  5E1A C;  3ZRX A;  5H6R A;  1R6T A;  4JI3 B;  3ABM B;  4DV2 O;  2YI8 A;  1WP7 A;  4FLX A;  1B06 A;  5JJJ B;  4BAY A;  4LF7 B;  2UXB O;  3EVK A;  3ZHT A;  1OCR C;  1IBK O;  4H37 A;  3ZIA G;  2CGN A;  4UFZ A;  1VF7 A;  1P84 F;  4G2K A; 
#chains in the Genus database with same CATH homology
 4JYY A;  1VAR A;  1D5N A;  1XRE A;  5AG2 A;  1AP6 A;  2GDS A;  1XDC A;  3AK1 A;  3KKY A;  5A9G A;  1IXB A;  4F6E A;  1GN6 A;  2QKC A;  3OT7 A;  1MSD A;  1JA8 A;  2AW9 A;  1LUV A;  1GN2 A;  1I0H A;  3KDR A;  4C7U A;  1MMM A;  3K9S A;  1P7G A;  3LSU A;  4YIP A;  4JZ2 A;  1EN4 A;  1WB7 A;  1BT8 A;  1AR5 A;  4E4E A;  1AP5 A;  1JR9 A;  2P4K A;  3DC5 A;  1EM1 A;  1KKC A;  1PM9 A;  3MDS A;  1ZLZ A;  3QVN A;  1IX9 A;  1BSM A;  1I08 A;  1GN3 A;  1EN5 A;  1N0N A;  3AK3 A;  2RCV A;  1PL4 A;  3IC9 A;  1XUQ A;  1AVM A;  2ADP A;  3RN4 A;  1ZTE A;  3TJT A;  4FFK A;  1AR4 A;  4JZG A;  1MNG A;  1VEW A;  1BS3 A;  1Y67 A;  1WB8 A;  4YIO A;  3CEI A;  1N0J A;  1QNM A;  3DC6 A;  1XIL A;  1SZX A;  3C3T A;  1LUW A;  1EN6 A;  1ZUQ A;  4BR6 A;  4X9Q A;  1GN4 A;  1IDS A;  2ADQ B;  4GUN A;  2QKA A;  1B06 A;  2CDY A;  3EVK A;  3C3S A;  2CE4 A;  1ZSP A;  3BFR A;  3AK2 A;  1MA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...