1I08A

Crystal structure analysis of the h30a mutant of manganese superoxide dismutase from e. coli
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKAHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
total genus 74
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i08A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i08A02
1GN6A 3LSUA 1XREA 1BSMA 1EN6A 2QKCA 1D5NA 4E4EA 1AR5A 1AR4A 4FFKA 1B06A 1MSDA 1IX9A 1BT8A 1GN4A 1Y67A 1I08A 2CE4A 3KKYA 4JZGA 3RN4A 4JYYA 4JZ2A 3BFRA 4YIPA 1GN3A 1AVMA 1AP5A 3CEIA 1GN2A 2ADQB 1ZSPA 3QVNA 4YIOA 1IDSA 1MA1A 4GUNA 1PM9A 3DC5A 1EN5A 2GDSA 1XILA 1ZUQA 3DC6A 1MMMA 3C3TA 1JR9A 3IC9A 2QKAA 4BR6A 3K9SA 1LUWA 1IXBA 1XDCA 1XUQA 3C3SA 2ADPA 1WB7A 1VARA 1ZLZA 4X9QA 2RCVA 1I0HA 1N0NA 1EN4A 1QNMA 3MDSA 1AP6A 1PL4A 1MNGA 1N0JA 3OT7A 4C7UA 3AK3A 1VEWA 1EM1A 3AK2A 1JA8A 3EVKA 1WB8A 2P4KA 4F6EA 1ZTEA 5AG2A 3AK1A 1SZXA 3TJTA 5A9GA 1LUVA 1BS3A 1KKCA 2AW9A 2CDYA 1P7GA
chains in the Genus database with same CATH superfamily
2WLIB 1BHAA 4I50A 4G28B 3F7YC 3JSNA 4KP4A 4D7TA 4GYCB 4E4EA 3CJHA 2QTSA 4AHCA 3ETEA 1ORQC 3SYOA 1XNQO 4DW1A 1MSDA 4NR1A 5KA6A 2AXTZ 4EB6A 4LF9O 2UU9O 4DUZB 1Q82W 1BCCH 2ETNA 3QNEA 2ZNJA 1GAXA 2JEUA 1Q5OA 2B1IA 4BAYA 2QA4V 4NKGB 4QGPA 4BIZA 4I9QA 4UCTA 1K7DA 2UXBB 1WN7A 2HR3A 4MVRA 3OTOB 4LF8O 4LH7A 2IBZH 1HR0B 4DV5O 2R9RB 2Y4TA 2OWOA 5J9PC 1AROP 4DW0A 1ZSPA 2KG7A 1XQ8A 3G80A 2ZR2A 5BXZA 4IHJA 1ROPA 4GX1A 4FLZA 1JR9A 4J7KA 4JTCB 3QO7A 1DK1A 1YZBA 2JIZG 4HYOA 4DV7B 5FLXN 2Q0AA 4N23A 3SPJA 2UU9B 3VBBA 5BR8O 1GK9A 2LGQA 1IJGA 3FAVA 1YJ9V 4CBCA 5EZYB 1FXKA 4DO2A 1B04A 1I7FA 3D36C 1M56C 1UFIA 4GCZA 4D7SA 1NS1A 5CA1B 3BA9A 4DV1B 2GHYA 3D8CA 3H1JH 4JV5B 5GTIZ 4FLYA 3A0HZ 4BW5A 4JI1B 3ABLB 2CTWA 1BGYH 1HNWO 4DUYO 3JAMN 3OTFA 3AG1B 1NTMH 4PI0A 3X2QB 3OE7G 1XHXA 2FKXA 4DV4B 2CUGA 3JASA 2E5LB 3B40A 3D3QA 2HG5C 3R65A 3RYFB 3ZJZA 5LP6A 3APOA 2E74B 4RWUA 3G71V 4KHPB 3ASNB 2YI8A 1GN4A 5BZBA 1NR1A 4O4IB 2F23A 4Z1VA 1N34O 3E89A 1TGOA 1ZX3A 3N2KB 3TK1A 4LFCO 1H2KA 4JASA 5GTHZ 2AZ2A 3K5OA 2YC0A 4TT3G 1YCIA 3S3XA 3U10A 1GMGA 1XL6A 2ZINA 4HZ3A 1M93A 3CEIA 1OCOB 3HKDA 4I5SA 3JD1A 3QVNA 4B3TO 3K59A 4LF4B 4IYHA 4ZOLB 2NN4A 5H5NA 1QVGU 1SETA 4X1YA 5CA0B 1Z5WA 1L8DA 4X64O 4NXMB 2Q68A 1XMQO 4WFFA 1RP3B 4DR6B 3RFRA 2ZE6A 4B7EA 3SPIA 2YXYA 2ZDIC 4YJ3B 4X9QA 3THOA 5LOVA 2ZE5A 1H2NA 1S5HC 5JVDA 4R6ZA 4TQFA 3E8BA 1Y74A 1N0JA 2EBOA 2Q4PA 2IJIA 4J7ZA 2BSKB 4MVZA 2OCCB 2CTPA 3KZIZ 3B8MA 2OIEA 1SZXA 1D5AA 5EYPA 3ZHSA 2AW9A 4FJCC 2D3OW 1M9NA 4GZRB 2PYJA 2X6AA 3T1YB 4DR2O 2F95B 4LNUB 1AR5A 4J41A 1PNMA 2JGDB 2PTMA 3M99B 2EIKC 4DR1O 2ITCC 4DR5B 4G2KA 4NTWA 4LF7B 1P7BA 3FB8C 3JD0A 5J2TB 2XAHA 4WFHA 5LA6A 2YIAA 4KL1A 1SESA 1VP7A 1FXHA 4JI5B 1R3IC 4FFBB 4O4LB 1IVSA 3K58A 4RAIA 3AG4C 3OW2U 5EC1C 2VQFO 3DXRA 4B3RB 3E86A 3ZMZA 4YIOA 1IDSA 1S0VA 5IJ9B 3W7TA 3PN1A 1U96A 5EIBD 4FM0A 2FMLA 3C3TA 3CYOA 2XUMA 3RW0A 1X4TA 2F4VO 5LMUB 3ZRSA 4LF6O 4GKJO 1N0NA 3N2GB 4TV9A 2W0XA 1NI8A 3WFVA 4MVUA 1OJHA 4DV6B 3AK3A 1OCRC 4O4HA 1H8HG 5JJEB 2W0FC 3ZBHA 5IYZB 3BEHA 3K5LA 2ODMA 5CA1A 4X62O 2CK3G 4JI2O 4DK1A 5GONB 2XTAA 1XL4A 4J7JA 1ZWIC 4UFZA 4NVPA 1K97A 4LCUC 3FB7C 1VQMV 1SQGA 4DXWA 3CCSV 4UCUA 2YIBD 5LYJB 4JI6B 4UVAA 4TV8B 5IDJA 4PDVA 4FFKA 4PHZA 1R6NA 2EIJB 4J9YB 1I94B 4CH6A 2EIMC 1BT8A 2YIBA 3P3NA 4I55A 4EFEA 1KBHA 5B3SB 5KUMA 1VIBA 2X7RB 4W4LA 5H6QA 3H9VA 4H0LB 1RFYA 3G6BA 4DV3O 1OCCC 1L1FA 3HB3B 4FIPC 4FM1A 4CS4A 3JATA 1YTFD 3BVOA 1KUQA 5IE9A 4I0XB 3KCXA 4FLWA 2QM7A 1YHQV 3CSXA 3CS5A 2BTQB 2WLKA 4DYLA 3IC9A 4JAAA 1XI1A 1GM7A 4DV2B 3K9SA 4DK0A 1XNRO 4YY3B 5LBQA 2QWNB 1BZKA 1PNLA 2P6JA 4AI8A 5KHIA 5HFMA 4HBNA 5IT9N 3L9DA 5EC2C 3APQA 1NTZH 1URFA 1FJGB 4JYCA 5K1XA 2B1GA 4AQYB 1G4YB 2BSKA 4O2AA 3EVKA 3CCLV 1WB8A 3ZMVA 2P5OA 4KFMA 3EHBB 4B08A 4PD4F 2A3QA 2WA3A 2IH3C 2XT9A 4DV0B 5B66Z 1F51A 1NVPB 1BS3A 1ZL8B 3G4SV 4XDJA 4FLXA 4PJ0Z 2DYRC 3T1CA 3ZRWB 1YIJV 2JEXA 1QLEC 3OR7C 1BQZA 1A32A 4MS2A 