1I08A

Crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKAHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 74
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i08A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i08A02
3K9SA 2GDSA 1XDCA 2AW9A 3BFRA 3IC9A 1P7GA 2ADPA 2CE4A 1D5NA 2CDYA 1I08A 1WB8A 1BT8A 3QVNA 1EN6A 3DC6A 1XUQA 1JR9A 1AVMA 2QKCA 5AG2A 4E4EA 1JA8A 1PL4A 1MNGA 1VARA 1IX9A 1Y67A 1AR5A 4F6EA 1BSMA 4JYYA 3KKYA 4YIPA 1KKCA 3DC5A 1LUWA 1ZLZA 1EN5A 1AP6A 1GN3A 4GUNA 2RCVA 4JZGA 1MA1A 1N0JA 1VEWA 1LUVA 3C3SA 1MSDA 3OT7A 4BR6A 1EM1A 2QKAA 3AK1A 4JZ2A 4X9QA 1XREA 1IXBA 1I0HA 1SZXA 3AK2A 1GN4A 1XILA 1GN2A 1ZTEA 3C3TA 1WB7A 1N0NA 5A9GA 4C7UA 1AR4A 1EN4A 3MDSA 3AK3A 1BS3A 2P4KA 1B06A 1GN6A 3LSUA 1IDSA 1QNMA 1ZSPA 1PM9A 3CEIA 3TJTA 1MMMA 3EVKA 4YIOA 1ZUQA 4FFKA 3RN4A 2ADQB 1AP5A
chains in the Genus database with same CATH superfamily
2Y0IA 4LF9B 4Z1VA 4JI2B 1V9PA 2PZSA 3BCCH 3SR2C 4I9QA 1IJGA 4I55B 1YVWA 4RUEA 4RO2A 2WA4A 1L0LH 4UVCA 4ASUG 4UVBA 1US6A 1K5QA 1VF6A 2LO1A 4DV7O 3FAVB 3RYHB 1HP8A 4U3JA 1KQSU 2CGOA 3E83A 2IJJA 4LH7A 2AHZA 2G38A 3GB7C 5IY5B 5KUKA 5IY5C 1YEWA 2Q0AA 2IJIA 5LA6B 4ZBMA 1LUVA 1SERA 2FKXA 4MTGA 5B5EZ 4DR2O 4HAMA 4U7OA 2AZ0A 4TUYA 1XREA 4O4LB 2N74A 2YIAA 2F23A 3APQA 2Y4UA 1BQZA 3OUSA 2KG7B 1FS0G 1VQLV 3OEEG 1SQGA 1BZKA 5H9CA 3HKBB 4JI8B 2QA4V 2OWOA 4DR5O 3UO2A 2QWOB 1H2LA 1NTKH 4X1IB 2PI4A 3DTUB 2LFSA 2OCHA 1EZVH 1ZAUA 4LCUC 1KBHA 1H2MA 1ZSPA 3AG7A 4J42A 3CCUV 3L72H 3ZS8C 1NZ6A 1UPGA 3H01A 4EEQA 4X88A 1FXKB 1FXKC 2FMLA 1N32B 3E8HA 1KECA 2ADPA 1SZTA 3OR6C 2CE4A 1AI7A 2RMKB 3S3XA 4UCVA 5L3FA 4X1KA 1R3KC 5AG2A 3DGEA 5LL6Y 4YJ2B 4FFBB 5KHKA 4TT3G 3JYCA 2UXNA 3OUFA 4K0KB 1GM8A 4GX2A 2LJ2A 1XMQO 1ZL8B 2M7WA 4MTXA 2HFEC 1S76D 2EILB 4ZHQA 2WSSG 5EBWC 4E2LA 3HKCB 4BIZA 3ZCCA 3E8BA 4FM0A 2YIBD 4X66O 4X9QA 3OFNG 4FK5C 4X89A 3A0BZ 5B1AB 3AK2A 5B1AC 2AZ2A 5LP6B 3P30A 1VQ5V 5IDJA 1ZWIC 3IFXA 1Y74B 1AR4A 3K79A 3MDSA 4UVAA 1BS3A 3FYEB 3JCZA 1XHZA 1W0JG 5B66Z 4IT5A 5GTIZ 4QPKA 4DUYO 4MW3A 5FNVA 4I0XA 4DR4O 2H94A 5IJ0B 1JOYA 4KXRA 2UUCO 3AG3C 2CTWA 2OTLV 1IVSA 5BR8B 4FM2A 2UU9O 3ZRWB 4IHJA 2KKWA 1N34B 4KP4A 4IYIA 1AP5A 1H38A 2X6CA 4PDMA 4FLXA 1BCCH 2UXCO 1SQQH 1RSOA 1JFFB 4HNAA 4HBNA 2CDYA 4NTYA 4GX0A 3J80N 4NKGB 2BSKA 3JASB 4LFCO 2QM7A 2QTSA 3K0DA 3ZHVA 2QWRB 1HNZB 2CTRA 1G1XB 4GZRB 1TUBA 1XEQA 3JD0A 1TGOA 1VQ6V 4XDLA 3JD1A 4PDRA 1DLBA 1M93A 1KUQA 3E8FA 5BMVA 2AHYA 2K1EA 1KKCA 1RM1B 1Y4MA 1DF5A 1RM1C 1FJGB 1YJNV 4J80A 3B40A 1TUEB 3IGAC 2V4DA 4XDKA 1F23A 5IJ9B 5LBQA 2BOBC 3LDDA 4EFBA 3A0HZ 3K08A 1R6TA 2UUBO 4I55A 1SQBH 1S72V 3E8GA 3UM7A 1Q86W 1HNWO 4JZ2A 3JSLA 1M57B 1K92A 1M57C 3QG5A 3LDEA 3SPIA 1YDXA 1XNRB 1WLEA 1XBLA 2OIEA 3C3TA 3RYHA 4DYLA 3MAQA 1AILA 1EN4A 2NR5A 2ZR2A 2PYJA 3W7WA 4LF5B 3JD4A 3F5WC 1I94O 2DQ3A 1ORQC 4J41A 5DM6V 1EZJA 2LGQA 2KQXA 4CH4A 1QR9A 4O4LA 1KD1W 3I56V 4XBFA 4P9PA 2KG7A 4LF8O 3GWOA 4AHCA 1VF5B 1OV9A 4PJ0Z 1F51A 3HKBA 3G67A 2EINB 3CSXA 3CCSV 4B3RO 1YITV 1VF7A 4DV1B 4YY3O 4DW0A 3AEIA 2P90A 3CRMA 3OGCC 2JGDB 4YXWG 1OCCB 4X1IA 1JJOA 4MVUA 2JEXA 1VQMV 4JV5B 3ABKB 2QKCA 1NI8A 2Y0PA 4E4EA 3ETEA 3AG2B 3ASNB 2HKOA 3SYOA 1IURA 3ASNC 1IBMO 5KA5A 1FXKA 2EJ7A 3FB5C 4PA3A 5DEDA 2IH3C 4WFGA 4ZKIA 5LHHA 1IBKB 2JK5C 1XMOO 3U11A 5KHIA 3CWBH 3H1LH 3LDCA 4LC1A 5FPRA 3DSQA 5ITZB 4CC6A 3D3QA 1K97A 2ZE8A 3L70H 3ZHSA 2QM8A 1DGSA 2L35A 2P67A 5KAIZ 4B3SB 2RJZA 4DK1A 4H33A 5C8YB 3T2MA 3RBZA 4PA4A 3T4ZA 1AROP 1PKXA 4YJ2A 3VQYA 4FFBA 3I5DA 1K8AW 2WLIB 1H5WA 3K03A 1XL6A 1OCOB 1QBZA 1OCOC 1IDSA 2OIGA 3WFVA 4X62O 1R6NA 3RW0A 5CA1B 4LH6A 3HKCA 2PF4E 1PM9A 3QO5A 3RWRD 1Q6UA 1E79G 3SJBC 1J5EB 4A5UB 3DXRB 5EK0A 1XI1A 3HPLC 2BTQB 1MMMA 3ZMSA 4I4TB 3RN4A 4W4KA 5LP6A 4JI0O 5KHJA 1NR7A 4X64O 4FLUA 1IBLB 4ZIBA 4B3MO 1Y74A 1CEZA 5LGTA 5F2VO 5LGNA 4FM1A 3G80A 3QO8A 1EN6A 1EBOA 4FLTA 4JI1B 4B3TB 2LQTA 2ZE5A 4LF9O 2CAZC 3ABMB 5IJ0A 3OTOB 1IX9A 1K3EA 1H2GA 2XAQA 3OEHG 2HVKC 4FLZA 4GKKB 3CXCU 3ZRWA 1H2KA 3EHBB 2ZKOA 2D2CB 1LUWA 2C2AA 3TK1A 4UCTA 1SESA 1YZBA 2GUZA 1MA1A 3CMEV 2EX3A 1JFFA 5D5PA 3OT7A 4DV3B 2EIMB 