1I08A

Crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKAHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
total genus 74
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i08A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i08A02
1PM9A 1EN6A 2GDSA 4E4EA 3EVKA 1ZLZA 3AK2A 3MDSA 3K9SA 4JZGA 1LUVA 3CEIA 4JZ2A 1I0HA 1IX9A 5A9GA 3DC5A 1BT8A 1ZSPA 1AP5A 1WB8A 1XREA 1XDCA 2CDYA 4C7UA 2ADQB 1MSDA 1EM1A 1EN4A 1N0JA 3IC9A 1GN4A 1VEWA 1SZXA 3C3SA 3KKYA 2CE4A 1MA1A 3DC6A 3TJTA 1GN3A 4X9QA 1PL4A 2P4KA 1AR4A 1ZTEA 1EN5A 1B06A 2RCVA 1AR5A 4YIPA 4BR6A 1WB7A 1GN2A 1MMMA 1ZUQA 3BFRA 3C3TA 1KKCA 1QNMA 1IXBA 1AVMA 1P7GA 3OT7A 4YIOA 4FFKA 1JA8A 1Y67A 3LSUA 3AK3A 2QKAA 1JR9A 1AP6A 1IDSA 5AG2A 3RN4A 4F6EA 2ADPA 1MNGA 1GN6A 1VARA 1BSMA 3QVNA 1D5NA 3AK1A 1BS3A 1XUQA 4JYYA 2AW9A 2QKCA 1XILA 1I08A 1N0NA 4GUNA 1LUWA
chains in the Genus database with same CATH superfamily
1LR1A 4XBFA 1E1QG 3U11A 2Y48A 3B77A 4FK5C 4ZKIA 3UT5B 5IYZA 1XMQB 2YEVB 4QE9A 1M57B 1IVSA 3RVZA 3EVKA 4O4IB 3HKBA 2KSDA 5C93A 4ZBMA 2YS8A 4MVOA 3JAMN 2AZ2A 1K4CC 2QE7G 4I55A 3FD9A 3QO8A 5JJJB 1F51A 3FB5C 1HNZO 5LHGA 4FVMA 3OMAB 2R72A 4MVQA 5IYBO 1ZSPA 1AP5A 2OIGA 2XAGA 3QO7A 4JGSA 3HKDA 3A0BZ 3ABKB 3C3SA 2IM9A 1AR1B 3THOA 4J42A 1BQZA 1RPRA 2JGDB 2ZNJA 1JFFA 2D2CB 1XBLA 1YZBA 3K5OA 3R66A 2W6JG 4U7NA 4FM2A 5B1BB 2E3CA 2E75B 3E8BA 3CRAA 1Q6HA 4X1YA 5FL7G 1QBZA 4YHHB 2DOSA 2JK5C 3VOUA 4KHPO 3K03A 3BFRA 1P4RA 3CCUV 5LP6B 3OTOO 4FIPC 1Z5WA 4KP4A 2WAMA 1SF9A 1Q5OA 4BW9A 4B3RB 3RFRA 2QKAA 1NTKH 1R3LC 5LMUO 3JALB 4LF6O 4X1KB 5CB4B 1YJ9V 2PYJA 5CA0B 2VS0A 3Q4HB 3CC2V 2WLJA 2EIJB 4TQFA 5D5PA 1COWG 4J7JA 5IWAO 3AK1A 1O9GA 1XUQA 4NKGB 4UUJC 3J80N 5KAFZ 4LF9B 1K33A 1S5LZ 3X2QB 2Z5UA 2WLHA 2PI5A 1QR9A 1R3KC 2YXLA 3STLC 2HLDG 2DYRB 4JYCA 4DUZB 5L3CA 3VQVA 5E79Z 2V1DA 4I0XB 1W0JG 2CK3G 3CD6V 4B3RO 1XHXA 1VQNV 3M8AA 4DV7B 4OGQB 3D8CA 2XT9A 1SA0B 1MSWD 4PDVA 3ML0A 4O4HB 4RQFA 2P67A 1BMFG 4BIZA 5FPRA 4O2BB 2IU0A 4GKKO 1HP8A 5KHGA 3K57A 2F23A 1JFFB 2Y69C 3K5MA 4JV5B 1VIBA 3RYHA 3H01A 1Y66A 1F23A 3MAQA 2FKXA 2EILC 5IJ9A 5LXTA 3K0DA 1D5AA 4PA9A 2VQEO 5LGNA 1ZWIC 2GBOA 3F7YC 4LP8A 4B3TO 1QNMA 1VQPV 1SQGA 1HNZB 2ZDIA 3OUSA 4G2KA 4TOIA 1S0VA 5J2UA 4X64O 2CGNA 1AP6A 2E74B 2GUZB 1JNBA 3RN4A 4N23A 3B4SA 2LGQA 4DV5O 3OW2U 1MNGA 1GN6A 2AGAA 4LNUA 1M1KW 3QVNA 4IHJA 4J11A 4LFAO 3OFNG 2JEUA 1VQ4V 4BAYA 2ILMA 2R70A 2AZ0A 2QKCA 3PJSK 1N0NA 5GW7A 1XMOB 4HYOA 5E1AC 5IT9N 2ITDC 4NXNB 1FKAO 1LUWA 2YUAA 1N36O 3O65A 3RYCA 4B7EA 1IBKO 3AG2C 4DK0A 1IURA 1K97A 3OMIB 1B04A 3RBZA 3OTFA 4K35A 4FLWA 1P49A 2UU9B 2JVDA 2Q7EA 2QM4A 1V9PA 2EIJC 1KU9A 5JQGB 3OMNB 2X7RB 2JEXA 5LA6B 3E83A 2HHHO 4CH3A 3SR2C 2ZR3A 3RYCB 3P32A 4JYAO 3RGBA 5H6QA 5A9GA 2UUBO 4JI3B 1XL4A 5F2VO 3TK1A 1SC5B 2FYUH 1GK9A 4EFEA 4GKJO 3U0ZA 4IYHA 5IJ9B 3JD4A 5LXTB 4EB6A 2CE4A 2YIBD 1K5SA 2FL4A 1VQMV 2M6YA 3OEHG 4GZRB 3B8MA 1JQ0A 1NS1A 3SGIA 4H33A 1OCZC 2QWOB 3KCXA 4FLVA 2NN4A 4LH6A 4QE7A 3TXQA 1GTOA 1WA8B 3EFFK 3MHHC 1SRYA 2JIZG 3H1HH 1VQ8V 4F6RB 1EBOA 3ZN0A 4O4JA 2VQFO 5J9PC 2WA4A 3JARA 2P06A 3ZHQA 3W7XA 3K0GA 3B8NA 1SERA 1BCCH 2ZM6O 2F4VB 3OR7C 2ZDIC 1NR1A 3E2EA 1DK1A 1IJGA 3JD1A 1YHQV 1QLNA 1MOFA 2KG7B 3APOA 5EC1C 1W59A 4LBEC 3E8FA 4UB6Z 5LP6C 4QPKA 1US6A 3ZHVA 4WFHA 2JGUA 4UCRA 1KECA 1FOUA 5CA1B 3ABLC 4NTXA 1NTMH 4DR7O 2X6CA 3BY6A 3K08A 2MW2B 3CCRV 1K3EA 2YI9A 1FD9A 3WB0A 4B7KA 5KLVH 3ASNC 1VQ9V 4W4KA 4I9QA 3LSSA 1DTOA 3AG1C 1WB8A 5KHHA 1RPOA 1EN4A 4PELA 2A3QA 4HAMA 3T1CA 1FAFA 3DXRB 5IJ0B 1HDJA 3CRRA 3W7TA 4IIJB 2H8PC 1M90W 1GM9A 1PPJH 4O4JB 1N36B 3WFVA 2YIAA 2OTJV 1WB7A 1GN2A 3UQ8A 2Q73A 1RP3B 2PGGA 5EBLC 2YI8A 1XI1A 4JAVA 2ZE6A 2KG7A 1QR8A 3DTUB 3L72H 3OGIB 3RYIA 5B1BC 5B5EZ 2Q8VA 2XUMA 4DR3B 4O2AA 4OX9O 5JCOA 3E86A 1GO3F 1FS0G 4MT8A 3UM7A 1CEZA 1JPXA 4X66B 1IZ3A 4Z1VA 1XMQO 2VQEB 4WBNB 3QO5A 3ASOB 3CMAV 2EIMC 4GT1A 1IBLO 1ZAUA 4O2AB 4JI8O 2CH7B 1ROPA 5IDJA 4PDRA 4H13B 5EYPB 3K9SA 1M56B 1JOYA 4PDMA 2Q68A 4JZ2A 3W7WA 4MVSA 1NVPB 2ZXWC 3UO3A 4DR3O 4JI0O 2Y0IA 2ETNA 1WP8A 2ATKC 1FXKC 2ADQB 5H6RA 3T1HB 3LDEA 3ZRXA 4IL6Z 2LP7A 3UCSC 