5IJ0A 2X6CA 1S5LZ 1K5QA 4X1KA 2VS0A 1N8RW 4X66O 1SS3A 1YSCA 2DQ3A 4PDLA 1COWG 3K0GA 1Y67A 5LL6Y 3VOUA 4X1IB 4Q6GA 2YS8A 5KAIZ 4IL6Z 3MHHC 4O4LA 4YIPA 2LO1A 1HNZO 2UXDB 3F5TA 1Q7YW 4F6RB 3TETA 1S77D 4MTOA 2L6LA 2A0LA 2H94A 5D5QA 3FB6C 3UT5B 1CP9A 3CRQA 3FX7A 3A0BZ 2UXCO 1XOUA 4QE7A 3RYIB 4X66B 4ZHQA 3JALB 2UUCO 5HFLA 5L3GA 3CCRV 1KP3A 1VF6A 4DR3O 5L3EA 1QQCA 1LR1A 1IURA 5TISZ 4HNAB 3SPHA 4O4JB 1MOFA 1FAFA 5CB4A 5LGTA 4LFAO 5JCOC 2P4KA 1ZAUA 4DRXA 5AG2A 3AK1A 1JVMA 3K57A 2ZM6B 1TA8A 4PDMA 3RVYA 3CCVV 1VMGA 3JAKA 1AR1B 4JGSA 3CCQV 1XBLA 1VQ4V 3LSUA 4LH6A 3CP1A 3LDEA 4RUEA 1AI5A 4DUZO 4H37A 4X89A 2Q7EA 3NXSA 4FLUA 1I5YA 2B5UA 1SQXH 3U11A 3K5MA 4DR4B 1NH2D 5KAFZ 2UXBO 2B9ZA 5FNVB 1R3JC 1AI4A 3OTOO 2GTSA 4GX5A 1TVKB 2AZ0A 1HR0O 5K1PA 2A7WA 1QBZA 1FFXB 1FOUA 5FPRA 1N4CA 2OT5A 4IYIA 2P90A 3OGCC 2X0LA 5BMVA 2OYQA 4JI8B 2GUZA 4U7OA 3SGIA 1AP5A 3UCSC 4BWAA 3BA8A 3KG2A 2QEXV 4DV7O 4ICGA 1V55C 3UM7A 1FFTB 1P4RA 2UUBB 4JI7B 4EKWA 3Q4HB 4B7KA 5JWPA 2M6YA 3LNNA 2QR4A 3SJQC 3SPCA 3HKEB 3GWOA 4CH4A 1V54C 1ZLZA 2Q73A 3OEHG 2F1MA 2HJDA 4DV1O 1WA8A 2EIKB 4PA9A 4JV5O 3ETGA 2Q7HA 3MDSA 2CH7B 3HKCB 4WCEV 1S72V 4JI1O 4L8JA 2PY5A 2WLLB 2PGGA 3ABTA 5J2UA 2HLDG 3B77A 4ASUG 4DV4O 1FXKC 2E5LO 2JS5A 1J5EB 4PA6A 3CMAV 4IGGA 4UB6Z 3AG4B 5B1BC 4PELA 2ZIOA 4KHPO 2N74A 4LF5B 1FS0G 3ZRWA 1NKDA 1D5NA 2HP8A 5KLVH 3CWBH 3ZN1A 4U3FH 1YVWA 4CC6A 4O2BA 4NXNB 2HEPA 5IYBO 4UCSA 1RPRA 1XHZA 4LF4O 1N36B 2HVKC 1OCRB 2CTRA 1GN3A 4NXMO 1NBMG 2ADQB 4DR6O 2EX3A 3IAYA 1AJPA 3KCYA 1KYOF 1KU9A 2Q5ZA 3ZCCA 1JOYA 2EINC 4Z2WA 3T4ZA 2QWOB 4BR6A 2ZKOA 1G6UA 1WP7A 2YUAA 1KP2A 2D2CB 2JRIA 4U3JA 3T4DA 1XUQA 3CE2A 2QTOA 3ABUA 1AILA 1NT2B 4X8AA 1Q43A 2JJ1G 3LDDA 5LMNO 3ZMTA 1YJNV 1PL4A 2EIMB 2GTAA 5D5PA 4MW8A 1VEWA 3OUSA 2P67A 4MVSA 4BW9A 1DTOA 3T1YO 1RPOA 1YI2V 3SJAC 3M7MX 4YHHB 1T5EA 5F2VO 3I56V 1OCCB 1HWYA 2XASA 1KKCA 4X20B 4DR5O 4LF7O 3UQ8A 1DLBA 1S5JA 5KMGB 4WFBV 4I4TA 2WAMA 3RYHB 3SR2C 5L3BA 3HKBB 3RYCB 3JCZA 2DQ0A 5KHGA 2LGWA 3D3IA 4JI5O 1D2DA 5JH7B 5LMNB 2Q0OC 1IX9A 2ITDC 3CCJV 1TVKA 4E2LA 2K9PA 5EBLC 1NZ6A 5EK0A 2IH1C 2WLIA 4B3RO 2QGNA 2ILMA 2WLMA 2BCCH 1SQVH 1W59A 5GW7A 4B3MB 4JYAB 4RQFA 3AG7A 3FYEB 3TXSA 2R72A 2ATKC 3AEIA 3BABA 3F7VC 3JYCA 5JJNB 4LBEC 2VWKA 5IWAB 1VF5B 4GUNA 3AG3C 5LGNA 5LMUO 4N21A 2GDSA 1XILA 1N32B 2DYRB 4J11A 5IYCO 1QLEB 4FZ1A 4DV6O 1OV9A 3PJSK 3HKEA 1KECA 1XDCA 2JJ2G 3H1IH 3KDRA 3EFFK 5IYDO 2EJ7A 2QM4A 2YSUB 1EN4A 3VQXA 1IBMB 3ZRXA 2QDOA 3HKCA 4QJFB 3I55V 3E22B 1MG1A 1K92A 1JA8A 3ML0A 5H9CA 4K3AA 5C93A 3A2FA 4TWKA 5EIBC 1R6TA 1B6QA 1PP9H 4JI6O 2LW1A 1SERA 2ZE8A 4I9WA 1LUVA 3BY6A 1TUBB 4LWSB 2ZD9A 1I94O 2X6BA 1Y6XA 5EZYA 1QHTA 3B09A 1CPYA 1XREA 3BAAA 1QR9A 2O57A 2V4DA 3UO2A 1NJIW 4PV1B 5L3DA 3U0ZA 2P06A 1J95A 3ZIAG 1SF9A 1K34A 1QCEA 2R9IA 2CE4A 2DMXA 1H38A 2RN9A 1K9MW 3SYAA 1SKVA 5H6RA 4JZ2A 3JD3A 2FB5A 3QG5A 1HNXB 3RYFA 4OX9B 3VQVA 2QWQB 4P9OA 1KC8W 4DV2O 2UXXA 4FPPA 4YY3O 2QKSA 4X88A 1VQ6V 2E76B 3MHSC 4P30A 4O4IA 1YITV 3HR0A 1JFFB 4F4LA 1PV0A 4P2ZA 1MZFA 2PF4E 3E8GA 4ZIBA 3G67A 1FJGO 3N2KA 2IM9A 4TUYB 2H8PC 4AQYO 4UCRA 5KX5B 2VQEB 3ASOC 1WB7A 1FYJA 2ZXWC 3BRCA 2RCVA 4B3SB 2R70A 1Y76B 4FLTA 3MAQA 5EBWC 3CPWU 1SQBH 4I50B 4DV0O 4ZOLA 2LJ2A 2V1DA 3SYPA 5L3CA 1IBLB 3J81N 1QLNA 3CJHB 5CA0A 2YDEA 3L74H 3E35A 1GKFA 1IXMA 3CMEV 4F6EA 5L3FA 1PKXA 5DECA 2RQ6A 4EB6B 1NTKH 1WPBA 2K1EA 4YJ3A 1GRJA 5B1NA 3CXCU 1YDXA 4P9PA 2QSAA 1DF4A 2F66C 1FD9A 3B4SA 3RBZA 5E1AC 1V55B 4FK5C 3WG7C 3TGUH 1FXVA 3AG2C 1SQPH 3RYCA 4MTGA 2HJFC 2NR5A 4PA3A 3OR6C 3RGBA 3IFXA 1VQ9V 2UXDO 1WP8A 4JTAB 1V54B 3JARB 4IHJB 1L0LH 1PNKA 4CH5A 3UKMA 1BL8A 2NLJC 2PZSA 2OIGA 1S76D 4JPRA 4LNUA 3MD0A 4JAVA 3WB1A 2LFRA 2JGDA 2OCHA 2W6IG 2EZPA 2PUSA 1K4CC 1AB3A 3JAWB 3FAVB 5LXTB 3CCMV 4G27B 2Z3YA 5J2TA 1FXKB 3VQYA 1R6KA 3K79A 3JSLA 2A9HA 1H5WA 5B1BB 1MMMA 4KUMA 3ZHVA 2VRZA 1WPXA 2WSSG 1IBKB 1N33B 4FFBA 1IXBA 3FD9A 1M56B 4UUJC 1Y66A 3CRCA 4QE9A 2ADPA 4MVQA 1CXZB 