3JASA 2GSMB 3K04A 2EIMC 2YSUB 3SJAC 3UT5A 3N2KB 4JI6O 2JDIG 1D5AA 1BHAA 4JPRA 3J7AU 2A79B 1YI2V 4G28B 3JARB 1OHHG 1N0NA 5A9GA 2W6IG 5IYZB 4UXNA 2UUAB 5JH7B 2W6JG 4PV1B 4N23A 1I5XA 3Q4HB 1Z2GA 2E5LO 2WPDG 4GYCB 3VOUA 5IJ9A 3T1YB 3LSUA 1K4DC 4DV5O 1HDJA 1V55B 4NR1A 1VQ8V 1WP8A 4JI8O 3ZN1A 4L87A 4OX9B 4YHHB 4FLYA 2EIJB 5J9PC 2F43G 1JNBA 4YIOA 5CBHA 4AQYB 1VQ7V 3E86A 4J11A 2AW9A 4J7JA 2Z3YA 2DYSB 1D5NA 1KP3A 2DYSC 3CE2A 1MZEA 4MVZA 2EZPA 4XDJA 2KB1A 2FL4A 2ZDIA 3ETQA 4QIWF 1K9MW 2RQ6A 2Z0AA 1O9GA 1QHTA 1Q8IA 1NTZH 4GKJO 2RN9A 2X0LA 1V54B 4K3AA 3P3PA 3X2QB 4ZOLB 3X2QC 1VIBA 1Y67A 1IXMA 2GTSA 2XAFA 2XT9A 2NNUA 4DUZB 4DR1O 4DR6B 5FLXN 2WLLB 4DR7O 1AP6A 1EN5A 1R73A 2YXHA 4NXMB 3VQVA 1H8EG 1AJPA 3NR7A 3BABA 3RYIA 3JAWB 2JGDA 3AK1A 4LWSB 4KHPB 5BY1A 4O4HB 2WLJA 1Y66A 4K8ZA 2QEXV 1XILA 4G2KA 3LNMB 2XAGA 2BCCH 3OAAG 4LFAB 1JMKC 4OPHA 1G4YB 1TVKB 3CRRA 2OCCB 2OCCC 2ATKC 3AG1B 3AG1C 1B04A 4JYAB 5H2FZ 2QTOA 4PHZA 5ITZA 2ITDC 4IIJB 1UJWB 4WFBV 2CH7B 3ZX6A 1XOUA 5IYBO 3CCLV 1T5EA 3CEIA 1HNXB 1GMGA 3TJTA 2B1GA 4LF7B 3UCSC 2DQ0A 5C8YA 3EVKA 1WJZA 4DV2O 4JI7B 2P6JA 4J7ZA 3K57A 3CC7V 2WLNA 1YHQV 3CHXA 1D2DA 4H44B 3CD6V 4B7EA 5BR8O 4LP8A 2Q7EA 2WLIA 3FB8C 3G4SV 1FKAO 3RVZA 4J9YB 3L9DA 3M7MX 1YJWV 4D7TA 1VQNV 5CA1A 4HYOA 1K5SA 4B08A 1OZ0A 4LFBO 5BXZA 3DXRA 4LNUB 2BTQA 4DRXB 2QGNA 1HNZO 4I7ZB 3CCRV 4I4TA 2JS5A 3K3WA 2RCVA 5LHIA 2FYUH 2FB5A 3N27A 4QJFB 1FPOA 2P5OA 5CBFA 5B3SB 2ZE7A 4DR3B 5B3SC 2A7WA 1Q6IA 2ZM6B 2D3OW 2ZXWB 1JJ2U 2ZXWC 3APOA 1PPJH 1FJGO 4H0LB 3B8NA 2EZOA 2VQEO 2RNBA 4J7KA 3CCEV 3STLC 3CCQV 1L0NH 3U10A 1JPXA 1XHXA 2EILC 2DN9A 1SF9A 3D8CA 2IJKA 4YJ3B 5H6RA 4WFAV 2ZIMA 2LP7A 2HVJC 4DV0O 4TV8B 1GTOA 2Q67A 2Y48A 1NT2B 3KG2A 3JD3A 2BTOA 3QF7A 5IWAO 5LMUB 1MG1A 5CN0A 1XNQB 5LP6C 4LF5O 3E89A 3N2KA 3HB3B 3ZRXA 5KHGA 3E2EA 1NQTA 4MTFA 4BW9A 4IL6Z 2WLHA 4AILC 3K58A 3JARA 3QO7A 1M4UA 4JI5B 4DR2B 1P7GA 5IYZA 4QNHB 1I08A 3OW2U 5JH7A 3W7TA 3GWKC 1Q81W 2JIZG 3Q4HA 5HFMA 5A2QN 3IAYA 1K34A 3CCJV 1F4NA 2XASA 4L8JA 1AR1B 3W7SA 1KYOF 3RGBA 3CJHB 4DR5B 1R3JC 1SKVA 4DV1O 3KKYA 5JQGB 1WA8B 4CH3A 2FTKA 4JGSA 1ZX3A 4MTOA 3OM3B 1FFTB 4RUFA 3GVMA 2F1MA 1IBKO 1R3IC 2KSDA 1VQKV 1Z5WA 1B6QA 4WBNB 3PJSK 2XAJA 2P7TC 1R3LC 3SYCA 2M6YA 4ZOLA 5E1AC 3ZBHA 3ZHTA 2R9RB 4G27B 2IH1C 1Z5VA 4B3SO 3LSSA 2BE3A 1SQPH 3B2EE 2WLLA 4WFHA 4JI4B 4DXWA 3HKEB 4P2ZA 2XAHA 1BQ0A 3CC4V 3AG4B 3CPWU 2MW2B 3AG4C 1ROPA 4CC5A 1S5HC 3TGUH 1ENVA 1FYJA 1PD3A 3K5MA 4KUMA 3W7XA 4I9WA 3JAWA 3CMAV 1Q3EA 4LWSA 2P06A 3FAVA 4O4HA 1U96A 4BAYA 1JX9A 1KB9F 1NVPD 3K59A 4GX5A 3SPCA 1R6KA 4Q20A 2JVDA 4TWKA 4CS2A 4HZ3A 3E35A 3P32A 3ETDA 2ZDIC 4R7CA 3H1IH 4I50B 1QLNA 3CCMV 1TVKA 3FX7A 5LA6A 4X66B 1J5EO 1Q6HA 5CA3A 2HHHB 4NVPA 2YIBA 3C90A 2PTMA 3CCVV 1R1BA 5H6QA 1NTMH 3KZIZ 4IIJA 3K5LA 2CUGA 1YF2A 1MNGA 4CS3A 2CH7A 1M56B 4FLWA 1M56C 5CBGA 2IM9A 2DW4A 5DECA 3K06A 5JWPA 1A32A 4JYYA 5JCOC 3BA9A 4PD4F 4CZZA 4TV9B 3CP1A 2EINC 3TXSA 4DUYB 4B3TO 4JI1O 1GN3A 4FIPC 5B1OA 4JAUA 4DW1A 3L73H 5KX5B 4GLXA 2WLKA 3OTOO 4X65B 1OCCC 1VEWA 2UXXA 2PYLA 1NU1H 3CRAA 3T1HB 2YDEA 2W0XA 3ABKC 1MSDA 2E74B 3IJ4A 3ZMUA 5BZBA 4GT1A 4GKKO 4DO2A 4TSFG 1U97A 1AI4A 3AG2C 4R50A 3HR0A 3ZIAG 1K4CC 4OPAA 3CYOA 1FD9A 1HWYA 3L75H 3P3NA 1ZTEA 2XUMA 4P9OA 1WP7A 4LFCB 4DV3O 1G8MA 1BHBA 4LNUA 1S77D 3E22B 3AK3A 4BWAA 4X20B 4O4IB 2V7QG 3N2GB 2ITCC 3JALB 4ZI7B 1QVGU 1GK9A 4KL1A 1PNLA 2YI9A 1J95A 2CK3G 2UUAO 1M9NA 4FVMA 5KUMA 3K0GA 3K9AA 1SC5B 4QE7A 2B9ZA 4LF6O 1ZL8A 3JAKB 2UUBB 3K9SA 3ZHRA 2X7RB 3OMAB 1HNWB 4YJ3A 4CH6A 1N33O 3STZC 4OX9O 4TV8A 4YHHO 1NR1A 4JI3O 1HR0B 1XUQA 4AQYO 1O9HA 4MT8A 2MK3A 4D7SA 5GTHZ 1AR5A 3MD0A 4TQDA 1ZLZA 1SRYA 4DK0A 2XNDG 1GM9A 1JVMA 1K7DA 2IU0A 4DV4B 1UFIA 4DV6O 1BGYH 2A9HA 2Q9LA 1SQXH 4JI2O 4NB5A 3O9OA 5E79Z 3ABMC 2QKAA 1Q90D 1THZA 4DR6O 4B7KA 2GBOA 3NXSA 3SYAA 1AB3A 1Y76B 5B1NA 4MW8A 3CJHA 1S0VA 4B3RB 4WCEV 4YY3B 1WB7A 5JQGA 1B3QA 3ZMVA 1GAXA 4KHPO 1WA8A 1E1QG 2F4VB 1W2BU 3BRCA 2YICA 4U3FH 3OMIB 2HP8A 3B4SA 3L74H 3EXAA 3OD4A 1IBMB 1QVFU 3RVYA 4MVMA 2ZNJA 3BEHA 2XOKG 3WB2A 3UKMA 5FPOA 5D5QA 2YXLA 2UXBB 4JYAO 4WBNA 