4LF8O 2IJHA 4ZI7B 1M57C 4DV3B 4CS2A 1H5WA 4LF7O 1ZTEA 3K5LA 4IIJA 2UU9O 4JI6O 2QM8A 4WFGA 1EN5A 1F4NA 5CBHA 1YIJV 3CCQV 4DRXA 3AG4C 4DV2B 4FFBB 3AG3C 3C3TA 4LF5O 2EZPA 2QWQB 2CUGA 3GWOA 1Q43A 5KX5A 1Y6XA 2XNDG 2PF4E 4W4LA 4JI2B 3CC4V 5KHJA 3FYEB 1QU7A 4F6RA 1Y67A 3F5WC 4AHCA 1OCRB 1FFXB 2GUZA 4R6ZA 4WBNA 2QTSA 5B1AC 5DECA 1VQOV 4F6EA 5GTIZ 2UUCB 2UUAB 2CH7A 2UXCB 4ZHQA 3BHPA 1XOUA 3VQYA 4I55B 3IAYA 2Q9LA 3VQWA 1O9HA 2K9PA 3KCYA 2Y0PA 3JAWB 2FB5A 2IU3A 3WB2A 4I4TA 4DV2O 4RO2A 1M93A 4LCUC 1FPOA 4MW3A 4X65O 1BHBA 1G4YB 2YXYA 1K4DC 4DV4B 4UFZA 3AG3B 3CEIA 5LHIA 2PTMA 2E5LB 4DV3O 4DR4B 1ZL8B 5C8YA 4I4TB 2DE0X 4UCUA 1VMGA 1IBMO 2EX3A 1YDXA 1N0JA 5IY5C 2OCCB 1KQSU 2JS5A 1Q8IA 2UUAO 3L74H 2UUCO 4JI0B 2A06H 3P3NA 5LA6A 1JMKC 4ICGA 1GN3A 3SJQC 1E1RG 1GM7A 4L8JA 3ZMSA 4TSFG 3FFQA 2RQ6A 2A0LA 4K0KO 4FLUA 1B06A 1S3JA 5K1XA 3ZMVA 2UXDB 2W0FC 3JCUZ 5L3EA 4GX0A 1DGSA 1NBMG 3L70H 4CS4A 3W7SA 5B3SB 4GLXA 1B6QA 2E76B 4P30A 3I55V 3JCZA 3H1IH 3OD4A 1UPGA 1AVMA 5ITZB 1AI6A 1DLBA 4UCVA 3T1YO 1W2BU 2XAQA 1YJWV 4Q20A 4AI8A 4OX9B 4D7SA 1IDSA 2ZD9A 2IJJA 1IBMB 4LF6B 5CA0A 1NJIW 3RVYA 3IC7A 4J9ZB 5FNVA 4MVRA 2OIEA 3KDRA 1H8HG 3CP1A 4DR4O 4OXSA 3SPJA 1HR0O 3T2MA 3F5TA 2DWDC 2Y4TA 1N34O 3SJCC 3CJHB 4X1IA 2QTOA 4LFCO 1XQ8A 4DW0A 3CRQA 1PM9A 3ZRVA 1JJ2U 1PNMA 3I56V 5KUMA 2YIBA 4JI1O 1S76D 3UT5A 4D7TA 1GM8A 5BXZA 5IE9A 1VQ7V 4JI8B 4O4HA 1EZJA 1DF5A 2A79B 1BL8A 2PUSA 2W0XA 3ABMB 2F1MA 4ZOLA 2Z3YA 5C8YB 3ZX6A 5CMUA 1G6UA 4O4LA 1GAXA 2NLJC 5LMNO 1GN4A 1RM1C 4MVZA 4OPAA 3ZEDA 4JASA 1ZX3A 4UB8Z 3N2GA 2AXTZ 3SJAC 4RAIA 1MABG 2P4KA 1AR4A 1K73W 1B3QA 1JVMA 2G38A 4P9OA 3JATA 3K3WA 4X88A 4PA3A 4LWSB 2V7QG 4I7ZB 4DRXB 2RNBA 4XDLA 2WLLB 3J7AU 1N8RW 4NXMO 2BE3A 4LF7B 1WPXA 2H3OA 3QTCA 2PYLA 2B1GA 4LF8B 5JJEB 4MTXA 2EJRA 3JSLA 4TQDA 2YXHA 4RUEA 2GTSA 1Y76B 4QNHB 2D3OW 3M7MX 1AB3A 4DR6B 5A2QN 1WAZA 1KD1W 4JI4O 5EIBD 3AG1B 3ZMZA 2BCCH 1HNWB 1N33O 1W0KG 4QJFB 3ZHRA 1EFRG 4DW1A 2ZXWB 4KL1A 2B9ZA 2Z0AA 3A0RA 1S72V 1TUEB 3AK2A 4CC5A 4DV1B 4TWKA 3CCLV 4X66O 2QM7A 2IH3C 3SYOA 3ABTA 3CWBH 5B3SC 4J41A 2Q0AA 3G6EV 3BA8A 1ZL8A 3OAAG 4H44B 3K59A 3HKDB 1FFTB 1NTZH 2N04A 4FJCC 4PD4F 2LW1A 4GKJB 2DQ3A 1VEWA 4O2BA 4IGGA 4JI3O 4NVPA 1XNRO 1E79G 3A0HZ 3FYIB 3HKCA 2MK3A 4J7ZA 1KBHA 3OTOB 3ZN1A 3S3XA 2HFEC 3RYIB 3T1YB 3LNMB 2RJZA 5DN6G 5CA3A 3RW0A 4MTOA 3H1LH 1XHZA 1JCHA 2X6AA 5IYDO 2HJFC 1IXBA 1VQKV 2Q7GA 3K5NA 2Q67A 2EIMB 4NYKA 3TXSA 3NXSA 2UXDO 4MVUA 4TV9A 4YJ2B 3E35A 2OCHA 3CPWU 3FKSG 3E8HA 4AQYO 5FNVB 1PL0A 2JJ2G 1SZTA 4EEQA 1NKDA 4O4IA 1HNXB 3LDCA 2HJDA 1FJGO 3JYCA 2HEPA 1A32A 3JASA 1H2SB 1RM1B 3CJHA 3SPCA 2CAZC 4TV8A 2ITCC 3FAVA 4B3SO 2N05A 1NU1H 2EZOA 3R65A 4E4EA 5KHKA 4HNAA 5CA1A 1Q81W 5CN0A 2R9RB 2WWWA 3S3WA 2XTAA 1Y4MA 3U10A 2ODMA 2LFRA 1VF6C 5JQGA 3WG7C 2JGDA 2ZR2A 4H0LB 4NXNO 1IX9A 3MHSC 4GX2A 3RYFA 3AG4B 4X89A 2KQXA 2BTOA 3BAAA 1NZ6A 3CE2A 3ASOC 1EM1A 1MZFA 3UO2A 2DWEC 1G1XB 2XOKG 4DV5B 1YJNV 1V55B 3E8GA 2UXBB 3ZRSA 2UXNA 1M5IA 3CSXA 5L3DA 1M4UA 3C90A 3SJBC 2F95B 4ZIBA 1THZA 5LOVB 3FB7C 3N27A 3OGCC 1G8MA 4NR1A 1ZUQA 3ZS8C 4EKWA 4FPPA 1TGOA 4ZI7A 2WLLA 1QQCA 2HG5C 2CTQA 1KKCA 1R6TA 2IH1C 5B1OA 4DV1O 2F93B 3WU2Z 3CCVV 3ZHTA 4FFKA 1KC8W 4B3MB 1P84F 1SQQH 5BY1A 1SQFA 4LF9O 1PNLA 2EINB 2PZSA 2HKOA 3AG2B 4UV8A 4CZZA 1I94B 4JYBA 5KX5B 1HNWO 1N33B 1UFIA 5KMGB 3CHXA 5EZYA 2OWOA 4LF4B 2Q7HA 5JCOC 4U3FH 2HHHB 3WB1A 3CCSV 2DW4A 1YVWA 2IW5A 4JAAA 5EC2C 4JF3A 3LNNA 4BW5A 4LF4O 2EULA 2WLKA 1CXZB 3ETGA 4CC6A 3B2EE 5JVDA 1BHAA 3WG7B 1I94O 3SYAA 3M99B 4FM0A 5IYZB 2QWPB 5LBQA 3K04A 3IFXA 2BTQA 5JH7B 2EBOA 3X2QC 4NXMB 2PI4A 3AEIA 4JZGA 5H2FZ 1OZ0A 2CTRA 1V54B 1HW7A 2ZT9B 4B08A 5B66Z 3DC5A 5EBWC 3OE7G 4MVMA 2N74A 5LOVA 3GWKC 2DMXA 4WFAV 2QGNA 3VQXA 1H2LA 3UKMA 5BZBA 2ZINA 3ZRWB 4JI4B 4DO2A 3LUTB 2YIDA 1Z5VA 1SS3A 1K92A 2QWNB 4J7KA 2E5LO 3ZMUA 3JALA 4DV0B 1YEWA 5JJNB 1JX9A 3LSQA 1FXVA 5HFMA 3RYHB 3JATB 2LGWA 3JSNA 4TV9B 1Q6UA 4MSWC 4TUYB 1FXHA 3B40A 1BZKA 2LFSA 1EZVH 4H37A 4J9YB 2ADPA 4LFAB 1N34B 1X59A 2YSUB 3AG7A 1VQLV 5JWPA 2M7WA 4Z1MG 5JH7A 1BE3H 4K8XA 1I08A 3K06A 4J10A 3ZIAG 1AJQA 3OUFA 