1Q86W 4DR7B 1YXBA 3F5WC 4K8XA 2ZQMA 1E1RG 4PA7A 2BE3A 1UJWB 1AP6A 2QJ1A 1VQ8V 5IJ9A 2ZM6O 3JASB 2E75B 1EM1A 4LP8A 4R8CA 2Q9LA 3RT3C 5KA5A 4IT5A 2NNUA 1K5SA 1NQTA 1QVFU 4H33A 4JI4B 3W7XA 3T1HB 3N2GA 2OTLV 3LUTB 2N04A 2IJKA 4DR4O 1QR8A 2C2AA 1GTOA 2Q6AA 1WAZA 2QKCA 5IYZA 2XHBA 2IJJA 4A5UB 2EINB 1B06A 1SQFA 3E2EA 5FPOA 4OXSA 3HKDB 2LW7A 5GONA 3CHXA 4JI8O 4TQDA 1VQOV 3RVZA 1I08A 4UVBA 4MVMA 3DSQA 3B8NA 3E8HA 4X1YB 2HVJC 2F43G 2QE7G 5LYJA 2UUBO 4JI7O 4TV8A 2XNDG 1O9HA 2CGOA 5LOVB 1XMOB 1F4NA 5JVDB 2XAFA 1K8AW 2JS3A 3NR7A 1BE3H 1DF5A 2CTQA 3L72H 1R3KC 1TUEB 1Y74B 2Q69A 3O9OA 1M90W 2HHHB 1VQPV 4UB8Z 1ZUQA 1F7YA 4PDRA 4UCVA 1JJOA 4FZ0A 2BOBC 4LFBB 4IIJB 3C3SA 3QO5A 3SDLA 1G8MA 3GB7C 1VARA 1Q6UA 3C90A 1E79G 3W7SA 2BOCC 3JD4A 1J5EO 3WU2Z 4I0XA 4UV8A 2LFSA 2WLHA 3ETDA 1Q3EA 4BIUA 2G38A 4OGQB 3CC7V 2BTQA 4LF5O 1M57C 2EULA 4FVMA 5IY5C 3ABKC 1Q8IA 1M4UA 1WNSA 3BPZA 5LA6B 3S3WA 3ZHUA 4JI0B 1BHBA 2HFEC 1GN6A 4JYBA 4JTDB 4NXNO 1OCZC 3AG3B 4WFEA 4PA4A 1NVPD 5ITZB 1LNQA 3CCEV 4JI3B 4J42A 3K04A 3ABMC 2YEVB 2ZIMA 3DXRB 1WLEA 1N36O 4GLXA 1GM8A 4UXNA 1VQ5V 3T2MA 2ARHA 4WBNB 5KHJA 1ZL8A 1JMKC 2JVDA 3JARA 3KKYA 3SJCC 4JZGA 4QPJA 1XNQB 2DWDC 3K06A 3BCCH 4LF9B 2EILC 1SZTA 3WB2A 3LNMB 3ZEDA 3ZMSA 3SYQA 1F4MA 4TV9B 3JAWA 1GN2A 4GT1A 4HAMA 5LXTA 1MA1A 2CGNA 2DE0X 1EN5A 3ZRVA 4O4HB 4X1IA 5KUKA 5LP6C 4LF8B 2EZOA 3FFQA 1JNBA 1K73W 2YI9A 4DV5B 4J10A 4L87A 4XDLA 2VWJA 3CCUV 2QKAA 1LUWA 4JAUA 5CN0A 3D36A 5H2FZ 2MK3A 3E8FA 4F6RA 4R50A 1Q6IA 4YHHO 4WFGA 4J9ZB 1PPJH 2DYSC 4FMTA 5B1AC 1K33A 1SA0B 3K3WA 4LC1A 3UT5A 1NR7A 2FTKA 2DW4A 3OMIB 1W2BU 4GX0A 2EJRA 4MTFA 3CRAA 3OMNB 2F93B 5KHHA 5BR8B 2P7TC 3P3PA 3RYIA 4XBFA 3JALA 5C8YB 4MTXA 3FB5C 3HPLC 1O9GA 2Y69C 1W0JG 1E1QG 1KB9F 4I55B 4EEQA 2CAZC 2YXLA 3OUFA 2KKWA 2JGUA 3FKSG 4UVCA 4HNAA 4O4JA 3K5NA 3ZHRA 2ZR3A 1RM1C 3STZC 4H13B 1IZ3A 5KHKA 2JK5C 2R9AA 3M8AA 5CBGA 1HNWB 1R3LC 2QWRB 2E3CA 4DUYB 3JATB 5FL7G 4B3MO 4MSWC 4JYAO 1JCHA 3ASOB 1DGSA 3K9AA 2WPDG 2ZXWB 1VQNV 3L73H 1XEQA 4K0KO 1F23A 5IWAO 2AHZA 4NTYA 1VQ7V 1V9PA 2Z0AA 1Q81W 2Q8VA 4MVOA 1YTFB 4GKKO 1N32O 3I5DA 3E83A 1RSOB 3L70H 2IU3A 1N34B 4NB5A 5FNVA 5DM6V 4LFCB 4RUFA 1M5IA 2KQXA 2ZDIA 3DGEA 2IJHA 2DOSA 4O2AB 1FFXA 3DC6A 1EZJA 1IBMO 5JQGB 3OFNG 4YJ2B 3WG7B 4B3TB 4IIJA 4UCOA 3IJ4A 1YJWV 5JJJB 2RNBA 3AG2B 4LR3A 1I0HA 4K0KB 1HW7A 3CC4V 4X64B 1AI6A 1XMQB 2FL4A 3GWKC 1CEZA 1L0NH 4GKKB 3AK2A 3Q4HA 5IJ0B 4I7ZB 4X65O 3FYIB 4X1KB 3CRMA 4ZI7B 4CS2A 1TAEA 1SRYA 4TSFG 3J7AU 4CS3A 5EBMC 4OPAA 4OPHA 5A9GA 1KQSU 2CDYA 3LSQA 2HKOA 3SYCA 1SC5B 2CH7A 3SJBC 3LDCA 1BSMA 1M1KW 2DWEC 5ITZA 1KKDA 2WLLA 5LHIA 2WA4A 4MW3A 2Y48A 2YEVA 4YXWG 1AJNA 1OZ0A 2RMKB 3JD2A 1W0KG 4DR2B 1MZEA 3H1LH 1HNXO 3B2EE 2LP7A 2WWWA 4WBNA 4OX9O 4X65B 2W6JG 2Y0IA 1P49A 2UUAO 2PI4A 3O65A 5CA3A 4DR1B 1BMFG 3RWRD 3P32A 4ZHQB 2QWPB 3LSSA 5B5EZ 1EFRG 2M7WA 3ABLC 4FM2A 1AVMA 2RDCA 4R7CA 1H2MA 1H2LA 1KMIZ 2A06H 3AG1C 1GH6A 5CMUA 2VQEO 1PM9A 3OAAG 3X2QC 4CC5A 4FLVA 2XAGA 3A0RA 4B3SO 2XOKG 5CB4B 1GO3F 2DJVA 2VQFB 4KXRA 1EZVH 4DRXB 1IBLO 3ASNC 3BHPA 3GVMA 2Y4UA 4H44B 2OTJV 1I5XA 1AJQA 1EBOA 3JAKB 3ETQA 1JJ2U 3OEEG 4GX2A 4TOIA 1VF7A 2UUAB 1JQ0A 1QNMA 3CB2A 1U97A 4UV9A 1SA0A 1MNGA 2IW5A 2AGAA 2F4VB 3ICXA 1FKAO 3H1HH 4LF6B 1Q90D 2MW2B 3K03A 2Y0PA 2KB1A 4GKJB 1OCOC 1PD3A 1ZTEA 3K0DA 5C8YA 1MABG 2YXHA 3CXHF 2ZE7A 1Z5VA 3STLC 4RO2A 1HP8A 1AI7A 2V7QG 2YICA 4X62B 4JI2B 2ZNIA 1EN6A 1NH2B 5A2QN 1US6A 3EXAA 1K4DC 5CBHA 1AR4A 2PYLA 3OM3B 5BMVB 4WFAV 2GUZB 3QTCA 4J80A 2QM8A 3VQWA 3K08A 2N05A 3ZMUA 2OCCC 4WF9V 4X20A 5BY1A 1ENVA 5KMGA 3QO8A 4JYYA 2YIDA 3RYHA 5DN6G 1KD1W 3BFRA 3HKBA 3UO3A 3L75H 4QPKA 1H2SB 4W4KA 1RSOA 1IBKO 1Q6HA 1WA8B 2AHYA 2Z5UA 1N33O 5JH7A 5LHHA 3IC7A 3W7WA 2KG7B 1M57B 1X59A 4ABMA 5IY5B 4DR7O 4DV3B 3ABKB 3DTUB 2PI5A 3ZS8C 2A79B 2XAJA 4NYKA 1VQLV 5J2UB 5JQGA 2RJZA 1OCZB 5B1OA 3QF7A 2FYUH 4K8ZA 4YJ2A 3ABMB 5LGUA 4JI4O 1YF2A 5CBFA 1JX9A 2H3OA 3T1HO 1XNRB 3OT7A 3W7UA 2DN9A 