2QDOA 3K5OA 2HLDG 2W0FC 1L1FA 2LW7A 2VS0A 2L6LA 4CBCA 1BL8A 3ABTA 3FB7C 4LF7O 4R6ZA 3VQWA 4FPPA 3CRCA 4NYKA 1N36B 2EULA 3HKEA 5IYCO 4R8CA 1V55C 4J9ZB 4JI7O 5LXTB 2BOCC 3LUTB 1BMFG 1AVMA 1OCRB 5FNVB 2R9AA 5LYJB 1DF4A 1OCRC 2IW5A 2YXYA 2EIJC 4FJCC 4H13B 4EFEA 2YEVB 1YIJV 3KCYA 1M5IA 5GONB 4UCUA 3A2FA 3QTCA 4GX1A 4F6EA 3BVOA 4O4JB 1NJIW 4JYBA 3R66A 1H8HG 3BA8A 2ODMA 4GUNA 2E76B 4JZGA 1N32O 4I50A 2ZR3A 3C3SA 3QNEA 2BSKB 2CTQA 1V54C 2IBZH 5LMNB 1AJQA 4Z1MG 3LNNA 1IXBA 3JAMN 5L3EA 1TUBB 3B09A 2JJ1G 1KC8W 4X64B 2DE0X 2LFRA 5JCOA 3H1JH 1OJHA 2ZM6O 4MVSA 5IT9N 4TV9A 5H5NA 4RAIA 4UB6Z 1B06A 2ZIOA 4K0KO 3VQXA 5KX5A 2DWEC 5L3GA 1GN6A 1XL4A 3B77A 3K5NA 1PL0A 4PA6A 1FFXB 1PP9H 2QJ1A 3ZRSA 4W4LA 2K9PA 2JEUA 5CA0B 2PY5A 1RP3B 2R70A 1N8RW 4UCSA 4UB8Z 5LMUO 2WAMA 2YS8A 1XNQO 4PELA 1RPOA 4JI6B 1BT8A 1WN7A 3E22A 4CS4A 2XTAA 1GRJA 1YCIA 4OXSA 1JCHA 4X20A 5KMGB 1VQPV 4O4IA 4NXNB 3N2GA 3WB1A 3JALA 4ZI7A 4JI5O 1JA8A 4JTCB 3PN1A 3SPHA 5EIBD 3ZHQA 3M8AA 1G6UA 4WFFA 1QLEB 3THOA 1QLEC 2Q0OC 2E5LB 2B1IA 1BE3H 3ML0A 2JRIA 4DV5B 3JAKA 1N34O 1N4CA 2NN4A 2P4VA 2DOSA 4N21A 5GW7A 3A0RA 3KCXA 1DTOA 2UXDB 3SYQA 2OT5A 4LF4B 4O2BB 2X6BA 3HKDB 4BIUA 1KMIZ 5L3BA 4PDVA 4P30A 2YI8A 3ETGA 2Z5UA 1AJNA 2F93B 4RQEA 2VQFB 3CS5A 2ZNIA 2NLJC 4GKJB 1RFYA 4UCRA 2ZQMA 1YXBA 5EBLC 3FYIB 5DN6G 1SQFA 1M90W 4CH5A 3ABLB 1QNMA 3ABLC 3D3IA 2QSAA 4O2AB 4IYHA 2X6AA 1YTFB 1CPYA 4DR1B 3ABUA 2AXTZ 4D6TH 4DR7B 4JI4O 2YIDA 2OTJV 1QCEA 3TCUA 1Y76A 5J2TB 4OGQB 3CX5F 1TA8A 1VP7A 1XDCA 4PA7A 3T4DA 3IC9A 5L3CA 1F4MA 1WB8A 4DV7B 1XNRO 3D36C 5J2UB 1GKFA 4QGPA 5EZYB 1NVPB 1LR1A 1PL4A 1WAZA 3FKSG 4J10A 1JQ0A 2CTPA 5CMUA 1Q82W 3SDLA 3ICXA 2HHHO 3H9VA 4YIPA 2QE7G 3DC5A 1K33A 4X8AA 2GTAA 5LHGA 4X1YB 3JCUZ 3S3WA 1Y6XA 3BAAA 5JVDB 3F7YC 4PI0A 5LOVB 3SPGA 5K1XA 4UV8A 4DV2B 2GV9A 5LXTA 3J81N 1I0HA 2HG5C 1MOFA 5LYJA 1SS3A 1IZ3A 2YEVA 4GCZA 1S3JA 1SETA 3AG3B 4X65O 4JV5O 1GN2A 2H3OA 5GONA 3T1HO 4RQFA 2Q8VA 4PDLA 3ZHUA 4O4JA 3ZMTA 1K73W 2VWKA 4RWUA 4IGGA 4EB6B 2GUZB 2P4KA 3RYFB 4F6RB 2ARHA 2QWPB 3ZEDA 1W59A 4LFBB 5EC2C 3I55V 3CC2V 2PUSA 1PNMA 1YJ9V 1COWG 3UT5B 1URFA 3OR7C 1YTFD 1X59A 5FL7G 3RFRA 1NH2B 2B5UA 2QWNB 4BIOA 1NS1A 2ZD9A 2EBOA 3H1KH 2QR4A 2GDSA 3BFRA 4UV9A 5JJEB 3JATB 2Q68A 2Y4TA 1LNQA 4K35A 2VQEB 1CXZB 2WWWA 5TISZ 1VMGA 3DC6A 2DMXA 1XMQB 4MVOA 4KFMA 1S5JA 4PI2A 3T1CA 5EYPB 4F4LA 1NBMG 1FAFA 3KDRA 5CB4B 4DV0B 1FFXA 1I5YA 4EKWA 1BSMA 5CA0A 3SYPA 4TOIA 3B8MA 1HR0O 2PGGA 3SPJA 5IWAB 4QPJA 2Q5ZA 4FMTA 1N0JA 2PI5A 3CXHF 5JJNB 4ABMA 1FXVA 2LGWA 3FB6C 1IBLO 1HW7A 1EM1A 1SA0B 1WPXA 2O57A 3RYCB 3UQ8A 4TQFA 5KMGA 3LSQA 4ICGA 1H2NA 4JYCA 2IJHA 2Q7HA 2R9IA 2WLMA 2CGNA 1P84F 4DV4O 5C93A 1GN4A 2ETNA 3OE7G 2F66C 2QWQB 1PNKA 5IE9A 4DR4B 2UUCB 1MZFA 3EFFK 3SGIA 2GHYA 2UU9B 2DYRB 2DYRC 3JSNA 3L71H 5KAFZ 3RYIB 1AI6A 5EC1C 1NKDA 2UXCB 1M1KW 1VF6C 3G6EV 4U3JB 2F4VO 3F7VC 4MS2A 2A0LA 4O2BA 3UO3A 3HKDA 1EFRG 4DRXA 1ZUQA 3RT3C 2Q73A 1NH2D 5JJJB 1WPBA 3ZRVA 1L8DA 3WB0A 1KU9A 1E1RG 1AI5A 2RDCA 3CB2A 3BPZA 2UXBO 3QVNA 3IC7A 4MVRA 5B1BB 2JJ2G 4MSWC 4U7NA 4TUYB 5B1BC 4JTDB 1FOUA 2JS3A 1Q7YW 2Q7GA 4JAVA 2XHBA 4O2AA 1RPRA 2H8PC 1VARA 3T1YO 4LBEC 2ZE6A 1N36O 1YSCA 4MVQA 4Q6GA 3CRQA 2YC0A 2IU3A 2Y69B 3ZJZA 5K1PA 3TXQA 5J2TA 2Y69C 1VQ9V 3JD2A 4NTXA 2AGAA 1S5LZ 4UCOA 3D36A 3BY6A 4BR6A 5J2UA 5KLVH 3VBBA 1VQOV 2OYQA 3M99B 5EZYA 2HJFC 3MHSC 1I94B 4WFEA 4QE9A 4BW5A 1X4TA 1QU7A 3WG7B 5LMNO 2HEPA 1MSWD 2N05A 3WG7C 2DJVA 3W7UA 1P49A 4X1KB 3ZN0A 4DUZO 1GH6A 1W0KG 4X1YA 1Q43A 4LF8B 3G6BA 5JVDA 2EIKB 4NXMO 2R72A 2EIKC 4NTWA 5LOVA 1DK1A 2WA3A 3FD9A 4K8XA 2Q4PA 4FFKA 3ZMZA 1OCZB 2ZINA 2ZT9B 1OCZC 1H2SB 4ZHQB 2JGUA 2A06H 3OGIB 3FFQA 2E75B 4I5SA 2Q69A 4LFAO 4EB6A 3RYFA 3TETA 4F6RA 1QR8A 4JAAA 2ILMA 1JR9A 1F7YA 1P4RA 1XMOB 2LW1A 5L3DA 2HR3A 4JTAB 3U0ZA 2P22C 2E3CA 1FXHA 1KP2A 1HNXO 4NXNO 4FZ0A 4WF9V 2EJRA 3SJQC 4PA9A 1QQCA 1WNSA 3JATA 3BHPA 1XQ8A 4FLVA 4I0XB 3ASOB 3ASOC 1KKDA 2YUAA 5EIBC 5IYDO 1I7FA 5KA6A 3OTFA 4LF6B 2QM4A 4IHJB 2V1DA 4JASA 3F5TA 1SZXA 3G71V 5EYPA 2F95B 2QKSA 4X62B 1N33B 5CB4A 1GM7A 3A8TA 1RSOB 4HNAB 4C7UA 5KHHA 3R65A 4FZ1A 4JI3B 2UXDO 2Q6AA 3MHHC 4AI8A 4UUJC 3WU2Z 3OMNB 4LF4O 1SQVH 4JF3A 4H37A 5HFLA 2VWJA 1GO3F 5EBMC 2DWDC 3SJCC 4LR3A 4JI0B 2N04A 3O65A 1CP9A 4B3MB 2VQFO 1P7BA 1SA0A 3RYCA 4DR3O 1PV0A 5BMVB 1MABG 1Q5OA 3H1HH 2A3QA 4UFZA 2ZCEA 1TAEA 2VRZA 5LGUA 4DV6B 4Z2WA 1VQ4V 2ADQB 2HJDA