5B1NA 4IT5A 1WPBA 1HNXO 4G28B 4FMTA 1EN6A 2LJ2A 4AQYB 2Y4UA 4PI2A 3CCJV 4FLXA 4EB6B 3D3QA 2CTWA 1S5JA 2OYQA 1VF5B 3FB6C 3TCUA 2EILB 4DR5B 4FZ1A 1OCCC 1Q7YW 2L35A 1L0LH 1XREA 4UVBA 1XDCA 2UXXA 3SYPA 1L1FA 1H2KA 1SETA 1HWYA 2WPDG 4JI5O 1N32B 1AJNA 3HR0A 2DYSC 5IJ0A 4GCZA 1Z2GA 2W6IG 3L71H 4LFCB 2GV9A 3OR6C 5D5QA 2YDEA 3KZIZ 5ITZA 2X6BA 4WFEA 1CP9A 5LL6Y 4CH6A 3APQA 4OPHA 4QGPA 1MMMA 3ABMC 4YHHO 3P3PA 3N2GB 2P4VA 5TISZ 1WNSA 4LNUB 3SYCA 4DR2O 1N4CA 4DUZO 4IHJB 5LHHA 2KB1A 3F7VC 2CGOA 1R73A 5HFLA 1JR9A 4X1KA 3CYOA 3QNEA 1XL6A 3ZMTA 5GONB 4LFBB 1WN7A 3IJ4A 2YICA 5KMGA 4DR2B 3K79A 1YTFD 3CCEV 3JASB 3CMEV 3CXHF 5LMUB 1X4TA 2AHZA 2GHYA 4UCSA 1QLEB 1OHHG 2P22C 3BPZA 4UCOA 2VWJA 4JTDB 2GDSA 4U3JB 5J2TB 4PA6A 5BR8B 1GH6A 1KKDA 3HKEB 5LYJB 1R6NA 4KHPB 4JI2O 4DYLA 4R8CA 4JTCB 3CRMA 4DUYO 1JJOA 3BRCA 5K1PA 3CB2A 1BT8A 1I7FA 1T5EA 3J81N 4DR5O 4U3JA 1I5XA 1VQ6V 2CDYA 3BEHA 4C7UA 4X65B 1XMOO 1L8DA 4B3MO 2QA4V 5DM6V 4BIOA 1NH2B 5LYJA 4DV0O 3D36A 1SZXA 1VQ5V 3JAKB 4KFMA 4XDJA 4B3SB 4AILC 1KB9F 5EK0A 1VF7A 4PA7A 2R9AA 3CRCA 5BR8O 2DN9A 5B1AB 2C2AA 4LR3A 2ARHA 1K7DA 1R3IC 1Y74B 3G67A 4NTWA 3CXCU 1KUQA 4YJ3A 1OCOB 4DR7B 1IXMA 1ORQC 4X62O 3VBBA 5J2UB 1SKVA 1YSCA 4R50A 3ETEA 4TV8B 5AG2A 1I5YA 1KP3A 3CC7V 2P7TC 4P9PA 5EZYB 4YY3B 2JS3A 5EBMC 1R3JC 3EXAA 1D5NA 1Y76A 3L9DA 4JYYA 1H8EG 4HBNA 4FLZA 2ZM6B 3T4DA 1U96A 2DJVA 2ZE5A 3TETA 2ZE7A 1KYOF 1FXKB 4GUNA 4YJ2A 3K9AA 1SQBH 3A2FA 2CTPA 1YTFB 3G71V 2O57A 1M9NA 4MS2A 4RUFA 2R9IA 1XNRB 4GX1A 4JTAB 3N2KA 4MTFA 3ZHUA 3SPGA 3T1HO 4BIUA 4MW8A 3H1KH 2B1IA 2OT5A 3BVOA 3G4SV 1P7BA 1RSOA 2X0LA 2BSKB 3JD2A 4DR1O 3BABA 3FAVB 2RDCA 4JI5B 2XAFA 4MTGA 1DF4A 5FPOA 1YF2A 4O4LB 4UXNA 2BTQB 4I0XA 4CBCA 2FMLA 3IC9A 1V54C 1VF6A 3GVMA 1QHTA 2JJ1G 5IWAB 2BSKA 3O9OA 4X9QA 1PL4A 4K0KB 4J80A 4X62B 3EHBB 2PY5A 2Q69A 2RCVA 4LWSA 1OJHA 2Q5ZA 2ZCEA 5CB4A 2WLIB 4RWUA 2ZQMA 2RN9A 1K8AW 2BOBC 1PNKA 3STZC 4CH5A 2IJKA 4LF5B 1K34A 3CS5A 4TUYA 1FXKA 2IJIA 2JDIG 2K1EA 1L0NH 1PP9H 2ZNIA 2EINC 3P30A 5JVDB 1URFA 2P90A 4QPJA 2ZIMA 2VWKA 4LH7A 3HKBB 1YI2V 4UV9A 3QG5A 4KXRA 3FB8C 1VP7A 5H9CA 2Q0OC 5IY5B 3ETDA 4WF9V 2UXCO 1FJGB 1NI8A 2LO1A 2VRZA 1WP7A 4LC1A 4RQEA 3HB3B 2XHBA 3N2KB 2UXBO 3ZJZA 1U97A 1ENVA 1ZLZA 1M56C 2Q4PA 5LMNB 1LNQA 4HNAB 1V55C 3MDSA 4UCTA 4WFBV 4G27B 4YXWG 5LGUA 3BA9A 1PKXA 5KA6A 2HR3A 1TA8A 3SPHA 1NH2D 2EJ7A 4UVCA 3KG2A 4X20A 4BWAA 4JAUA 4EFBA 4JV5O 1XNQB 4I50B 1Q90D 4GX5A 1S77D 1NQTA 2L6LA 4X1YB 2FTKA 2QR4A 1TUBB 5CBFA 4I9WA 3KKYA 4PA4A 1D2DA 1F4MA 2LW7A 2QKSA 1MA1A 4Q6GA 4JI6B 3DGEA 3H9VA 3IGAC 3SPIA 4ZOLB 2P5OA 4DXWA 2H94A 4YJ3B 2F4VO 1R1BA 4U7OA 3QF7A 1MG1A 2IBZH 4HZ3A 1OV9A 2A9HA 2OCCC 3E22A 4ZHQB 1P7GA 2VQFB 4YIOA 1JA8A 3G80A 2KKWA 3LSUA 4CS3A 3SDLA 4UVAA 1QCEA 4X1IB 4Z2WA 2ZKOA 2QJ1A 2LQTA 2F43G 1BSMA 2V4DA 1YXBA 3E22B 4E2LA 1BS3A 3B09A 1Q86W 3D36C 1SQXH 1S5HC 3L73H 5CBGA 4WFFA 3JD3A 2XAHA 4GYCB 1GMGA 1QVGU 3LDDA 4PV1B 4F4LA 3ZHSA 1R6KA 2EIKB 5J2TA 2B5UA 1K9MW 2WLMA 4A5UB 4K3AA 1NR7A 4FZ0A 1NT2B 1FYJA 3HPLC 1TVKA 1RSOB 1WLEA 4CH4A 5DEDA 4L87A 4JI7B 1AI5A 4XDKA 5KAIZ 2QEXV 2Y69B 1MSDA 1XEQA 4I50A 2ZIOA 1GKFA 3NR7A 2F66C 4YY3O 3JAKA 3ZCCA 3DC6A 3TJTA 1Q82W 1XNQO 4GKKB 4DUYB 1PV0A 3ZRWA 3FX7A 1K5QA 1CPYA 2HVKC 1SQVH 5LGTA 4BR6A 3JARB 2WLIA 1MZEA 4PHZA 3H1JH 3D3IA 4X64B 2JRIA 3HKCB 5KHIA 4K8ZA 3OT7A 3I5DA 1FFXA 2HP8A 3ZBHA 4FLTA 4B3TB 2EIKC 3BCCH 5KUKA 1PD3A 4LFBO 1UJWB 4N21A 2YC0A 4DV4O 1VARA 2ZE8A 4DV6B 1NVPD 4JI1B 3ETQA 4IYIA 5L3BA 1GRJA 3HKEA 2AW9A 2HVJC 4DR1B 2GTAA 4P2ZA 4DK1A 1F7YA 4ABMA 4I5SA 1WJZA 4JI7O 5GONA 1H38A 1HR0B 5FLXN 3JAWA 2YEVA 3W7UA 1QLEC 1AROP 4TT3G 5EIBC 1J5EB 1YITV 4JYAB 1TAEA 5KA5A 1BQ0A 1AI4A 2XASA 4JPRA 5IYCO 4DV7O 4PDLA 2AHYA 1QVFU 3DXRA 1AILA 1LUVA 1TVKB 1Q3EA 2A7WA 1BGYH 1SQPH 1OCZB 1I0HA 3RYFB 2P6JA 4R7CA 2Q6AA 4X20B 3PN1A 5H5NA 4KUMA 1IBKB 3CCMV 3ASNB 3TGUH 4X8AA 5BMVB 1SA0A 5GTHZ 1KMIZ 4QIWF 2BOCC 2NR5A 1J95A 1TUBA 1Q6IA 2NNUA 2OTLV 4NB5A 2WA3A 1IBLB 3ABKC 3CX5F 3E89A 3K58A 1SESA 1RFYA 3ABUA 3OEEG 3OM3B 4D6TH 3T4ZA 1OCCB 5BMVA 1AR5A 4YIPA 4NTYA 4ASUG 1AI7A 1H2MA 2GSMB 3L75H 1WA8A 2UUBB 3MD0A 1J5EO 1H2NA 2DYSB 4DR6O 4PJ0Z 2WLNA 2QWRB 3RT3C 3ABLB 3AK3A 1YCIA 2QSAA 1Y74A 3SYQA 3G6BA 3RWRD 4FM1A 1OCRC 4FFBA 3ICXA 3Q4HA 2DYRC 5LP6A 2WSSG 3GB7C 1N32O 2XAJA 4FLYA 3JD0A 4DV6O 2DQ0A 4WCEV 5EYPA 4PI0A 1KP2A 1OCOC 1H2GA 1XILA 2QDOA 2RMKB 1AJPA 5L3FA 3DSQA 3A8TA 5L3GA