2BTOA 2GV9A 3JCUZ 4BIOA 3ZHTA 2IU0A 4O2BB 3TXQA 4ZI7A 2EILB 3CD6V 3CX5F 3ZN0A 2Q67A 1S3JA 2GSMB 2WLNA 1P7GA 1GM9A 1P84F 2ZT9B 1NU1H 3L71H 3J80N 3E22A 1VF6C 1YEWA 5LP6B 4NTXA 1K3EA 1VQKV 4ZBMA 2GBOA 3IGAC 4Q20A 2P4VA 3N27A 2Q7GA 3R66A 4JF3A 2XAQA 1TUBA 4LWSA 1HDJA 1BQ0A 3P30A 4D6TH 5LHGA 4RQEA 1XMOO 3RN4A 2ZCEA 3CRRA 2WLJA 2DYSB 5B1AB 2HHHO 4U3JB 4Z1MG 2P22C 1H2GA 4K35A 1UPGA 2L35A 1SQQH 4LFBO 3G6EV 5E79Z 1R73A 5DEDA 3DC5A 2Y69B 4EFBA 3OGIB 1G1XB 3OD4A 4QNHB 3SPGA 1HNZB 2EIJC 4AILC 1THZA 4ZKIA 3OMAB 4QIWF 1MSWD 1FPOA 3A8TA 4CZZA 4XDKA 4U7NA 5B3SC 2KSDA 1RM1B 3TCUA 5JCOA 1B3QA 2LQTA 3H01A 4PI2A 2UXCB 4CH3A 4I4TB 2UUCB 4C7UA 4MT8A 1PL0A 2UXNA 1WJZA 1JFFA 1Z2GA 4JI0O 3ZHQA 1QU7A 1OHHG 4DR3B 1Y4MA 3WB0A 3ZX6A 4TUYA 1H8EG 1JPXA 5EYPB 5KX5A 4JI3O 3CC2V 2JDIG 3TJTA 1R1BA 1Y76A 3H1KH 4LFAB
chains in the Genus database with same CATH topology
1GN6A 3LSUA 1XREA 1BSMA 1EN6A 2QKCA 1D5NA 4E4EA 1AR5A 1AR4A 4FFKA 1B06A 1MSDA 1IX9A 1BT8A 1GN4A 1Y67A 1I08A 2CE4A 3KKYA 4JZGA 3RN4A 4JYYA 4JZ2A 3BFRA 4YIPA 1GN3A 1AVMA 1AP5A 3CEIA 1GN2A 2ADQB 1ZSPA 3QVNA 4YIOA 1IDSA 1MA1A 4GUNA 1PM9A 3DC5A 1EN5A 2GDSA 1XILA 1ZUQA 3DC6A 1MMMA 3C3TA 1JR9A 3IC9A 2QKAA 4BR6A 3K9SA 1LUWA 1IXBA 1XDCA 1XUQA 3C3SA 2ADPA 1WB7A 3KDRA 1VARA 1ZLZA 4X9QA 2RCVA 1I0HA 1N0NA 1EN4A 1QNMA 3MDSA 1AP6A 1PL4A 1MNGA 1N0JA 3OT7A 4C7UA 3AK3A 1VEWA 1EM1A 3AK2A 1JA8A 3EVKA 1WB8A 2P4KA 4F6EA 1ZTEA 5AG2A 3AK1A 1SZXA 3TJTA 5A9GA 1LUVA 1BS3A 1KKCA 2AW9A 2CDYA 1P7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN6 A;  3LSU A;  1XRE A;  1BSM A;  1EN6 A;  2QKC A;  1D5N A;  4E4E A;  1AR5 A;  1AR4 A;  4FFK A;  1B06 A;  1MSD A;  1IX9 A;  1BT8 A;  1GN4 A;  1Y67 A;  1I08 A;  2CE4 A;  3KKY A;  4JZG A;  3RN4 A;  4JYY A;  4JZ2 A;  3BFR A;  4YIP A;  1GN3 A;  1AVM A;  1AP5 A;  3CEI A;  1GN2 A;  2ADQ B;  1ZSP A;  3QVN A;  4YIO A;  1IDS A;  1MA1 A;  4GUN A;  1PM9 A;  3DC5 A;  1EN5 A;  2GDS A;  1XIL A;  1ZUQ A;  3DC6 A;  1MMM A;  3C3T A;  1JR9 A;  3IC9 A;  2QKA A;  4BR6 A;  3K9S A;  1LUW A;  1IXB A;  1XDC A;  1XUQ A;  3C3S A;  2ADP A;  1WB7 A;  1VAR A;  1ZLZ A;  4X9Q A;  2RCV A;  1I0H A;  1N0N A;  1EN4 A;  1QNM A;  3MDS A;  1AP6 A;  1PL4 A;  1MNG A;  1N0J A;  3OT7 A;  4C7U A;  3AK3 A;  1VEW A;  1EM1 A;  3AK2 A;  1JA8 A;  3EVK A;  1WB8 A;  2P4K A;  4F6E A;  1ZTE A;  5AG2 A;  3AK1 A;  1SZX A;  3TJT A;  5A9G A;  1LUV A;  1BS3 A;  1KKC A;  2AW9 A;  2CDY A;  1P7G A; 
#chains in the Genus database with same CATH topology
 2WLI B;  1BHA A;  4I50 A;  4G28 B;  3F7Y C;  3JSN A;  4KP4 A;  4D7T A;  4GYC B;  4E4E A;  3CJH A;  2QTS A;  4AHC A;  3ETE A;  1ORQ C;  3SYO A;  1XNQ O;  4DW1 A;  1MSD A;  4NR1 A;  5KA6 A;  2AXT Z;  4EB6 A;  4LF9 O;  2UU9 O;  4DUZ B;  1Q82 W;  1BCC H;  2ETN A;  3QNE A;  2ZNJ A;  1GAX A;  2JEU A;  1Q5O A;  2B1I A;  4BAY A;  2QA4 V;  4NKG B;  4QGP A;  4BIZ A;  4I9Q A;  4UCT A;  1K7D A;  2UXB B;  1WN7 A;  2HR3 A;  4MVR A;  3OTO B;  4LF8 O;  4LH7 A;  2IBZ H;  1HR0 B;  4DV5 O;  2R9R B;  2Y4T A;  2OWO A;  5J9P C;  1ARO P;  4DW0 A;  1ZSP A;  2KG7 A;  1XQ8 A;  3G80 A;  2ZR2 A;  5BXZ A;  4IHJ A;  1ROP A;  4GX1 A;  4FLZ A;  1JR9 A;  4J7K A;  4JTC B;  3QO7 A;  1DK1 A;  1YZB A;  2JIZ G;  4HYO A;  4DV7 B;  5FLX N;  2Q0A A;  4N23 A;  3SPJ A;  2UU9 B;  3VBB A;  5BR8 O;  1GK9 A;  2LGQ A;  1IJG A;  3FAV A;  1YJ9 V;  4CBC A;  5EZY B;  1FXK A;  4DO2 A;  1B04 A;  1I7F A;  3D36 C;  1M56 C;  1UFI A;  4GCZ A;  4D7S A;  1NS1 A;  5CA1 B;  3BA9 A;  4DV1 B;  2GHY A;  3D8C A;  3H1J H;  4JV5 B;  5GTI Z;  4FLY A;  3A0H Z;  4BW5 A;  4JI1 B;  3ABL B;  2CTW A;  1BGY H;  1HNW O;  4DUY O;  3JAM N;  3OTF A;  3AG1 B;  1NTM H;  4PI0 A;  3X2Q B;  3OE7 G;  1XHX A;  2FKX A;  4DV4 B;  2CUG A;  3JAS A;  2E5L B;  3B40 A;  3D3Q A;  2HG5 C;  3R65 A;  3RYF B;  3ZJZ A;  5LP6 A;  3APO A;  2E74 B;  4RWU A;  3G71 V;  4KHP B;  3ASN B;  2YI8 A;  1GN4 A;  5BZB A;  1NR1 A;  4O4I B;  2F23 A;  4Z1V