chains in the Genus database with same CATH topology
3K9SA 2GDSA 1XDCA 2AW9A 3BFRA 3IC9A 1P7GA 2ADPA 2CE4A 1D5NA 2CDYA 1I08A 1WB8A 1BT8A 3QVNA 1EN6A 3DC6A 1XUQA 1JR9A 1AVMA 2QKCA 5AG2A 4E4EA 1JA8A 1PL4A 1MNGA 1VARA 3KDRA 1IX9A 1Y67A 1AR5A 4F6EA 1BSMA 4JYYA 3KKYA 4YIPA 1KKCA 3DC5A 1LUWA 1ZLZA 1EN5A 1AP6A 1GN3A 4GUNA 2RCVA 4JZGA 1MA1A 1N0JA 1VEWA 1LUVA 3C3SA 1MSDA 3OT7A 4BR6A 1EM1A 2QKAA 3AK1A 4JZ2A 4X9QA 1XREA 1IXBA 1I0HA 1SZXA 3AK2A 1GN4A 1XILA 1GN2A 1ZTEA 3C3TA 1WB7A 1N0NA 5A9GA 4C7UA 1AR4A 1EN4A 3MDSA 3AK3A 1BS3A 2P4KA 1B06A 1GN6A 3LSUA 1IDSA 1QNMA 1ZSPA 1PM9A 3CEIA 3TJTA 1MMMA 3EVKA 4YIOA 1ZUQA 4FFKA 3RN4A 2ADQB 1AP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9S A;  2GDS A;  1XDC A;  2AW9 A;  3BFR A;  3IC9 A;  1P7G A;  2ADP A;  2CE4 A;  1D5N A;  2CDY A;  1I08 A;  1WB8 A;  1BT8 A;  3QVN A;  1EN6 A;  3DC6 A;  1XUQ A;  1JR9 A;  1AVM A;  2QKC A;  5AG2 A;  4E4E A;  1JA8 A;  1PL4 A;  1MNG A;  1VAR A;  1IX9 A;  1Y67 A;  1AR5 A;  4F6E A;  1BSM A;  4JYY A;  3KKY A;  4YIP A;  1KKC A;  3DC5 A;  1LUW A;  1ZLZ A;  1EN5 A;  1AP6 A;  1GN3 A;  4GUN A;  2RCV A;  4JZG A;  1MA1 A;  1N0J A;  1VEW A;  1LUV A;  3C3S A;  1MSD A;  3OT7 A;  4BR6 A;  1EM1 A;  2QKA A;  3AK1 A;  4JZ2 A;  4X9Q A;  1XRE A;  1IXB A;  1I0H A;  1SZX A;  3AK2 A;  1GN4 A;  1XIL A;  1GN2 A;  1ZTE A;  3C3T A;  1WB7 A;  1N0N A;  5A9G A;  4C7U A;  1AR4 A;  1EN4 A;  3MDS A;  3AK3 A;  1BS3 A;  2P4K A;  1B06 A;  1GN6 A;  3LSU A;  1IDS A;  1QNM A;  1ZSP A;  1PM9 A;  3CEI A;  3TJT A;  1MMM A;  3EVK A;  4YIO A;  1ZUQ A;  4FFK A;  3RN4 A;  2ADQ B;  1AP5 A; 
#chains in the Genus database with same CATH topology
 2Y0I A;  4LF9 B;  4Z1V A;  4JI2 B;  1V9P A;  2PZS A;  3BCC H;  3SR2 C;  4I9Q A;  1IJG A;  4I55 B;  1YVW A;  4RUE A;  4RO2 A;  2WA4 A;  1L0L H;  4UVC A;  4ASU G;  4UVB A;  1US6 A;  1K5Q A;  1VF6 A;  2LO1 A;  4DV7 O;  3FAV B;  3RYH B;  1HP8 A;  4U3J A;  1KQS U;  2CGO A;  3E83 A;  2IJJ A;  4LH7 A;  2AHZ A;  2G38 A;  3GB7 C;  5IY5 B;  5KUK A;  5IY5 C;  1YEW A;  2Q0A A;  2IJI A;  5LA6 B;  4ZBM A;  1LUV A;  1SER A;  2FKX A;  4MTG A;  5B5E Z;  4DR2 O;  4HAM A;  4U7O A;  2AZ0 A;  4TUY A;  1XRE A;  4O4L B;  2N74 A;  2YIA A;  2F23 A;  3APQ A;  2Y4U A;  1BQZ A;  3OUS A;  2KG7 B;  1FS0 G;  1VQL V;  3OEE G;  1SQG A;  1BZK A;  5H9C A;  3HKB B;  4JI8 B;  2QA4 V;  2OWO A;  4DR5 O;  3UO2 A;  2QWO B;  1H2L A;  1NTK H;  4X1I B;  2PI4 A;  3DTU B;  2LFS A;  2OCH A;  1EZV H;  1ZAU A;  4LCU C;  1KBH A;  1H2M A;  1ZSP A;  3AG7 A;  4J42 A;  3CCU V;  3L72 H;  3ZS8 C;  1NZ6 A;  1UPG A;  3H01 A;  4EEQ A;  4X88 A;  1FXK B;  1FXK C;  2FML A;  1N32 B;  3E8H A;  1KEC A;  2ADP A;  1SZT A;  3OR6 C;  2CE4 A;  1AI7 A;  2RMK B;  3S3X A;  4UCV A;  5L3F A;  4X1K A;  1R3K C;  5AG2 A;  3DGE A;  5LL6 Y;  4YJ2 B;  4FFB B;  5KHK A;  4TT3 G;  3JYC A;  2UXN A;  3OUF A;  4K0K B;  1GM8 A;  4GX2 A;  2LJ2 A;  1XMQ O;  1ZL8 B;  2M7W A;  4MTX A;  2HFE C;  1S76 D;  2EIL B;  4ZHQ A;  2WSS G;  5EBW C;  4E2L A;  3HKC B;  4BIZ A;  3ZCC A;  3E8B A;  4FM0 A;  2YIB D;  4X66 O;  4X9Q A;  3OFN G;  4FK5 C;  4X89 A;  3A0B Z;  5B1A B;  3AK2 A;  5B1A C;  2AZ2 A;  5LP6 B;  3P30 A;  1VQ5 V;  5IDJ A;  1ZWI C;  3IFX A;  1Y74 B;  1AR4 A;  3K79 A;  3MDS A;  4UVA A;  1BS3 A;  3FYE B;  3JCZ A;  1XHZ A;  1W0J G;  5B66 Z;  4IT5 A;  5GTI Z;  4QPK A;  4DUY O;  4MW3 A;  5FNV A;  4I0X A;  4DR4 O;  2H94 A;  5IJ0 B;  1JOY A;  4KXR A;  2UUC O;  3AG3 C;  2CTW A;  2OTL V;  1IVS A;  5BR8 B;  4FM2 A;  2UU9 O;  3ZRW B;  4IHJ A;  2KKW A;  1N34 B;  4KP4 A;  4IYI A;  1AP5 A;  1H38 A;  2X6C A;  4PDM A;  4FLX A;  1BCC H;  2UXC O;  1SQQ H;  1RSO A;  1JFF B;  4HNA A;  4HBN A;  2CDY A;  4NTY A;  4GX0 A;  3J80 N;  4NKG B;  2BSK A;  3JAS B;  4LFC O;  2QM7 A;  2QTS A;  3K0D A;  3ZHV