chains in the Genus database with same CATH topology
1PM9A 1EN6A 2GDSA 4E4EA 3EVKA 1ZLZA 3AK2A 3MDSA 3K9SA 4JZGA 1LUVA 3CEIA 4JZ2A 1I0HA 1IX9A 5A9GA 3DC5A 1BT8A 1ZSPA 1AP5A 1WB8A 1XREA 1XDCA 2CDYA 4C7UA 2ADQB 1MSDA 1EM1A 1EN4A 1N0JA 3IC9A 1GN4A 1VEWA 1SZXA 3C3SA 3KKYA 2CE4A 1MA1A 3DC6A 3TJTA 1GN3A 4X9QA 1PL4A 2P4KA 1AR4A 1ZTEA 1EN5A 1B06A 2RCVA 1AR5A 4YIPA 4BR6A 1WB7A 1GN2A 1MMMA 1ZUQA 3BFRA 3C3TA 1KKCA 1QNMA 1IXBA 1AVMA 1P7GA 3OT7A 4YIOA 4FFKA 1JA8A 1Y67A 3LSUA 3AK3A 2QKAA 1JR9A 1AP6A 1IDSA 5AG2A 3RN4A 4F6EA 2ADPA 3KDRA 1MNGA 1GN6A 1VARA 1BSMA 3QVNA 1D5NA 3AK1A 1BS3A 1XUQA 4JYYA 2AW9A 2QKCA 1XILA 1I08A 1N0NA 4GUNA 1LUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM9 A;  1EN6 A;  2GDS A;  4E4E A;  3EVK A;  1ZLZ A;  3AK2 A;  3MDS A;  3K9S A;  4JZG A;  1LUV A;  3CEI A;  4JZ2 A;  1I0H A;  1IX9 A;  5A9G A;  3DC5 A;  1BT8 A;  1ZSP A;  1AP5 A;  1WB8 A;  1XRE A;  1XDC A;  2CDY A;  4C7U A;  2ADQ B;  1MSD A;  1EM1 A;  1EN4 A;  1N0J A;  3IC9 A;  1GN4 A;  1VEW A;  1SZX A;  3C3S A;  3KKY A;  2CE4 A;  1MA1 A;  3DC6 A;  3TJT A;  1GN3 A;  4X9Q A;  1PL4 A;  2P4K A;  1AR4 A;  1ZTE A;  1EN5 A;  1B06 A;  2RCV A;  1AR5 A;  4YIP A;  4BR6 A;  1WB7 A;  1GN2 A;  1MMM A;  1ZUQ A;  3BFR A;  3C3T A;  1KKC A;  1QNM A;  1IXB A;  1AVM A;  1P7G A;  3OT7 A;  4YIO A;  4FFK A;  1JA8 A;  1Y67 A;  3LSU A;  3AK3 A;  2QKA A;  1JR9 A;  1AP6 A;  1IDS A;  5AG2 A;  3RN4 A;  4F6E A;  2ADP A;  1MNG A;  1GN6 A;  1VAR A;  1BSM A;  3QVN A;  1D5N A;  3AK1 A;  1BS3 A;  1XUQ A;  4JYY A;  2AW9 A;  2QKC A;  1XIL A;  1I08 A;  1N0N A;  4GUN A;  1LUW A; 
#chains in the Genus database with same CATH topology
 1LR1 A;  4XBF A;  1E1Q G;  3U11 A;  2Y48 A;  3B77 A;  4FK5 C;  4ZKI A;  3UT5 B;  5IYZ A;  1XMQ B;  2YEV B;  4QE9 A;  1M57 B;  1IVS A;  3RVZ A;  3EVK A;  4O4I B;  3HKB A;  2KSD A;  5C93 A;  4ZBM A;  2YS8 A;  4MVO A;  3JAM N;  2AZ2 A;  1K4C C;  2QE7 G;  4I55 A;  3FD9 A;  3QO8 A;  5JJJ B;  1F51 A;  3FB5 C;  1HNZ O;  5LHG A;  4FVM A;  3OMA B;  2R72 A;  4MVQ A;  5IYB O;  1ZSP A;  1AP5 A;  2OIG A;  2XAG A;  3QO7 A;  4JGS A;  3HKD A;  3A0B Z;  3ABK B;  3C3S A;  2IM9 A;  1AR1 B;  3THO A;  4J42 A;  1BQZ A;  1RPR A;  2JGD B;  2ZNJ A;  1JFF A;  2D2C B;  1XBL A;  1YZB A;  3K5O A;  3R66 A;  2W6J G;  4U7N A;  4FM2 A;  5B1B B;  2E3C A;  2E75 B;  3E8B A;  3CRA A;  1Q6H A;  4X1Y A;  5FL7 G;  1QBZ A;  4YHH B;  2DOS A;  2JK5 C;  3VOU A;  4KHP O;  3K03 A;  3BFR A;  1P4R A;  3CCU V;  5LP6 B;  3OTO O;  4FIP C;  1Z5W A;  4KP4 A;  2WAM A;  1SF9 A;  1Q5O A;  4BW9 A;  4B3R B;  3RFR A;  2QKA A;  1NTK H;  1R3L C;  5LMU O;  3JAL B;  4LF6 O;  4X1K B;  5CB4 B;  1YJ9 V;  2PYJ A;  5CA0 B;  2VS0 A;  3Q4H B;  3CC2 V;  2WLJ A;  2EIJ B;  4TQF A;  5D5P A;  1COW G;  4J7J A;  5IWA O;  3AK1 A;  1O9G A;  1XUQ A;  4NKG B;  4UUJ C;  3J80 N;  5KAF Z;  4LF9 B;  1K33 A;  1S5L Z;  3X2Q B;  2Z5U A;  2WLH A;  2PI5 A;  1QR9 A;  1R3K C;  2YXL A;  3STL C;  2HLD G;  2DYR B;  4JYC A;  4DUZ B;  5L3C A;  3VQV A;  5E79 Z;  2V1D A;  4I0X B;  1W0J G;  2CK3 G;  3CD6 V;  4B3R O;  1XHX A;  1VQN V;  3M8A A;  4DV7 B;  4OGQ B;  3D8C A;  2XT9 A;  1SA0 B;  1MSW D;  4PDV A;  3ML0 A;  4O4H B;  4RQF A;  2P67 A;  1BMF G;  4BIZ A;  5FPR A;  4O2B B;  2IU0 A;  4GKK O;  1HP8 A;  5KHG A;  3K57 A;  2F23 A;  1JFF B;  2Y69 C;  3K5M A;  4JV5 B;  1VIB A;  3RYH A;  3H01 A;  1Y66 A;  1F23 A;  3MAQ A;  2FKX A;  2EIL C;  5IJ9 A;  5LXT A;  3K0D A;  1D5A A;  4PA9 A;  2VQE O;  5LGN A;  1ZWI C;  2GBO A;  3F7Y C;  4LP8 A;  4B3T O;  1QNM A;  1VQP V;  1SQG A;  1HNZ B;  2ZDI A;  3OUS A;  4G2K A;  4TOI A;  1S0V A;  5J2U A;  4X64 O;  2CGN A;  1AP6 A;  2E74 B;  2GUZ B;  1JNB A;  3RN4 A;  4N23 A;  3B4S A;  2LGQ A;  4DV5 O;  3OW2 U;  1MNG A;  1GN6 A;  2AGA A;  4LNU A;  1M1K W;  