A;  1N34 O;  3E89 A;  1TGO A;  1ZX3 A;  3N2K B;  3TK1 A;  4LFC O;  1H2K A;  4JAS A;  5GTH Z;  2AZ2 A;  3K5O A;  2YC0 A;  4TT3 G;  1YCI A;  3S3X A;  3U10 A;  1GMG A;  1XL6 A;  2ZIN A;  4HZ3 A;  1M93 A;  3CEI A;  1OCO B;  3HKD A;  4I5S A;  3JD1 A;  3QVN A;  4B3T O;  3K59 A;  4LF4 B;  4IYH A;  4ZOL B;  2NN4 A;  5H5N A;  1QVG U;  1SET A;  4X1Y A;  5CA0 B;  1Z5W A;  1L8D A;  4X64 O;  4NXM B;  2Q68 A;  1XMQ O;  4WFF A;  1RP3 B;  4DR6 B;  3RFR A;  2ZE6 A;  4B7E A;  3SPI A;  2YXY A;  2ZDI C;  4YJ3 B;  4X9Q A;  3THO A;  5LOV A;  2ZE5 A;  1H2N A;  1S5H C;  5JVD A;  4R6Z A;  4TQF A;  3E8B A;  1Y74 A;  1N0J A;  2EBO A;  2Q4P A;  2IJI A;  4J7Z A;  2BSK B;  4MVZ A;  2OCC B;  2CTP A;  3KZI Z;  3B8M A;  2OIE A;  1SZX A;  1D5A A;  5EYP A;  3ZHS A;  2AW9 A;  4FJC C;  2D3O W;  1M9N A;  4GZR B;  2PYJ A;  2X6A A;  3T1Y B;  4DR2 O;  2F95 B;  4LNU B;  1AR5 A;  4J41 A;  1PNM A;  2JGD B;  2PTM A;  3M99 B;  2EIK C;  4DR1 O;  2ITC C;  4DR5 B;  4G2K A;  4NTW A;  4LF7 B;  1P7B A;  3FB8 C;  3JD0 A;  5J2T B;  2XAH A;  4WFH A;  5LA6 A;  2YIA A;  4KL1 A;  1SES A;  1VP7 A;  1FXH A;  4JI5 B;  1R3I C;  4FFB B;  4O4L B;  1IVS A;  3K58 A;  4RAI A;  3AG4 C;  3OW2 U;  5EC1 C;  2VQF O;  3DXR A;  4B3R B;  3E86 A;  3ZMZ A;  4YIO A;  1IDS A;  1S0V A;  5IJ9 B;  3W7T A;  3PN1 A;  1U96 A;  5EIB D;  4FM0 A;  2FML A;  3C3T A;  3CYO A;  2XUM A;  3RW0 A;  1X4T A;  2F4V O;  5LMU B;  3ZRS A;  4LF6 O;  4GKJ O;  1N0N A;  3N2G B;  4TV9 A;  2W0X A;  1NI8 A;  3WFV A;  4MVU A;  1OJH A;  4DV6 B;  3AK3 A;  1OCR C;  4O4H A;  1H8H G;  5JJE B;  2W0F C;  3ZBH A;  5IYZ B;  3BEH A;  3K5L A;  2ODM A;  5CA1 A;  4X62 O;  2CK3 G;  4JI2 O;  4DK1 A;  5GON B;  2XTA A;  1XL4 A;  4J7J A;  1ZWI C;  4UFZ A;  4NVP A;  1K97 A;  4LCU C;  3FB7 C;  1VQM V;  1SQG A;  4DXW A;  3CCS V;  4UCU A;  2YIB D;  5LYJ B;  4JI6 B;  4UVA A;  4TV8 B;  5IDJ A;  4PDV A;  4FFK A;  4PHZ A;  1R6N A;  2EIJ B;  4J9Y B;  1I94 B;  4CH6 A;  2EIM C;  1BT8 A;  2YIB A;  3P3N A;  4I55 A;  4EFE A;  1KBH A;  5B3S B;  5KUM A;  1VIB A;  2X7R B;  4W4L A;  5H6Q A;  3H9V A;  4H0L B;  1RFY A;  3G6B A;  4DV3 O;  1OCC C;  1L1F A;  3HB3 B;  4FIP C;  4FM1 A;  4CS4 A;  3JAT A;  1YTF D;  3BVO A;  1KUQ A;  5IE9 A;  4I0X B;  3KCX A;  4FLW A;  2QM7 A;  1YHQ V;  3CSX A;  3CS5 A;  2BTQ B;  2WLK A;  4DYL A;  3IC9 A;  4JAA A;  1XI1 A;  1GM7 A;  4DV2 B;  3K9S A;  4DK0 A;  1XNR O;  4YY3 B;  5LBQ A;  2QWN B;  1BZK A;  1PNL A;  2P6J A;  4AI8 A;  5KHI A;  5HFM A;  4HBN A;  5IT9 N;  3L9D A;  5EC2 C;  3APQ A;  1NTZ H;  1URF A;  1FJG B;  4JYC A;  5K1X A;  2B1G A;  4AQY B;  1G4Y B;  2BSK A;  4O2A A;  3EVK A;  3CCL V;  1WB8 A;  3ZMV A;  2P5O A;  4KFM A;  3EHB B;  4B08 A;  4PD4 F;  2A3Q A;  2WA3 A;  2IH3 C;  2XT9 A;  4DV0 B;  5B66 Z;  1F51 A;  1NVP B;  1BS3 A;  1ZL8 B;  3G4S V;  4XDJ A;  4FLX A;  4PJ0 Z;  2DYR C;  3T1C A;  3ZRW B;  1YIJ V;  2JEX A;  1QLE C;  3OR7 C;  1BQZ A;  1A32 A;  4MS2 A;  5IJ0 A;  2X6C A;  1S5L Z;  1K5Q A;  4X1K A;  2VS0 A;  1N8R W;  4X66 O;  1SS3 A;  1YSC A;  2DQ3 A;  4PDL A;  1COW G;  3K0G A;  1Y67 A;  5LL6 Y;  3VOU A;  4X1I B;  4Q6G A;  2YS8 A;  5KAI Z;  4IL6 Z;  3MHH C;  4O4L A;  4YIP A;  2LO1 A;  1HNZ O;  2UXD B;  3F5T A;  1Q7Y W;  4F6R B;  3TET A;  1S77 D;  4MTO A;  2L6L A;  2A0L A;  2H94 A;  5D5Q A;  3FB6 C;  3UT5 B;  1CP9 A;  3CRQ A;  3FX7 A;  3A0B Z;  2UXC O;  1XOU A;  4QE7 A;  3RYI B;  4X66 B;  4ZHQ A;  3JAL B;  2UUC O;  5HFL A;  5L3G A;  3CCR V;  1KP3 A;  1VF6 A;  4DR3 O;  5L3E A;  1QQC A;  1LR1 A;  1IUR A;  5TIS Z;  4HNA B;  3SPH A;  4O4J B;  1MOF A;  1FAF A;  5CB4 A;  5LGT A;  4LFA O;  5JCO C;  2P4K A;  1ZAU A;  4DRX A;  5AG2 A;  3AK1 A;  1JVM A;  3K57 A;  2ZM6 B;  1TA8 A;  4PDM A;  3RVY A;  3CCV V;  1VMG A;  3JAK A;  1AR1 B;  4JGS A;  3CCQ V;  1XBL A;  1VQ4 V;  3LSU A;  4LH6 A;  3CP1 A;  3LDE A;  4RUE A;  1AI5 A;  4DUZ O;  4H37 A;  4X89 A;  2Q7E A;  3NXS A;  4FLU A;  1I5Y A;  2B5U A;  