A;  2QWR B;  1HNZ B;  2CTR A;  1G1X B;  4GZR B;  1TUB A;  1XEQ A;  3JD0 A;  1TGO A;  1VQ6 V;  4XDL A;  3JD1 A;  4PDR A;  1DLB A;  1M93 A;  1KUQ A;  3E8F A;  5BMV A;  2AHY A;  2K1E A;  1KKC A;  1RM1 B;  1Y4M A;  1DF5 A;  1RM1 C;  1FJG B;  1YJN V;  4J80 A;  3B40 A;  1TUE B;  3IGA C;  2V4D A;  4XDK A;  1F23 A;  5IJ9 B;  5LBQ A;  2BOB C;  3LDD A;  4EFB A;  3A0H Z;  3K08 A;  1R6T A;  2UUB O;  4I55 A;  1SQB H;  1S72 V;  3E8G A;  3UM7 A;  1Q86 W;  1HNW O;  4JZ2 A;  3JSL A;  1M57 B;  1K92 A;  1M57 C;  3QG5 A;  3LDE A;  3SPI A;  1YDX A;  1XNR B;  1WLE A;  1XBL A;  2OIE A;  3C3T A;  3RYH A;  4DYL A;  3MAQ A;  1AIL A;  1EN4 A;  2NR5 A;  2ZR2 A;  2PYJ A;  3W7W A;  4LF5 B;  3JD4 A;  3F5W C;  1I94 O;  2DQ3 A;  1ORQ C;  4J41 A;  5DM6 V;  1EZJ A;  2LGQ A;  2KQX A;  4CH4 A;  1QR9 A;  4O4L A;  1KD1 W;  3I56 V;  4XBF A;  4P9P A;  2KG7 A;  4LF8 O;  3GWO A;  4AHC A;  1VF5 B;  1OV9 A;  4PJ0 Z;  1F51 A;  3HKB A;  3G67 A;  2EIN B;  3CSX A;  3CCS V;  4B3R O;  1YIT V;  1VF7 A;  4DV1 B;  4YY3 O;  4DW0 A;  3AEI A;  2P90 A;  3CRM A;  3OGC C;  2JGD B;  4YXW G;  1OCC B;  4X1I A;  1JJO A;  4MVU A;  2JEX A;  1VQM V;  4JV5 B;  3ABK B;  2QKC A;  1NI8 A;  2Y0P A;  4E4E A;  3ETE A;  3AG2 B;  3ASN B;  2HKO A;  3SYO A;  1IUR A;  3ASN C;  1IBM O;  5KA5 A;  1FXK A;  2EJ7 A;  3FB5 C;  4PA3 A;  5DED A;  2IH3 C;  4WFG A;  4ZKI A;  5LHH A;  1IBK B;  2JK5 C;  1XMO O;  3U11 A;  5KHI A;  3CWB H;  3H1L H;  3LDC A;  4LC1 A;  5FPR A;  3DSQ A;  5ITZ B;  4CC6 A;  3D3Q A;  1K97 A;  2ZE8 A;  3L70 H;  3ZHS A;  2QM8 A;  1DGS A;  2L35 A;  2P67 A;  5KAI Z;  4B3S B;  2RJZ A;  4DK1 A;  4H33 A;  5C8Y B;  3T2M A;  3RBZ A;  4PA4 A;  3T4Z A;  1ARO P;  1PKX A;  4YJ2 A;  3VQY A;  4FFB A;  3I5D A;  1K8A W;  2WLI B;  1H5W A;  3K03 A;  1XL6 A;  1OCO B;  1QBZ A;  1OCO C;  1IDS A;  2OIG A;  3WFV A;  4X62 O;  1R6N A;  3RW0 A;  5CA1 B;  4LH6 A;  3HKC A;  2PF4 E;  1PM9 A;  3QO5 A;  3RWR D;  1Q6U A;  1E79 G;  3SJB C;  1J5E B;  4A5U B;  3DXR B;  5EK0 A;  1XI1 A;  3HPL C;  2BTQ B;  1MMM A;  3ZMS A;  4I4T B;  3RN4 A;  4W4K A;  5LP6 A;  4JI0 O;  5KHJ A;  1NR7 A;  4X64 O;  4FLU A;  1IBL B;  4ZIB A;  4B3M O;  1Y74 A;  1CEZ A;  5LGT A;  5F2V O;  5LGN A;  4FM1 A;  3G80 A;  3QO8 A;  1EN6 A;  1EBO A;  4FLT A;  4JI1 B;  4B3T B;  2LQT A;  2ZE5 A;  4LF9 O;  2CAZ C;  3ABM B;  5IJ0 A;  3OTO B;  1IX9 A;  1K3E A;  1H2G A;  2XAQ A;  3OEH G;  2HVK C;  4FLZ A;  4GKK B;  3CXC U;  3ZRW A;  1H2K A;  3EHB B;  2ZKO A;  2D2C B;  1LUW A;  2C2A A;  3TK1 A;  4UCT A;  1SES A;  1YZB A;  2GUZ A;  1MA1 A;  3CME V;  2EX3 A;  1JFF A;  5D5P A;  3OT7 A;  4DV3 B;  2EIM B;  3JAS A;  2GSM B;  3K04 A;  2EIM C;  2YSU B;  3SJA C;  3UT5 A;  3N2K B;  4JI6 O;  2JDI G;  1D5A A;  1BHA A;  4JPR A;  3J7A U;  2A79 B;  1YI2 V;  4G28 B;  3JAR B;  1OHH G;  1N0N A;  5A9G A;  2W6I G;  5IYZ B;  4UXN A;  2UUA B;  5JH7 B;  2W6J G;  4PV1 B;  4N23 A;  1I5X A;  3Q4H B;  1Z2G A;  2E5L O;  2WPD G;  4GYC B;  3VOU A;  5IJ9 A;  3T1Y B;  3LSU A;  1K4D C;  4DV5 O;  1HDJ A;  1V55 B;  4NR1 A;  1VQ8 V;  1WP8 A;  4JI8 O;  3ZN1 A;  4L87 A;  4OX9 B;  4YHH B;  4FLY A;  2EIJ B;  5J9P C;  2F43 G;  1JNB A;  4YIO A;  5CBH A;  4AQY B;  1VQ7 V;  3E86 A;  4J11 A;  2AW9 A;  4J7J A;  2Z3Y A;  2DYS B;  1D5N A;  1KP3 A;  2DYS C;  3CE2 A;  1MZE A;  4MVZ A;  2EZP A;  4XDJ A;  2KB1 A;  2FL4 A;  2ZDI A;  3ETQ A;  4QIW F;  1K9M W;  2RQ6 A;  2Z0A A;  1O9G A;  1QHT A;  1Q8I A;  1NTZ H;  4GKJ O;  2RN9 A;  2X0L A;  1V54 B;  4K3A A;  3P3P A;  3X2Q B;  4ZOL B;  3X2Q C;  1VIB A;  1Y67 A;  1IXM A;  2GTS A;  2XAF A;  2XT9 A;  2NNU A;  4DUZ B;  4DR1 O;  4DR6 B;  5FLX N;  2WLL B;  4DR7 O;  1AP6 A;  1EN5 A;  1R73 A;  2YXH A;  4NXM B;  3VQV A;  1H8E G;  1AJP A;  3NR7 A;  3BAB A;  3RYI A;  3JAW B;  2JGD A;  3AK1 A;  4LWS B;  4KHP B;  5BY1 A;  4O4H B;  2WLJ A;  1Y66 A;  4K8Z A;  2QEX V;  1XIL A;  4G2K A;  3LNM B;  2XAG A;  2BCC H;  3OAA G;  4LFA B;  1JMK C;  4OPH A;  1G4Y B;  1TVK B;  3CRR A;  2OCC B;  2OCC C;  2ATK C;  3AG1 B;  3AG1 C;  1B04 A;  4JYA B;  5H2F Z;  2QTO A;  4PHZ A;  5ITZ A;  2ITD C;  4IIJ B;  1UJW B;  4WFB V;  2CH7 B;  3ZX6 A;  1XOU A;  5IYB O;  3CCL V;  1T5E A;  3CEI A;  1HNX B;  1GMG A;  3TJT A;  2B1G A;  4LF7 B;  3UCS C;  2DQ0 A;  5C8Y A;  3EVK A;  1WJZ A;  4DV2 O;  4JI7 B;  2P6J A;  4J7Z A;  3K57 A;  3CC7 V;  2WLN A;  1YHQ V;  3CHX A;  1D2D A;  4H44 B;  3CD6 V;  4B7E A;  5BR8 O;  4LP8 A;  2Q7E A;  2WLI A;  3FB8 C;  3G4S V;  1FKA O;  3RVZ A;  4J9Y B;  3L9D A;  3M7M X;  1YJW V;  4D7T A;  1VQN V;  5CA1 A;  4HYO A;  1K5S A;  4B08 A;  1OZ0 A;  4LFB O;  5BXZ A;  3DXR A;  4LNU B;  2BTQ A;  4DRX B;  2QGN A;  1HNZ O;  4I7Z B;  3CCR V;  4I4T A;  2JS5 A;  3K3W A;  2RCV A;  5LHI A;  2FYU H;  2FB5 A;  3N27 A;  4QJF B;  1FPO A;  2P5O A;  5CBF A;  5B3S B;  2ZE7 A;  4DR3 B;  5B3S C;  2A7W A;  1Q6I A;  2ZM6 B;  2D3O W;  2ZXW B;  1JJ2 U;  2ZXW C;  3APO A;  1PPJ H;  1FJG O;  4H0L B;  3B8N A;  2EZO A;  2VQE O;  2RNB A;  4J7K A;  3CCE V;  3STL C;  3CCQ V;  1L0N H;  3U10 A;  1JPX A;  1XHX A;  2EIL C;  2DN9 A;  1SF9 A;  3D8C A;  2IJK A;  4YJ3 B;  5H6R A;  4WFA V;  2ZIM A;  2LP7 A;  2HVJ C;  4DV0 O;  4TV8 B;  1GTO A;  2Q67 A;  2Y48 A;  1NT2 B;  3KG2 A;  3JD3 A;  2BTO A;  3QF7 A;  5IWA O;  5LMU B;  1MG1 A;  5CN0 A;  1XNQ B;  5LP6 C;  4LF5 O;  3E89 A;  3N2K A;  3HB3 B;  3ZRX A;  5KHG A;  3E2E A;  1NQT A;  4MTF A;  4BW9 A;  4IL6 Z;  2WLH A;  4AIL C;  3K58 A;  3JAR A;  3QO7 A;  1M4U A;  4JI5 B;  4DR2 B;  1P7G A;  5IYZ A;  4QNH B;  1I08 A;  3OW2 U;  5JH7 A;  3W7T A;  3GWK C;  1Q81 W;  2JIZ G;  3Q4H A;  5HFM A;  5A2Q N;  3IAY A;  1K34 A;  3CCJ V;  1F4N A;  2XAS A;  4L8J A;  1AR1 B;  3W7S A;  1KYO F;  3RGB A;  3CJH B;  4DR5 B;  1R3J C;  1SKV A;  4DV1 O;  3KKY A;  5JQG B;  1WA8 B;  4CH3 A;  2FTK A;  4JGS A;  1ZX3 A;  4MTO A;  3OM3 B;  1FFT B;  4RUF A;  3GVM A;  2F1M A;  1IBK O;  1R3I C;  2KSD A;  1VQK V;  1Z5W A;  1B6Q A;  4WBN B;  3PJS K;  2XAJ A;  2P7T C;  1R3L C;  3SYC A;  2M6Y A;  4ZOL A;  5E1A C;  3ZBH A;  3ZHT A;  2R9R B;  4G27 B;  2IH1 C;  1Z5V A;  4B3S O;  3LSS A;  2BE3 A;  1SQP H;  3B2E E;  2WLL A;  4WFH A;  4JI4 B;  4DXW A;  3HKE B;  4P2Z A;  2XAH A;  1BQ0 A;  3CC4 V;  3AG4 B;  3CPW U;  2MW2 B;  3AG4 C;  1ROP A;  4CC5 A;  1S5H C;  3TGU H;  1ENV A;  1FYJ A;  1PD3 A;  3K5M A;  4KUM A;  3W7X A;  4I9W A;  3JAW A;  3CMA V;  1Q3E A;  4LWS A;  2P06 A;  3FAV A;  4O4H A;  1U96 A;  4BAY A;  1JX9 A;  1KB9 F;  1NVP D;  3K59 A;  4GX5 A;  3SPC A;  1R6K A;  4Q20 A;  2JVD A;  4TWK A;  4CS2 A;  4HZ3 A;  3E35 A;  3P32 A;  3ETD A;  2ZDI C;  4R7C A;  3H1I H;  4I50 B;  1QLN A;  3CCM V;  1TVK A;  3FX7 A;  5LA6 A;  4X66 B;  1J5E O;  1Q6H A;  5CA3 A;  2HHH B;  4NVP A;  2YIB A;  3C90 A;  2PTM A;  3CCV V;  1R1B A;  5H6Q A;  1NTM H;  3KZI Z;  4IIJ A;  3K5L A;  2CUG A;  1YF2 A;  1MNG A;  4CS3 A;  2CH7 A;  1M56 B;  4FLW A;  1M56 C;  5CBG A;  2IM9 A;  2DW4 A;  5DEC A;  3K06 A;  5JWP A;  1A32 A;  4JYY A;  5JCO C;  3BA9 A;  4PD4 F;  4CZZ A;  4TV9 B;  3CP1 A;  2EIN C;  3TXS A;  4DUY B;  4B3T O;  4JI1 O;  1GN3 A;  4FIP C;  5B1O A;  4JAU A;  4DW1 A;  3L73 H;  5KX5 B;  4GLX A;  2WLK A;  3OTO O;  4X65 B;  1OCC C;  1VEW A;  2UXX A;  2PYL A;  1NU1 H;  3CRA A;  3T1H B;  2YDE A;  2W0X A;  3ABK C;  1MSD A;  2E74 B;  3IJ4 A;  3ZMU A;  5BZB A;  4GT1 A;  4GKK O;  4DO2 A;  4TSF G;  1U97 A;  1AI4 A;  3AG2 C;  4R50 A;  3HR0 A;  3ZIA G;  1K4C C;  4OPA A;  3CYO A;  1FD9 A;  1HWY A;  3L75 H;  3P3N A;  1ZTE A;  2XUM A;  4P9O A;  1WP7 A;  4LFC B;  4DV3 O;  1G8M A;  1BHB A;  4LNU A;  1S77 D;  3E22 B;  3AK3 A;  4BWA A;  4X20 B;  4O4I B;  2V7Q G;  3N2G B;  2ITC C;  3JAL B;  4ZI7 B;  1QVG U;  1GK9 A;  4KL1 A;  1PNL A;  2YI9 A;  1J95 A;  2CK3 G;  2UUA O;  1M9N A;  4FVM A;  5KUM A;  3K0G A;  3K9A A;  1SC5 B;  4QE7 A;  2B9Z A;  4LF6 O;  1ZL8 A;  3JAK B;  2UUB B;  3K9S A;  3ZHR A;  2X7R B;  3OMA B;  1HNW B;  4YJ3 A;  4CH6 A;  1N33 O;  3STZ C;  4OX9 O;  4TV8 A;  4YHH O;  1NR1 A;  4JI3 O;  1HR0 B;  1XUQ A;  4AQY O;  1O9H A;  4MT8 A;  2MK3 A;  4D7S A;  5GTH Z;  1AR5 A;  3MD0 A;  4TQD A;  1ZLZ A;  1SRY A;  4DK0 A;  2XND G;  1GM9 A;  1JVM A;  1K7D A;  2IU0 A;  4DV4 