3QVN A;  4IHJ A;  4J11 A;  4LFA O;  3OFN G;  2JEU A;  1VQ4 V;  4BAY A;  2ILM A;  2R70 A;  2AZ0 A;  2QKC A;  3PJS K;  1N0N A;  5GW7 A;  1XMO B;  4HYO A;  5E1A C;  5IT9 N;  2ITD C;  4NXN B;  1FKA O;  1LUW A;  2YUA A;  1N36 O;  3O65 A;  3RYC A;  4B7E A;  1IBK O;  3AG2 C;  4DK0 A;  1IUR A;  1K97 A;  3OMI B;  1B04 A;  3RBZ A;  3OTF A;  4K35 A;  4FLW A;  1P49 A;  2UU9 B;  2JVD A;  2Q7E A;  2QM4 A;  1V9P A;  2EIJ C;  1KU9 A;  5JQG B;  3OMN B;  2X7R B;  2JEX A;  5LA6 B;  3E83 A;  2HHH O;  4CH3 A;  3SR2 C;  2ZR3 A;  3RYC B;  3P32 A;  4JYA O;  3RGB A;  5H6Q A;  5A9G A;  2UUB O;  4JI3 B;  1XL4 A;  5F2V O;  3TK1 A;  1SC5 B;  2FYU H;  1GK9 A;  4EFE A;  4GKJ O;  3U0Z A;  4IYH A;  5IJ9 B;  3JD4 A;  5LXT B;  4EB6 A;  2CE4 A;  2YIB D;  1K5S A;  2FL4 A;  1VQM V;  2M6Y A;  3OEH G;  4GZR B;  3B8M A;  1JQ0 A;  1NS1 A;  3SGI A;  4H33 A;  1OCZ C;  2QWO B;  3KCX A;  4FLV A;  2NN4 A;  4LH6 A;  4QE7 A;  3TXQ A;  1GTO A;  1WA8 B;  3EFF K;  3MHH C;  1SRY A;  2JIZ G;  3H1H H;  1VQ8 V;  4F6R B;  1EBO A;  3ZN0 A;  4O4J A;  2VQF O;  5J9P C;  2WA4 A;  3JAR A;  2P06 A;  3ZHQ A;  3W7X A;  3K0G A;  3B8N A;  1SER A;  1BCC H;  2ZM6 O;  2F4V B;  3OR7 C;  2ZDI C;  1NR1 A;  3E2E A;  1DK1 A;  1IJG A;  3JD1 A;  1YHQ V;  1QLN A;  1MOF A;  2KG7 B;  3APO A;  5EC1 C;  1W59 A;  4LBE C;  3E8F A;  4UB6 Z;  5LP6 C;  4QPK A;  1US6 A;  3ZHV A;  4WFH A;  2JGU A;  4UCR A;  1KEC A;  1FOU A;  5CA1 B;  3ABL C;  4NTX A;  1NTM H;  4DR7 O;  2X6C A;  3BY6 A;  3K08 A;  2MW2 B;  3CCR V;  1K3E A;  2YI9 A;  1FD9 A;  3WB0 A;  4B7K A;  5KLV H;  3ASN C;  1VQ9 V;  4W4K A;  4I9Q A;  3LSS A;  1DTO A;  3AG1 C;  1WB8 A;  5KHH A;  1RPO A;  1EN4 A;  4PEL A;  2A3Q A;  4HAM A;  3T1C A;  1FAF A;  3DXR B;  5IJ0 B;  1HDJ A;  3CRR A;  3W7T A;  4IIJ B;  2H8P C;  1M90 W;  1GM9 A;  1PPJ H;  4O4J B;  1N36 B;  3WFV A;  2YIA A;  2OTJ V;  1WB7 A;  1GN2 A;  3UQ8 A;  2Q73 A;  1RP3 B;  2PGG A;  5EBL C;  2YI8 A;  1XI1 A;  4JAV A;  2ZE6 A;  2KG7 A;  1QR8 A;  3DTU B;  3L72 H;  3OGI B;  3RYI A;  5B1B C;  5B5E Z;  2Q8V A;  2XUM A;  4DR3 B;  4O2A A;  4OX9 O;  5JCO A;  3E86 A;  1GO3 F;  1FS0 G;  4MT8 A;  3UM7 A;  1CEZ A;  1JPX A;  4X66 B;  1IZ3 A;  4Z1V A;  1XMQ O;  2VQE B;  4WBN B;  3QO5 A;  3ASO B;  3CMA V;  2EIM C;  4GT1 A;  1IBL O;  1ZAU A;  4O2A B;  4JI8 O;  2CH7 B;  1ROP A;  5IDJ A;  4PDR A;  4H13 B;  5EYP B;  3K9S A;  1M56 B;  1JOY A;  4PDM A;  2Q68 A;  4JZ2 A;  3W7W A;  4MVS A;  1NVP B;  2ZXW C;  3UO3 A;  4DR3 O;  4JI0 O;  2Y0I A;  2ETN A;  1WP8 A;  2ATK C;  1FXK C;  2ADQ B;  5H6R A;  3T1H B;  3LDE A;  3ZRX A;  4IL6 Z;  2LP7 A;  3UCS C;  4LF8 O;  2IJH A;  4ZI7 B;  1M57 C;  4DV3 B;  4CS2 A;  1H5W A;  4LF7 O;  1ZTE A;  3K5L A;  4IIJ A;  2UU9 O;  4JI6 O;  2QM8 A;  4WFG A;  1EN5 A;  1F4N A;  5CBH A;  1YIJ V;  3CCQ V;  4DRX A;  3AG4 C;  4DV2 B;  4FFB B;  3AG3 C;  3C3T A;  4LF5 O;  2EZP A;  2QWQ B;  2CUG A;  3GWO A;  1Q43 A;  5KX5 A;  1Y6X A;  2XND G;  2PF4 E;  4W4L A;  4JI2 B;  3CC4 V;  5KHJ A;  3FYE B;  1QU7 A;  4F6R A;  1Y67 A;  3F5W C;  4AHC A;  1OCR B;  1FFX B;  2GUZ A;  4R6Z A;  4WBN A;  2QTS A;  5B1A C;  5DEC A;  1VQO V;  4F6E A;  5GTI Z;  2UUC B;  2UUA B;  2CH7 A;  2UXC B;  4ZHQ A;  3BHP A;  1XOU A;  3VQY A;  4I55 B;  3IAY A;  2Q9L A;  3VQW A;  1O9H A;  2K9P A;  3KCY A;  2Y0P A;  3JAW B;  2FB5 A;  2IU3 A;  3WB2 A;  4I4T A;  4DV2 O;  4RO2 A;  1M93 A;  4LCU C;  1FPO A;  4MW3 A;  4X65 O;  1BHB A;  1G4Y B;  2YXY A;  1K4D C;  4DV4 B;  4UFZ A;  3AG3 B;  3CEI A;  5LHI A;  2PTM A;  2E5L B;  4DV3 O;  4DR4 B;  1ZL8 B;  5C8Y A;  4I4T B;  2DE0 X;  4UCU A;  1VMG A;  1IBM O;  2EX3 A;  1YDX A;  1N0J A;  5IY5 C;  2OCC B;  1KQS U;  2JS5 A;  1Q8I A;  2UUA O;  3L74 H;  2UUC O;  4JI0 B;  2A06 H;  3P3N A;  5LA6 A;  1JMK C;  4ICG A;  1GN3 A;  3SJQ C;  1E1R G;  1GM7 A;  4L8J A;  3ZMS A;  4TSF G;  3FFQ A;  2RQ6 A;  2A0L A;  4K0K O;  4FLU A;  1B06 A;  1S3J A;  5K1X A;  3ZMV A;  2UXD B;  2W0F C;  3JCU Z;  5L3E A;  4GX0 A;  1DGS A;  1NBM G;  3L70 H;  4CS4 A;  3W7S A;  5B3S B;  4GLX A;  1B6Q A;  2E76 B;  4P30 A;  3I55 V;  3JCZ A;  3H1I H;  3OD4 A;  1UPG A;  1AVM A;  5ITZ B;  1AI6 A;  1DLB A;  4UCV A;  3T1Y O;  1W2B U;  2XAQ A;  1YJW V;  4Q20 A;  4AI8 A;  4OX9 B;  4D7S A;  1IDS A;  2ZD9 A;  2IJJ A;  1IBM B;  4LF6 B;  5CA0 A;  1NJI W;  3RVY A;  3IC7 A;  4J9Z B;  5FNV A;  4MVR A;  2OIE A;  3KDR A;  1H8H G;  3CP1 A;  4DR4 O;  4OXS A;  3SPJ A;  1HR0 O;  3T2M A;  3F5T A;  2DWD C;  2Y4T A;  1N34 O;  3SJC C;  3CJH B;  4X1I A;  2QTO A;  4LFC O;  1XQ8 A;  4DW0 A;  3CRQ A;  1PM9 A;  3ZRV A;  1JJ2 U;  1PNM A;  3I56 V;  5KUM A;  2YIB A;  4JI1 O;  1S76 D;  3UT5 A;  4D7T A;  1GM8 A;  5BXZ A;  5IE9 A;  1VQ7 V;  4JI8 B;  4O4H A;  1EZJ A;  1DF5 A;  2A79 B;  1BL8 A;  2PUS A;  2W0X A;  3ABM B;  2F1M A;  4ZOL A;  2Z3Y A;  5C8Y B;  3ZX6 A;  5CMU A;  1G6U A;  4O4L A;  1GAX A;  2NLJ C;  5LMN O;  1GN4 A;  1RM1 C;  4MVZ A;  4OPA A;  3ZED A;  4JAS A;  1ZX3 A;  4UB8 Z;  3N2G A;  2AXT Z;  3SJA C;  4RAI A;  1MAB G;  2P4K A;  1AR4 A;  1K73 W;  1B3Q A;  1JVM A;  2G38 A;  4P9O A;  3JAT A;  3K3W A;  4X88 A;  4PA3 A;  4LWS B;  2V7Q G;  4I7Z B;  4DRX B;  2RNB A;  4XDL A;  2WLL B;  3J7A U;  1N8R W;  4NXM O;  2BE3 A;  4LF7 B;  1WPX A;  2H3O A;  3QTC A;  2PYL A;  2B1G A;  4LF8 B;  5JJE B;  4MTX A;  2EJR A;  3JSL A;  4TQD A;  2YXH A;  4RUE A;  2GTS A;  1Y76 B;  4QNH B;  2D3O W;  3M7M X;  1AB3 A;  4DR6 B;  5A2Q N;  1WAZ A;  1KD1 W;  4JI4 O;  5EIB D;  3AG1 B;  3ZMZ A;  2BCC H;  1HNW B;  1N33 O;  1W0K G;  4QJF B;  3ZHR A;  1EFR G;  4DW1 A;  2ZXW B;  4KL1 A;  2B9Z A;  2Z0A A;  3A0R A;  1S72 V;  1TUE B;  3AK2 A;  4CC5 A;  4DV1 B;  4TWK A;  3CCL V;  4X66 O;  2QM7 A;  2IH3 C;  3SYO A;  3ABT A;  3CWB H;  5B3S C;  4J41 A;  2Q0A A;  3G6E V;  3BA8 A;  1ZL8 A;  3OAA G;  4H44 B;  3K59 A;  3HKD B;  1FFT B;  1NTZ H;  2N04 A;  4FJC C;  4PD4 F;  2LW1 A;  4GKJ B;  2DQ3 A;  1VEW A;  4O2B A;  4IGG A;  4JI3 O;  4NVP A;  1XNR O;  1E79 G;  3A0H Z;  3FYI B;  3HKC A;  2MK3 A;  4J7Z A;  1KBH A;  3OTO B;  3ZN1 A;  3S3X A;  2HFE C;  3RYI B;  3T1Y B;  3LNM B;  2RJZ A;  5DN6 G;  5CA3 A;  3RW0 A;  4MTO A;  3H1L H;  1XHZ A;  1JCH A;  2X6A A;  5IYD O;  2HJF C;  1IXB A;  1VQK V;  2Q7G A;  3K5N A;  2Q67 A;  2EIM B;  4NYK A;  3TXS A;  3NXS A;  2UXD O;  4MVU A;  4TV9 A;  4YJ2 B;  3E35 A;  2OCH A;  3CPW U;  3FKS G;  3E8H A;  4AQY O;  5FNV B;  1PL0 A;  2JJ2 G;  1SZT A;  4EEQ A;  1NKD A;  4O4I A;  1HNX B;  3LDC A;  2HJD A;  1FJG O;  3JYC A;  2HEP A;  1A32 A;  3JAS A;  1H2S B;  1RM1 B;  3CJH A;  3SPC A;  2CAZ C;  4TV8 A;  2ITC C;  3FAV A;  4B3S O;  2N05 A;  1NU1 H;  2EZO A;  3R65 A;  4E4E A;  5KHK A;  4HNA A;  5CA1 A;  1Q81 W;  5CN0 A;  2R9R B;  2WWW A;  3S3W A;  2XTA A;  1Y4M A;  3U10 A;  2ODM A;  2LFR A;  1VF6 C;  5JQG A;  3WG7 C;  2JGD A;  2ZR2 A;  4H0L B;  4NXN O;  1IX9 A;  3MHS C;  4GX2 A;  3RYF A;  3AG4 B;  4X89 A;  2KQX A;  2BTO A;  3BAA A;  1NZ6 A;  3CE2 A;  3ASO C;  1EM1 A;  1MZF A;  3UO2 A;  2DWE C;  1G1X B;  2XOK G;  4DV5 B;  1YJN V;  1V55 B;  3E8G A;  2UXB B;  3ZRS A;  2UXN A;  1M5I A;  3CSX A;  5L3D A;  1M4U A;  3C90 A;  3SJB C;  2F95 B;  4ZIB A;  1THZ A;  5LOV B;  3FB7 C;  3N27 A;  3OGC C;  1G8M A;  4NR1 A;  1ZUQ A;  3ZS8 C;  4EKW A;  4FPP A;  1TGO A;  4ZI7 A;  2WLL A;  1QQC A;  2HG5 C;  2CTQ A;  1KKC A;  1R6T A;  2IH1 C;  5B1O A;  4DV1 O;  2F93 B;  3WU2 Z;  3CCV V;  3ZHT A;  4FFK A;  1KC8 W;  4B3M B;  1P84 F;  1SQQ H;  5BY1 A;  1SQF A;  4LF9 O;  1PNL A;  2EIN B;  2PZS A;  2HKO A;  3AG2 B;  4UV8 A;  4CZZ A;  1I94 B;  4JYB A;  5KX5 B;  1HNW O;  1N33 B;  1UFI A;  5KMG B;  3CHX A;  5EZY A;  2OWO A;  4LF4 B;  2Q7H A;  5JCO C;  4U3F H;  2HHH B;  3WB1 A;  3CCS V;  2DW4 A;  1YVW A;  2IW5 A;  4JAA A;  5EC2 C;  4JF3 A;  3LNN A;  4BW5 A;  4LF4 O;  2EUL A;  2WLK A;  1CXZ B;  3ETG A;  4CC6 A;  3B2E E;  5JVD A;  1BHA A;  3WG7 B;  1I94 O;  3SYA A;  3M99 B;  4FM0 A;  5IYZ B;  2QWP B;  5LBQ A;  3K04 A;  3IFX A;  2BTQ A;  5JH7 B;  2EBO A;  3X2Q C;  4NXM B;  2PI4 A;  3AEI A;  4JZG A;  5H2F Z;  1OZ0 A;  2CTR A;  1V54 B;  1HW7 A;  2ZT9 B;  4B08 A;  5B66 Z;  3DC5 A;  5EBW C;  3OE7 G;  4MVM A;  2N74 A;  5LOV A;  3GWK C;  2DMX