1SQX H;  3U11 A;  3K5M A;  4DR4 B;  1NH2 D;  5KAF Z;  2UXB O;  2B9Z A;  5FNV B;  1R3J C;  1AI4 A;  3OTO O;  2GTS A;  4GX5 A;  1TVK B;  2AZ0 A;  1HR0 O;  5K1P A;  2A7W A;  1QBZ A;  1FFX B;  1FOU A;  5FPR A;  1N4C A;  2OT5 A;  4IYI A;  2P90 A;  3OGC C;  2X0L A;  5BMV A;  2OYQ A;  4JI8 B;  2GUZ A;  4U7O A;  3SGI A;  1AP5 A;  3UCS C;  4BWA A;  3BA8 A;  3KG2 A;  2QEX V;  4DV7 O;  4ICG A;  1V55 C;  3UM7 A;  1FFT B;  1P4R A;  2UUB B;  4JI7 B;  4EKW A;  3Q4H B;  4B7K A;  5JWP A;  2M6Y A;  3LNN A;  2QR4 A;  3SJQ C;  3SPC A;  3HKE B;  3GWO A;  4CH4 A;  1V54 C;  1ZLZ A;  2Q73 A;  3OEH G;  2F1M A;  2HJD A;  4DV1 O;  1WA8 A;  2EIK B;  4PA9 A;  4JV5 O;  3ETG A;  2Q7H A;  3MDS A;  2CH7 B;  3HKC B;  4WCE V;  1S72 V;  4JI1 O;  4L8J A;  2PY5 A;  2WLL B;  2PGG A;  3ABT A;  5J2U A;  2HLD G;  3B77 A;  4ASU G;  4DV4 O;  1FXK C;  2E5L O;  2JS5 A;  1J5E B;  4PA6 A;  3CMA V;  4IGG A;  4UB6 Z;  3AG4 B;  5B1B C;  4PEL A;  2ZIO A;  4KHP O;  2N74 A;  4LF5 B;  1FS0 G;  3ZRW A;  1NKD A;  1D5N A;  2HP8 A;  5KLV H;  3CWB H;  3ZN1 A;  4U3F H;  1YVW A;  4CC6 A;  4O2B A;  4NXN B;  2HEP A;  5IYB O;  4UCS A;  1RPR A;  1XHZ A;  4LF4 O;  1N36 B;  2HVK C;  1OCR B;  2CTR A;  1GN3 A;  4NXM O;  1NBM G;  2ADQ B;  4DR6 O;  2EX3 A;  3IAY A;  1AJP A;  3KCY A;  1KYO F;  1KU9 A;  2Q5Z A;  3ZCC A;  1JOY A;  2EIN C;  4Z2W A;  3T4Z A;  2QWO B;  4BR6 A;  2ZKO A;  1G6U A;  1WP7 A;  2YUA A;  1KP2 A;  2D2C B;  2JRI A;  4U3J A;  3T4D A;  1XUQ A;  3CE2 A;  2QTO A;  3ABU A;  1AIL A;  1NT2 B;  4X8A A;  1Q43 A;  2JJ1 G;  3LDD A;  5LMN O;  3ZMT A;  1YJN V;  1PL4 A;  2EIM B;  2GTA A;  5D5P A;  4MW8 A;  1VEW A;  3OUS A;  2P67 A;  4MVS A;  4BW9 A;  1DTO A;  3T1Y O;  1RPO A;  1YI2 V;  3SJA C;  3M7M X;  4YHH B;  1T5E A;  5F2V O;  3I56 V;  1OCC B;  1HWY A;  2XAS A;  1KKC A;  4X20 B;  4DR5 O;  4LF7 O;  3UQ8 A;  1DLB A;  1S5J A;  5KMG B;  4WFB V;  4I4T A;  2WAM A;  3RYH B;  3SR2 C;  5L3B A;  3HKB B;  3RYC B;  3JCZ A;  2DQ0 A;  5KHG A;  2LGW A;  3D3I A;  4JI5 O;  1D2D A;  5JH7 B;  5LMN B;  2Q0O C;  1IX9 A;  2ITD C;  3CCJ V;  1TVK A;  4E2L A;  2K9P A;  5EBL C;  1NZ6 A;  5EK0 A;  2IH1 C;  2WLI A;  4B3R O;  2QGN A;  2ILM A;  2WLM A;  2BCC H;  1SQV H;  1W59 A;  5GW7 A;  4B3M B;  4JYA B;  4RQF A;  3AG7 A;  3FYE B;  3TXS A;  2R72 A;  2ATK C;  3AEI A;  3BAB A;  3F7V C;  3JYC A;  5JJN B;  4LBE C;  2VWK A;  5IWA B;  1VF5 B;  4GUN A;  3AG3 C;  5LGN A;  5LMU O;  4N21 A;  2GDS A;  1XIL A;  1N32 B;  2DYR B;  4J11 A;  5IYC O;  1QLE B;  4FZ1 A;  4DV6 O;  1OV9 A;  3PJS K;  3HKE A;  1KEC A;  1XDC A;  2JJ2 G;  3H1I H;  3KDR A;  3EFF K;  5IYD O;  2EJ7 A;  2QM4 A;  2YSU B;  1EN4 A;  3VQX A;  1IBM B;  3ZRX A;  2QDO A;  3HKC A;  4QJF B;  3I55 V;  3E22 B;  1MG1 A;  1K92 A;  1JA8 A;  3ML0 A;  5H9C A;  4K3A A;  5C93 A;  3A2F A;  4TWK A;  5EIB C;  1R6T A;  1B6Q A;  1PP9 H;  4JI6 O;  2LW1 A;  1SER A;  2ZE8 A;  4I9W A;  1LUV A;  3BY6 A;  1TUB B;  4LWS B;  2ZD9 A;  1I94 O;  2X6B A;  1Y6X A;  5EZY A;  1QHT A;  3B09 A;  1CPY A;  1XRE A;  3BAA A;  1QR9 A;  2O57 A;  2V4D A;  3UO2 A;  1NJI W;  4PV1 B;  5L3D A;  3U0Z A;  2P06 A;  1J95 A;  3ZIA G;  1SF9 A;  1K34 A;  1QCE A;  2R9I A;  2CE4 A;  2DMX A;  1H38 A;  2RN9 A;  1K9M W;  3SYA A;  1SKV A;  5H6R A;  4JZ2 A;  3JD3 A;  2FB5 A;  3QG5 A;  1HNX B;  3RYF A;  4OX9 B;  3VQV A;  2QWQ B;  4P9O A;  1KC8 W;  4DV2 O;  2UXX A;  4FPP A;  4YY3 O;  2QKS A;  4X88 A;  1VQ6 V;  2E76 B;  3MHS C;  4P30 A;  4O4I A;  1YIT V;  3HR0 A;  1JFF B;  4F4L A;  1PV0 A;  4P2Z A;  1MZF A;  2PF4 E;  3E8G A;  4ZIB A;  3G67 A;  1FJG O;  3N2K A;  2IM9 A;  4TUY B;  2H8P C;  4AQY O;  4UCR A;  5KX5 B;  2VQE B;  3ASO C;  1WB7 A;  1FYJ A;  2ZXW C;  3BRC A;  2RCV A;  4B3S B;  2R70 A;  1Y76 B;  4FLT A;  3MAQ A;  5EBW C;  3CPW U;  1SQB H;  4I50 B;  4DV0 O;  4ZOL A;  2LJ2 A;  2V1D A;  3SYP A;  5L3C A;  1IBL B;  3J81 N;  1QLN A;  3CJH B;  5CA0 A;  2YDE A;  3L74 H;  3E35 A;  