B;  1UFI A;  4DV6 O;  1BGY H;  2A9H A;  2Q9L A;  1SQX H;  4JI2 O;  4NB5 A;  3O9O A;  5E79 Z;  3ABM C;  2QKA A;  1Q90 D;  1THZ A;  4DR6 O;  4B7K A;  2GBO A;  3NXS A;  3SYA A;  1AB3 A;  1Y76 B;  5B1N A;  4MW8 A;  3CJH A;  1S0V A;  4B3R B;  4WCE V;  4YY3 B;  1WB7 A;  5JQG A;  1B3Q A;  3ZMV A;  1GAX A;  4KHP O;  1WA8 A;  1E1Q G;  2F4V B;  1W2B U;  3BRC A;  2YIC A;  4U3F H;  3OMI B;  2HP8 A;  3B4S A;  3L74 H;  3EXA A;  3OD4 A;  1IBM B;  1QVF U;  3RVY A;  4MVM A;  2ZNJ A;  3BEH A;  2XOK G;  3WB2 A;  3UKM A;  5FPO A;  5D5Q A;  2YXL A;  2UXB B;  4JYA O;  4WBN A;  2QDO A;  3K5O A;  2HLD G;  2W0F C;  1L1F A;  2LW7 A;  2VS0 A;  2L6L A;  4CBC A;  1BL8 A;  3ABT A;  3FB7 C;  4LF7 O;  4R6Z A;  3VQW A;  4FPP A;  3CRC A;  4NYK A;  1N36 B;  2EUL A;  3HKE A;  5IYC O;  4R8C A;  1V55 C;  4J9Z B;  4JI7 O;  5LXT B;  2BOC C;  3LUT B;  1BMF G;  1AVM A;  1OCR B;  5FNV B;  2R9A A;  5LYJ B;  1DF4 A;  1OCR C;  2IW5 A;  2YXY A;  2EIJ C;  4FJC C;  4H13 B;  4EFE A;  2YEV B;  1YIJ V;  3KCY A;  1M5I A;  5GON B;  4UCU A;  3A2F A;  3QTC A;  4GX1 A;  4F6E A;  3BVO A;  4O4J B;  1NJI W;  4JYB A;  3R66 A;  1H8H G;  3BA8 A;  2ODM A;  4GUN A;  2E76 B;  4JZG A;  1N32 O;  4I50 A;  2ZR3 A;  3C3S A;  3QNE A;  2BSK B;  2CTQ A;  1V54 C;  2IBZ H;  5LMN B;  1AJQ A;  4Z1M G;  3LNN A;  1IXB A;  3JAM N;  5L3E A;  1TUB B;  3B09 A;  2JJ1 G;  1KC8 W;  4X64 B;  2DE0 X;  2LFR A;  5JCO A;  3H1J H;  1OJH A;  2ZM6 O;  4MVS A;  5IT9 N;  4TV9 A;  5H5N A;  4RAI A;  4UB6 Z;  1B06 A;  2ZIO A;  4K0K O;  3VQX A;  5KX5 A;  2DWE C;  5L3G A;  1GN6 A;  1XL4 A;  3B77 A;  3K5N A;  1PL0 A;  4PA6 A;  1FFX B;  1PP9 H;  2QJ1 A;  3ZRS A;  4W4L A;  2K9P A;  2JEU A;  5CA0 B;  2PY5 A;  1RP3 B;  2R70 A;  1N8R W;  4UCS A;  4UB8 Z;  5LMU O;  2WAM A;  2YS8 A;  1XNQ O;  4PEL A;  1RPO A;  4JI6 B;  1BT8 A;  1WN7 A;  3E22 A;  4CS4 A;  2XTA A;  1GRJ A;  1YCI A;  4OXS A;  1JCH A;  4X20 A;  5KMG B;  1VQP V;  4O4I A;  4NXN B;  3N2G A;  3WB1 A;  3JAL A;  4ZI7 A;  4JI5 O;  1JA8 A;  4JTC B;  3PN1 A;  3SPH A;  5EIB D;  3ZHQ A;  3M8A A;  1G6U A;  4WFF A;  1QLE B;  3THO A;  1QLE C;  2Q0O C;  2E5L B;  2B1I A;  1BE3 H;  3ML0 A;  2JRI A;  4DV5 B;  3JAK A;  1N34 O;  1N4C A;  2NN4 A;  2P4V A;  2DOS A;  4N21 A;  5GW7 A;  3A0R A;  3KCX A;  1DTO A;  2UXD B;  3SYQ A;  2OT5 A;  4LF4 B;  4O2B B;  2X6B A;  3HKD B;  4BIU A;  1KMI Z;  5L3B A;  4PDV A;  4P30 A;  2YI8 A;  3ETG A;  2Z5U A;  1AJN A;  2F93 B;  4RQE A;  2VQF B;  3CS5 A;  2ZNI A;  2NLJ C;  4GKJ B;  1RFY A;  4UCR A;  2ZQM A;  1YXB A;  5EBL C;  3FYI B;  5DN6 G;  1SQF A;  1M90 W;  4CH5 A;  3ABL B;  1QNM A;  3ABL C;  3D3I A;  2QSA A;  4O2A B;  4IYH A;  2X6A A;  1YTF B;  1CPY A;  4DR1 B;  3ABU A;  2AXT Z;  4D6T H;  4DR7 B;  4JI4 O;  2YID A;  2OTJ V;  1QCE A;  3TCU A;  1Y76 A;  5J2T B;  4OGQ B;  3CX5 F;  1TA8 A;  1VP7 A;  1XDC A;  4PA7 A;  3T4D A;  3IC9 A;  5L3C A;  1F4M A;  1WB8 A;  4DV7 B;  1XNR O;  3D36 C;  5J2U B;  1GKF A;  4QGP A;  5EZY B;  1NVP B;  1LR1 A;  1PL4 A;  1WAZ A;  3FKS G;  4J10 A;  1JQ0 A;  2CTP A;  5CMU A;  1Q82 W;  3SDL A;  3ICX A;  2HHH O;  3H9V A;  4YIP A;  2QE7 G;  3DC5 A;  1K33 A;  4X8A A;  2GTA A;  5LHG A;  4X1Y B;  3JCU Z;  3S3W A;  1Y6X A;  3BAA A;  5JVD B;  3F7Y C;  4PI0 A;  5LOV B;  3SPG A;  5K1X A;  4UV8 A;  4DV2 B;  2GV9 A;  5LXT A;  3J81 N;  1I0H A;  2HG5 C;  1MOF A;  5LYJ A;  1SS3 A;  1IZ3 A;  2YEV A;  4GCZ A;  1S3J A;  1SET A;  3AG3 B;  4X65 O;  4JV5 O;  1GN2 A;  2H3O A;  5GON A;  3T1H O;  4RQF A;  2Q8V A;  4PDL A;  3ZHU A;  4O4J A;  3ZMT A;  1K73 W;  2VWK A;  4RWU A;  4IGG A;  4EB6 B;  2GUZ B;  2P4K A;  3RYF B;  4F6R B;  2ARH A;  2QWP B;  3ZED A;  1W59 A;  4LFB B;  5EC2 C;  3I55 V;  3CC2 V;  2PUS A;  1PNM A;  1YJ9 V;  1COW G;  3UT5 B;  1URF A;  3OR7 C;  1YTF D;  1X59 A;  5FL7 G;  3RFR A;  1NH2 B;  2B5U A;  2QWN B;  4BIO A;  1NS1 A;  2ZD9 A;  2EBO A;  3H1K H;  2QR4 A;  2GDS A;  3BFR A;  4UV9 A;  5JJE B;  3JAT B;  2Q68 A;  2Y4T A;  1LNQ A;  4K35 A;  2VQE B;  1CXZ B;  2WWW A;  5TIS Z;  1VMG A;  3DC6 A;  2DMX A;  1XMQ B;  4MVO A;  4KFM A;  