A;  4WFA V;  2QGN A;  3VQX A;  1H2L A;  3UKM A;  5BZB A;  2ZIN A;  3ZRW B;  4JI4 B;  4DO2 A;  3LUT B;  2YID A;  1Z5V A;  1SS3 A;  1K92 A;  2QWN B;  4J7K A;  2E5L O;  3ZMU A;  3JAL A;  4DV0 B;  1YEW A;  5JJN B;  1JX9 A;  3LSQ A;  1FXV A;  5HFM A;  3RYH B;  3JAT B;  2LGW A;  3JSN A;  4TV9 B;  1Q6U A;  4MSW C;  4TUY B;  1FXH A;  3B40 A;  1BZK A;  2LFS A;  1EZV H;  4H37 A;  4J9Y B;  2ADP A;  4LFA B;  1N34 B;  1X59 A;  2YSU B;  3AG7 A;  1VQL V;  5JWP A;  2M7W A;  4Z1M G;  5JH7 A;  1BE3 H;  4K8X A;  1I08 A;  3K06 A;  4J10 A;  3ZIA G;  1AJQ A;  3OUF A;  5B1N A;  4IT5 A;  1WPB A;  1HNX O;  4G28 B;  4FMT A;  1EN6 A;  2LJ2 A;  4AQY B;  2Y4U A;  4PI2 A;  3CCJ V;  4FLX A;  4EB6 B;  3D3Q A;  2CTW A;  1S5J A;  2OYQ A;  1VF5 B;  3FB6 C;  3TCU A;  2EIL B;  4DR5 B;  4FZ1 A;  1OCC C;  1Q7Y W;  2L35 A;  1L0L H;  1XRE A;  4UVB A;  1XDC A;  2UXX A;  3SYP A;  1L1F A;  1H2K A;  1SET A;  1HWY A;  2WPD G;  4JI5 O;  1N32 B;  1AJN A;  3HR0 A;  2DYS C;  5IJ0 A;  4GCZ A;  1Z2G A;  2W6I G;  3L71 H;  4LFC B;  2GV9 A;  3OR6 C;  5D5Q A;  2YDE A;  3KZI Z;  5ITZ A;  2X6B A;  4WFE A;  1CP9 A;  5LL6 Y;  4CH6 A;  3APQ A;  4OPH A;  4QGP A;  1MMM A;  3ABM C;  4YHH O;  3P3P A;  3N2G B;  2P4V A;  5TIS Z;  1WNS A;  4LNU B;  3SYC A;  4DR2 O;  1N4C A;  4DUZ O;  4IHJ B;  5LHH A;  2KB1 A;  3F7V C;  2CGO A;  1R73 A;  5HFL A;  1JR9 A;  4X1K A;  3CYO A;  3QNE A;  1XL6 A;  3ZMT A;  5GON B;  4LFB B;  1WN7 A;  3IJ4 A;  2YIC A;  5KMG A;  4DR2 B;  3K79 A;  1YTF D;  3CCE V;  3JAS B;  3CME V;  3CXH F;  5LMU B;  1X4T A;  2AHZ A;  2GHY A;  4UCS A;  1QLE B;  1OHH G;  2P22 C;  3BPZ A;  4UCO A;  2VWJ A;  4JTD B;  2GDS A;  4U3J B;  5J2T B;  4PA6 A;  5BR8 B;  1GH6 A;  1KKD A;  3HKE B;  5LYJ B;  1R6N A;  4KHP B;  4JI2 O;  4DYL A;  4R8C A;  4JTC B;  3CRM A;  4DUY O;  1JJO A;  3BRC A;  5K1P A;  3CB2 A;  1BT8 A;  1I7F A;  1T5E A;  3J81 N;  4DR5 O;  4U3J A;  1I5X A;  1VQ6 V;  2CDY A;  3BEH A;  4C7U A;  4X65 B;  1XMO O;  1L8D A;  4B3M O;  2QA4 V;  5DM6 V;  4BIO A;  1NH2 B;  5LYJ A;  4DV0 O;  3D36 A;  1SZX A;  1VQ5 V;  3JAK B;  4KFM A;  4XDJ A;  4B3S B;  4AIL C;  1KB9 F;  5EK0 A;  1VF7 A;  4PA7 A;  2R9A A;  3CRC A;  5BR8 O;  2DN9 A;  5B1A B;  2C2A A;  4LR3 A;  2ARH A;  1K7D A;  1R3I C;  1Y74 B;  3G67 A;  4NTW A;  3CXC U;  1KUQ A;  4YJ3 A;  1OCO B;  4DR7 B;  1IXM A;  1ORQ C;  4X62 O;  3VBB A;  5J2U B;  1SKV A;  1YSC A;  4R50 A;  3ETE A;  4TV8 B;  5AG2 A;  1I5Y A;  1KP3 A;  3CC7 V;  2P7T C;  4P9P A;  5EZY B;  4YY3 B;  2JS3 A;  5EBM C;  1R3J C;  3EXA A;  1D5N A;  1Y76 A;  3L9D A;  4JYY A;  1H8E G;  4HBN A;  4FLZ A;  2ZM6 B;  3T4D A;  1U96 A;  2DJV A;  2ZE5 A;  3TET A;  2ZE7 A;  1KYO F;  1FXK B;  4GUN A;  4YJ2 A;  3K9A A;  1SQB H;  3A2F A;  2CTP A;  1YTF B;  3G71 V;  2O57 A;  1M9N A;  4MS2 A;  4RUF A;  2R9I A;  1XNR B;  4GX1 A;  4JTA B;  3N2K A;  4MTF A;  3ZHU A;  3SPG A;  3T1H O;  4BIU A;  4MW8 A;  3H1K H;  2B1I A;  2OT5 A;  3BVO A;  3G4S V;  1P7B A;  1RSO A;  2X0L A;  2BSK B;  3JD2 A;  4DR1 O;  3BAB A;  3FAV B;  2RDC A;  4JI5 B;  2XAF A;  4MTG A;  1DF4 A;  5FPO A;  1YF2 A;  4O4L B;  4UXN A;  2BTQ B;  4I0X A;  4CBC A;  2FML A;  3IC9 A;  1V54 C;  1VF6 A;  3GVM A;  1QHT A;  2JJ1 G;  5IWA B;  2BSK A;  3O9O A;  4X9Q A;  1PL4 A;  4K0K B;  4J80 A;  4X62 B;  3EHB B;  2PY5 A;  2Q69 A;  2RCV A;  4LWS A;  1OJH A;  2Q5Z A;  2ZCE A;  5CB4 A;  2WLI B;  4RWU A;  2ZQM A;  2RN9 A;  1K8A W;  2BOB C;  1PNK A;  3STZ C;  4CH5 A;  2IJK A;  4LF5 B;  1K34 A;  3CS5 A;  4TUY A;  1FXK A;  2IJI A;  2JDI G;  2K1E A;  1L0N H;  1PP9 H;  2ZNI A;  2EIN C;  3P30 A;  5JVD B;  1URF A;  2P90 A;  4QPJ A;  2ZIM A;  2VWK A;  4LH7 A;  3HKB B;  1YI2 V;  4UV9 A;  3QG5 A;  4KXR A;  3FB8 C;  1VP7 A;  5H9C A;  2Q0O C;  5IY5 B;  3ETD A;  4WF9 V;  2UXC O;  1FJG B;  1NI8 A;  2LO1 A;  2VRZ A;  1WP7 A;  4LC1 A;  4RQE A;  3HB3 B;  2XHB A;  3N2K B;  2UXB O;  3ZJZ A;  1U97 A;  1ENV A;  1ZLZ A;  1M56 C;  2Q4P A;  5LMN B;  1LNQ A;  4HNA B;  1V55 C;  3MDS A;  4UCT A;  4WFB V;  4G27 B;  4YXW G;  5LGU A;  3BA9 A;  1PKX A;  5KA6 A;  2HR3 A;  