1GKF A;  1IXM A;  3CME V;  4F6E A;  5L3F A;  1PKX A;  5DEC A;  2RQ6 A;  4EB6 B;  1NTK H;  1WPB A;  2K1E A;  4YJ3 A;  1GRJ A;  5B1N A;  3CXC U;  1YDX A;  4P9P A;  2QSA A;  1DF4 A;  2F66 C;  1FD9 A;  3B4S A;  3RBZ A;  5E1A C;  1V55 B;  4FK5 C;  3WG7 C;  3TGU H;  1FXV A;  3AG2 C;  1SQP H;  3RYC A;  4MTG A;  2HJF C;  2NR5 A;  4PA3 A;  3OR6 C;  3RGB A;  3IFX A;  1VQ9 V;  2UXD O;  1WP8 A;  4JTA B;  1V54 B;  3JAR B;  4IHJ B;  1L0L H;  1PNK A;  4CH5 A;  3UKM A;  1BL8 A;  2NLJ C;  2PZS A;  2OIG A;  1S76 D;  4JPR A;  4LNU A;  3MD0 A;  4JAV A;  3WB1 A;  2LFR A;  2JGD A;  2OCH A;  2W6I G;  2EZP A;  2PUS A;  1K4C C;  1AB3 A;  3JAW B;  3FAV B;  5LXT B;  3CCM V;  4G27 B;  2Z3Y A;  5J2T A;  1FXK B;  3VQY A;  1R6K A;  3K79 A;  3JSL A;  2A9H A;  1H5W A;  5B1B B;  1MMM A;  4KUM A;  3ZHV A;  2VRZ A;  1WPX A;  2WSS G;  1IBK B;  1N33 B;  4FFB A;  1IXB A;  3FD9 A;  1M56 B;  4UUJ C;  1Y66 A;  3CRC A;  4QE9 A;  2ADP A;  4MVQ A;  1CXZ B;  1Q86 W;  4DR7 B;  1YXB A;  3F5W C;  4K8X A;  2ZQM A;  1E1R G;  4PA7 A;  2BE3 A;  1UJW B;  1AP6 A;  2QJ1 A;  1VQ8 V;  5IJ9 A;  2ZM6 O;  3JAS B;  2E75 B;  1EM1 A;  4LP8 A;  4R8C A;  2Q9L A;  3RT3 C;  5KA5 A;  4IT5 A;  2NNU A;  1K5S A;  1NQT A;  1QVF U;  4H33 A;  4JI4 B;  3W7X A;  3T1H B;  3N2G A;  2OTL V;  3LUT B;  2N04 A;  2IJK A;  4DR4 O;  1QR8 A;  2C2A A;  1GTO A;  2Q6A A;  1WAZ A;  2QKC A;  5IYZ A;  2XHB A;  2IJJ A;  4A5U B;  2EIN B;  1B06 A;  1SQF A;  3E2E A;  5FPO A;  4OXS A;  3HKD B;  2LW7 A;  5GON A;  3CHX A;  4JI8 O;  4TQD A;  1VQO V;  3RVZ A;  1I08 A;  4UVB A;  4MVM A;  3DSQ A;  3B8N A;  3E8H A;  4X1Y B;  2HVJ C;  2F43 G;  2QE7 G;  5LYJ A;  2UUB O;  4JI7 O;  4TV8 A;  2XND G;  1O9H A;  2CGO A;  5LOV B;  1XMO B;  1F4N A;  5JVD B;  2XAF A;  1K8A W;  2JS3 A;  3NR7 A;  1BE3 H;  1DF5 A;  2CTQ A;  3L72 H;  1R3K C;  1TUE B;  1Y74 B;  2Q69 A;  3O9O A;  1M90 W;  2HHH B;  1VQP V;  4UB8 Z;  1ZUQ A;  1F7Y A;  4PDR A;  4UCV A;  1JJO A;  4FZ0 A;  2BOB C;  4LFB B;  4IIJ B;  3C3S A;  3QO5 A;  3SDL A;  1G8M A;  3GB7 C;  1VAR A;  1Q6U A;  3C90 A;  1E79 G;  3W7S A;  2BOC C;  3JD4 A;  1J5E O;  3WU2 Z;  4I0X A;  4UV8 A;  2LFS A;  2WLH A;  3ETD A;  1Q3E A;  4BIU A;  2G38 A;  4OGQ B;  3CC7 V;  2BTQ A;  4LF5 O;  1M57 C;  2EUL A;  4FVM A;  5IY5 C;  3ABK C;  1Q8I A;  1M4U A;  1WNS A;  3BPZ A;  5LA6 B;  3S3W A;  3ZHU A;  4JI0 B;  1BHB A;  2HFE C;  1GN6 A;  4JYB A;  4JTD B;  4NXN O;  1OCZ C;  3AG3 B;  4WFE A;  4PA4 A;  1NVP D;  5ITZ B;  1LNQ A;  3CCE V;  4JI3 B;  4J42 A;  3K04 A;  3ABM C;  2YEV B;  2ZIM A;  3DXR B;  1WLE A;  1N36 O;  4GLX A;  1GM8 A;  4UXN A;  1VQ5 V;  3T2M A;  2ARH A;  4WBN B;  5KHJ A;  1ZL8 A;  1JMK C;  2JVD A;  3JAR A;  3KKY A;  3SJC C;  4JZG A;  4QPJ A;  1XNQ B;  2DWD C;  3K06 A;  3BCC H;  4LF9 B;  2EIL C;  1SZT A;  3WB2 A;  3LNM B;  3ZED A;  3ZMS A;  3SYQ A;  1F4M A;  4TV9 B;  3JAW A;  1GN2 A;  4GT1 A;  4HAM A;  5LXT A;  1MA1 A;  2CGN A;  2DE0 X;  1EN5 A;  3ZRV A;  4O4H B;  4X1I A;  5KUK A;  5LP6 C;  4LF8 B;  2EZO A;  3FFQ A;  1JNB A;  1K73 W;  2YI9 A;  4DV5 B;  4J10 A;  4L87 A;  4XDL A;  2VWJ A;  3CCU V;  2QKA A;  1LUW A;  4JAU A;  5CN0 A;  3D36 A;  5H2F Z;  2MK3 A;  3E8F A;  4F6R A;  4R50 A;  1Q6I A;  4YHH O;  4WFG A;  4J9Z B;  1PPJ H;  2DYS C;  4FMT A;  5B1A C;  1K33 A;  1SA0 B;  3K3W A;  4LC1 A;  3UT5 A;  1NR7 A;  2FTK A;  2DW4 A;  3OMI B;  1W2B U;  4GX0 A;  2EJR A;  4MTF A;  3CRA A;  3OMN B;  2F93 B;  5KHH A;  5BR8 B;  2P7T C;  3P3P A;  3RYI A;  4XBF A;  3JAL A;  5C8Y B;  4MTX A;  3FB5 C;  3HPL C;  1O9G A;  2Y69 C;  1W0J G;  1E1Q G;  1KB9 F;  4I55 B;  4EEQ A;  2CAZ C;  2YXL A;  3OUF A;  2KKW A;  2JGU A;  3FKS G;  4UVC A;  4HNA A;  4O4J A;  3K5N A;  3ZHR A;  2ZR3 A;  1RM1 C;  3STZ C;  4H13 B;  1IZ3 A;  5KHK A;  2JK5 C;  2R9A A;  3M8A A;  5CBG A;  1HNW B;  1R3L C;  2QWR B;  2E3C A;  4DUY B;  3JAT B;  5FL7 G;  4B3M O;  4MSW C;  4JYA O;  1JCH A;  3ASO B;  1DGS A;  