1S5J A;  4PI2 A;  3T1C A;  5EYP B;  4F4L A;  1NBM G;  1FAF A;  3KDR A;  5CB4 B;  4DV0 B;  1FFX A;  1I5Y A;  4EKW A;  1BSM A;  5CA0 A;  3SYP A;  4TOI A;  3B8M A;  1HR0 O;  2PGG A;  3SPJ A;  5IWA B;  4QPJ A;  2Q5Z A;  4FMT A;  1N0J A;  2PI5 A;  3CXH F;  5JJN B;  4ABM A;  1FXV A;  2LGW A;  3FB6 C;  1IBL O;  1HW7 A;  1EM1 A;  1SA0 B;  1WPX A;  2O57 A;  3RYC B;  3UQ8 A;  4TQF A;  5KMG A;  3LSQ A;  4ICG A;  1H2N A;  4JYC A;  2IJH A;  2Q7H A;  2R9I A;  2WLM A;  2CGN A;  1P84 F;  4DV4 O;  5C93 A;  1GN4 A;  2ETN A;  3OE7 G;  2F66 C;  2QWQ B;  1PNK A;  5IE9 A;  4DR4 B;  2UUC B;  1MZF A;  3EFF K;  3SGI A;  2GHY A;  2UU9 B;  2DYR B;  2DYR C;  3JSN A;  3L71 H;  5KAF Z;  3RYI B;  1AI6 A;  5EC1 C;  1NKD A;  2UXC B;  1M1K W;  1VF6 C;  3G6E V;  4U3J B;  2F4V O;  3F7V C;  4MS2 A;  2A0L A;  4O2B A;  3UO3 A;  3HKD A;  1EFR G;  4DRX A;  1ZUQ A;  3RT3 C;  2Q73 A;  1NH2 D;  5JJJ B;  1WPB A;  3ZRV A;  1L8D A;  3WB0 A;  1KU9 A;  1E1R G;  1AI5 A;  2RDC A;  3CB2 A;  3BPZ A;  2UXB O;  3QVN A;  3IC7 A;  4MVR A;  5B1B B;  2JJ2 G;  4MSW C;  4U7N A;  4TUY B;  5B1B C;  4JTD B;  1FOU A;  2JS3 A;  1Q7Y W;  2Q7G A;  4JAV A;  2XHB A;  4O2A A;  1RPR A;  2H8P C;  1VAR A;  3T1Y O;  4LBE C;  2ZE6 A;  1N36 O;  1YSC A;  4MVQ A;  4Q6G A;  3CRQ A;  2YC0 A;  2IU3 A;  2Y69 B;  3ZJZ A;  5K1P A;  3TXQ A;  5J2T A;  2Y69 C;  1VQ9 V;  3JD2 A;  4NTX A;  2AGA A;  1S5L Z;  4UCO A;  3D36 A;  3BY6 A;  4BR6 A;  5J2U A;  5KLV H;  3VBB A;  1VQO V;  2OYQ A;  3M99 B;  5EZY A;  2HJF C;  3MHS C;  1I94 B;  4WFE A;  4QE9 A;  4BW5 A;  1X4T A;  1QU7 A;  3WG7 B;  5LMN O;  2HEP A;  1MSW D;  2N05 A;  3WG7 C;  2DJV A;  3W7U A;  1P49 A;  4X1K B;  3ZN0 A;  4DUZ O;  1GH6 A;  1W0K G;  4X1Y A;  1Q43 A;  4LF8 B;  3G6B A;  5JVD A;  2EIK B;  4NXM O;  2R72 A;  2EIK C;  4NTW A;  5LOV A;  1DK1 A;  2WA3 A;  3FD9 A;  4K8X A;  2Q4P A;  4FFK A;  3ZMZ A;  1OCZ B;  2ZIN A;  2ZT9 B;  1OCZ C;  1H2S B;  4ZHQ B;  2JGU A;  2A06 H;  3OGI B;  3FFQ A;  2E75 B;  4I5S A;  2Q69 A;  4LFA O;  4EB6 A;  3RYF A;  3TET A;  4F6R A;  1QR8 A;  4JAA A;  2ILM A;  1JR9 A;  1F7Y A;  1P4R A;  1XMO B;  2LW1 A;  5L3D A;  2HR3 A;  4JTA B;  3U0Z A;  2P22 C;  2E3C A;  1FXH A;  1KP2 A;  1HNX O;  4NXN O;  4FZ0 A;  4WF9 V;  2EJR A;  3SJQ C;  4PA9 A;  1QQC A;  1WNS A;  3JAT A;  3BHP A;  1XQ8 A;  4FLV A;  4I0X B;  3ASO B;  3ASO C;  1KKD A;  2YUA A;  5EIB C;  5IYD O;  1I7F A;  5KA6 A;  3OTF A;  4LF6 B;  2QM4 A;  4IHJ B;  2V1D A;  4JAS A;  3F5T A;  1SZX A;  3G71 V;  5EYP A;  2F95 B;  2QKS A;  4X62 B;  1N33 B;  5CB4 A;  1GM7 A;  3A8T A;  1RSO B;  4HNA B;  4C7U A;  5KHH A;  3R65 A;  4FZ1 A;  4JI3 B;  2UXD O;  2Q6A A;  3MHH C;  4AI8 A;  4UUJ C;  3WU2 Z;  3OMN B;  4LF4 O;  1SQV H;  4JF3 A;  4H37 A;  5HFL A;  2VWJ A;  1GO3 F;  5EBM C;  2DWD C;  3SJC C;  4LR3 A;  4JI0 B;  2N04 A;  3O65 A;  1CP9 A;  4B3M B;  2VQF O;  1P7B A;  1SA0 A;  3RYC A;  4DR3 O;  1PV0 A;  5BMV B;  1MAB G;  1Q5O A;  3H1H H;  2A3Q A;  4UFZ A;  2ZCE A;  1TAE A;  2VRZ A;  5LGU A;  4DV6 B;  4Z2W A;  1VQ4 V;  2ADQ B;  2HJD A; 
#chains in the Genus database with same CATH homology
 3K9S A;  2GDS A;  1XDC A;  2AW9 A;  3BFR A;  3IC9 A;  1P7G A;  2ADP A;  2CE4 A;  1D5N A;  2CDY A;  1I08 A;  1WB8 A;  1BT8 A;  3QVN A;  1EN6 A;  3DC6 A;  1XUQ A;  1JR9 A;  1AVM A;  2QKC A;  5AG2 A;  4E4E A;  1JA8 A;  1PL4 A;  1MNG A;  1VAR A;  3KDR A;  1IX9 A;  1Y67 A;  1AR5 A;  4F6E A;  1BSM A;  4JYY A;  3KKY A;  4YIP A;  1KKC A;  3DC5 A;  1LUW A;  1ZLZ A;  1EN5 A;  1AP6 A;  1GN3 A;  4GUN A;  2RCV A;  4JZG A;  1MA1 A;  1N0J A;  1VEW A;  1LUV A;  3C3S A;  1MSD A;  3OT7 A;  4BR6 A;  1EM1 A;  2QKA A;  3AK1 A;  4JZ2 A;  4X9Q A;  1XRE A;  1IXB A;  1I0H A;  1SZX A;  3AK2 A;  1GN4 A;  1XIL A;  1GN2 A;  1ZTE A;  3C3T A;  1WB7 A;  1N0N A;  5A9G A;  4C7U A;  1AR4 A;  1EN4 A;  3MDS A;  3AK3 A;  1BS3 A;  2P4K A;  1B06 A;  1GN6 A;  3LSU A;  1IDS A;  1QNM A;  1ZSP A;  1PM9 A;  3CEI A;  3TJT A;  1MMM A;  3EVK A;  4YIO A;  1ZUQ A;  4FFK A;  3RN4 A;  2ADQ B;  1AP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...