1TA8 A;  3SPH A;  1NH2 D;  2EJ7 A;  4UVC A;  3KG2 A;  4X20 A;  4BWA A;  4JAU A;  4EFB A;  4JV5 O;  1XNQ B;  4I50 B;  1Q90 D;  4GX5 A;  1S77 D;  1NQT A;  2L6L A;  4X1Y B;  2FTK A;  2QR4 A;  1TUB B;  5CBF A;  4I9W A;  3KKY A;  4PA4 A;  1D2D A;  1F4M A;  2LW7 A;  2QKS A;  1MA1 A;  4Q6G A;  4JI6 B;  3DGE A;  3H9V A;  3IGA C;  3SPI A;  4ZOL B;  2P5O A;  4DXW A;  2H94 A;  4YJ3 B;  2F4V O;  1R1B A;  4U7O A;  3QF7 A;  1MG1 A;  2IBZ H;  4HZ3 A;  1OV9 A;  2A9H A;  2OCC C;  3E22 A;  4ZHQ B;  1P7G A;  2VQF B;  4YIO A;  1JA8 A;  3G80 A;  2KKW A;  3LSU A;  4CS3 A;  3SDL A;  4UVA A;  1QCE A;  4X1I B;  4Z2W A;  2ZKO A;  2QJ1 A;  2LQT A;  2F43 G;  1BSM A;  2V4D A;  1YXB A;  3E22 B;  4E2L A;  1BS3 A;  3B09 A;  1Q86 W;  3D36 C;  1SQX H;  1S5H C;  3L73 H;  5CBG A;  4WFF A;  3JD3 A;  2XAH A;  4GYC B;  1GMG A;  1QVG U;  3LDD A;  4PV1 B;  4F4L A;  3ZHS A;  1R6K A;  2EIK B;  5J2T A;  2B5U A;  1K9M W;  2WLM A;  4A5U B;  4K3A A;  1NR7 A;  4FZ0 A;  1NT2 B;  1FYJ A;  3HPL C;  1TVK A;  1RSO B;  1WLE A;  4CH4 A;  5DED A;  4L87 A;  4JI7 B;  1AI5 A;  4XDK A;  5KAI Z;  2QEX V;  2Y69 B;  1MSD A;  1XEQ A;  4I50 A;  2ZIO A;  1GKF A;  3NR7 A;  2F66 C;  4YY3 O;  3JAK A;  3ZCC A;  3DC6 A;  3TJT A;  1Q82 W;  1XNQ O;  4GKK B;  4DUY B;  1PV0 A;  3ZRW A;  3FX7 A;  1K5Q A;  1CPY A;  2HVK C;  1SQV H;  5LGT A;  4BR6 A;  3JAR B;  2WLI A;  1MZE A;  4PHZ A;  3H1J H;  3D3I A;  4X64 B;  2JRI A;  3HKC B;  5KHI A;  4K8Z A;  3OT7 A;  3I5D A;  1FFX A;  2HP8 A;  3ZBH A;  4FLT A;  4B3T B;  2EIK C;  3BCC H;  5KUK A;  1PD3 A;  4LFB O;  1UJW B;  4N21 A;  2YC0 A;  4DV4 O;  1VAR A;  2ZE8 A;  4DV6 B;  1NVP D;  4JI1 B;  3ETQ A;  4IYI A;  5L3B A;  1GRJ A;  3HKE A;  2AW9 A;  2HVJ C;  4DR1 B;  2GTA A;  4P2Z A;  4DK1 A;  1F7Y A;  4ABM A;  4I5S A;  1WJZ A;  4JI7 O;  5GON A;  1H38 A;  1HR0 B;  5FLX N;  3JAW A;  2YEV A;  3W7U A;  1QLE C;  1ARO P;  4TT3 G;  5EIB C;  1J5E B;  1YIT V;  4JYA B;  1TAE A;  5KA5 A;  1BQ0 A;  1AI4 A;  2XAS A;  4JPR A;  5IYC O;  4DV7 O;  4PDL A;  2AHY A;  1QVF U;  3DXR A;  1AIL A;  1LUV A;  1TVK B;  1Q3E A;  2A7W A;  1BGY H;  1SQP H;  1OCZ B;  1I0H A;  3RYF B;  2P6J A;  4R7C A;  2Q6A A;  4X20 B;  3PN1 A;  5H5N A;  4KUM A;  1IBK B;  3CCM V;  3ASN B;  3TGU H;  4X8A A;  5BMV B;  1SA0 A;  5GTH Z;  1KMI Z;  4QIW F;  2BOC C;  2NR5 A;  1J95 A;  1TUB A;  1Q6I A;  2NNU A;  2OTL V;  4NB5 A;  2WA3 A;  1IBL B;  3ABK C;  3CX5 F;  3E89 A;  3K58 A;  1SES A;  1RFY A;  3ABU A;  3OEE G;  3OM3 B;  4D6T H;  3T4Z A;  1OCC B;  5BMV A;  1AR5 A;  4YIP A;  4NTY A;  4ASU G;  1AI7 A;  1H2M A;  2GSM B;  3L75 H;  1WA8 A;  2UUB B;  3MD0 A;  1J5E O;  1H2N A;  2DYS B;  4DR6 O;  4PJ0 Z;  2WLN A;  2QWR B;  3RT3 C;  3ABL B;  3AK3 A;  1YCI A;  2QSA A;  1Y74 A;  3SYQ A;  3G6B A;  3RWR D;  4FM1 A;  1OCR C;  4FFB A;  3ICX A;  3Q4H A;  2DYR C;  5LP6 A;  2WSS G;  3GB7 C;  1N32 O;  2XAJ A;  4FLY A;  3JD0 A;  4DV6 O;  2DQ0 A;  4WCE V;  5EYP A;  4PI0 A;  1KP2 A;  1OCO C;  1H2G A;  1XIL A;  2QDO A;  2RMK B;  1AJP A;  5L3F A;  3DSQ A;  3A8T A;  5L3G A; 
#chains in the Genus database with same CATH homology
 1PM9 A;  1EN6 A;  2GDS A;  4E4E A;  3EVK A;  1ZLZ A;  3AK2 A;  3MDS A;  3K9S A;  4JZG A;  1LUV A;  3CEI A;  4JZ2 A;  1I0H A;  1IX9 A;  5A9G A;  3DC5 A;  1BT8 A;  1ZSP A;  1AP5 A;  1WB8 A;  1XRE A;  1XDC A;  2CDY A;  4C7U A;  2ADQ B;  1MSD A;  1EM1 A;  1EN4 A;  1N0J A;  3IC9 A;  1GN4 A;  1VEW A;  1SZX A;  3C3S A;  3KKY A;  2CE4 A;  1MA1 A;  3DC6 A;  3TJT A;  1GN3 A;  4X9Q A;  1PL4 A;  2P4K A;  1AR4 A;  1ZTE A;  1EN5 A;  1B06 A;  2RCV A;  1AR5 A;  4YIP A;  4BR6 A;  1WB7 A;  1GN2 A;  1MMM A;  1ZUQ A;  3BFR A;  3C3T A;  1KKC A;  1QNM A;  1IXB A;  1AVM A;  1P7G A;  3OT7 A;  4YIO A;  4FFK A;  1JA8 A;  1Y67 A;  3LSU A;  3AK3 A;  2QKA A;  1JR9 A;  1AP6 A;  1IDS A;  5AG2 A;  3RN4 A;  4F6E A;  2ADP A;  3KDR A;  1MNG A;  1GN6 A;  1VAR A;  1BSM A;  3QVN A;  1D5N A;  3AK1 A;  1BS3 A;  1XUQ A;  4JYY A;  2AW9 A;  2QKC A;  1XIL A;  1I08 A;  1N0N A;  4GUN A;  1LUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...