3K9A A;  2WPD G;  2ZXW B;  1VQN V;  3L73 H;  1XEQ A;  4K0K O;  1F23 A;  5IWA O;  2AHZ A;  4NTY A;  1VQ7 V;  1V9P A;  2Z0A A;  1Q81 W;  2Q8V A;  4MVO A;  1YTF B;  4GKK O;  1N32 O;  3I5D A;  3E83 A;  1RSO B;  3L70 H;  2IU3 A;  1N34 B;  4NB5 A;  5FNV A;  5DM6 V;  4LFC B;  4RUF A;  1M5I A;  2KQX A;  2ZDI A;  3DGE A;  2IJH A;  2DOS A;  4O2A B;  1FFX A;  3DC6 A;  1EZJ A;  1IBM O;  5JQG B;  3OFN G;  4YJ2 B;  3WG7 B;  4B3T B;  4IIJ A;  4UCO A;  3IJ4 A;  1YJW V;  5JJJ B;  2RNB A;  3AG2 B;  4LR3 A;  1I0H A;  4K0K B;  1HW7 A;  3CC4 V;  4X64 B;  1AI6 A;  1XMQ B;  2FL4 A;  3GWK C;  1CEZ A;  1L0N H;  4GKK B;  3AK2 A;  3Q4H A;  5IJ0 B;  4I7Z B;  4X65 O;  3FYI B;  4X1K B;  3CRM A;  4ZI7 B;  4CS2 A;  1TAE A;  1SRY A;  4TSF G;  3J7A U;  4CS3 A;  5EBM C;  4OPA A;  4OPH A;  5A9G A;  1KQS U;  2CDY A;  3LSQ A;  2HKO A;  3SYC A;  1SC5 B;  2CH7 A;  3SJB C;  3LDC A;  1BSM A;  1M1K W;  2DWE C;  5ITZ A;  1KKD A;  2WLL A;  5LHI A;  2WA4 A;  4MW3 A;  2Y48 A;  2YEV A;  4YXW G;  1AJN A;  1OZ0 A;  2RMK B;  3JD2 A;  1W0K G;  4DR2 B;  1MZE A;  3H1L H;  1HNX O;  3B2E E;  2LP7 A;  2WWW A;  4WBN A;  4OX9 O;  4X65 B;  2W6J G;  2Y0I A;  1P49 A;  2UUA O;  2PI4 A;  3O65 A;  5CA3 A;  4DR1 B;  1BMF G;  3RWR D;  3P32 A;  4ZHQ B;  2QWP B;  3LSS A;  5B5E Z;  1EFR G;  2M7W A;  3ABL C;  4FM2 A;  1AVM A;  2RDC A;  4R7C A;  1H2M A;  1H2L A;  1KMI Z;  2A06 H;  3AG1 C;  1GH6 A;  5CMU A;  2VQE O;  1PM9 A;  3OAA G;  3X2Q C;  4CC5 A;  4FLV A;  2XAG A;  3A0R A;  4B3S O;  2XOK G;  5CB4 B;  1GO3 F;  2DJV A;  2VQF B;  4KXR A;  1EZV H;  4DRX B;  1IBL O;  3ASN C;  3BHP A;  3GVM A;  2Y4U A;  4H44 B;  2OTJ V;  1I5X A;  1AJQ A;  1EBO A;  3JAK B;  3ETQ A;  1JJ2 U;  3OEE G;  4GX2 A;  4TOI A;  1VF7 A;  2UUA B;  1JQ0 A;  1QNM A;  3CB2 A;  1U97 A;  4UV9 A;  1SA0 A;  1MNG A;  2IW5 A;  2AGA A;  2F4V B;  3ICX A;  1FKA O;  3H1H H;  4LF6 B;  1Q90 D;  2MW2 B;  3K03 A;  2Y0P A;  2KB1 A;  4GKJ B;  1OCO C;  1PD3 A;  1ZTE A;  3K0D A;  5C8Y A;  1MAB G;  2YXH A;  3CXH F;  2ZE7 A;  1Z5V A;  3STL C;  4RO2 A;  1HP8 A;  1AI7 A;  2V7Q G;  2YIC A;  4X62 B;  4JI2 B;  2ZNI A;  1EN6 A;  1NH2 B;  5A2Q N;  1US6 A;  3EXA A;  1K4D C;  5CBH A;  1AR4 A;  2PYL A;  3OM3 B;  5BMV B;  4WFA V;  2GUZ B;  3QTC A;  4J80 A;  2QM8 A;  3VQW A;  3K08 A;  2N05 A;  3ZMU A;  2OCC C;  4WF9 V;  4X20 A;  5BY1 A;  1ENV A;  5KMG A;  3QO8 A;  4JYY A;  2YID A;  3RYH A;  5DN6 G;  1KD1 W;  3BFR A;  3HKB A;  3UO3 A;  3L75 H;  4QPK A;  1H2S B;  4W4K A;  1RSO A;  1IBK O;  1Q6H A;  1WA8 B;  2AHY A;  2Z5U A;  1N33 O;  5JH7 A;  5LHH A;  3IC7 A;  3W7W A;  2KG7 B;  1M57 B;  1X59 A;  4ABM A;  5IY5 B;  4DR7 O;  4DV3 B;  3ABK B;  3DTU B;  2PI5 A;  3ZS8 C;  2A79 B;  2XAJ A;  4NYK A;  1VQL V;  5J2U B;  5JQG A;  2RJZ A;  1OCZ B;  5B1O A;  3QF7 A;  2FYU H;  4K8Z A;  4YJ2 A;  3ABM B;  5LGU A;  4JI4 O;  1YF2 A;  5CBF A;  1JX9 A;  2H3O A;  3T1H O;  1XNR B;  3OT7 A;  3W7U A;  2DN9 A;  2BTO A;  2GV9 A;  3JCU Z;  4BIO A;  3ZHT A;  2IU0 A;  4O2B B;  3TXQ A;  4ZI7 A;  2EIL B;  3CD6 V;  3CX5 F;  3ZN0 A;  2Q67 A;  1S3J A;  2GSM B;  2WLN A;  1P7G A;  1GM9 A;  1P84 F;  2ZT9 B;  1NU1 H;  3L71 H;  3J80 N;  3E22 A;  1VF6 C;  1YEW A;  5LP6 B;  4NTX A;  1K3E A;  1VQK V;  4ZBM A;  2GBO A;  3IGA C;  4Q20 A;  2P4V A;  3N27 A;  2Q7G A;  3R66 A;  4JF3 A;  2XAQ A;  1TUB A;  4LWS A;  1HDJ A;  1BQ0 A;  3P30 A;  4D6T H;  5LHG A;  4RQE A;  1XMO O;  3RN4 A;  2ZCE A;  3CRR A;  2WLJ A;  2DYS B;  5B1A B;  2HHH O;  4U3J B;  4Z1M G;  2P22 C;  1H2G A;  4K35 A;  1UPG A;  2L35 A;  1SQQ H;  4LFB O;  3G6E V;  5E79 Z;  1R73 A;  5DED A;  3DC5 A;  2Y69 B;  4EFB A;  3OGI B;  1G1X B;  3OD4 A;  4QNH B;  3SPG A;  1HNZ B;  2EIJ C;  4AIL C;  1THZ A;  4ZKI A;  3OMA B;  4QIW F;  1MSW D;  1FPO A;  3A8T A;  4CZZ A;  4XDK A;  4U7N A;  5B3S C;  2KSD A;  1RM1 B;  3TCU A;  5JCO A;  1B3Q A;  2LQT A;  3H01 A;  4PI2 A;  2UXC B;  4CH3 A;  4I4T B;  2UUC B;  4C7U A;  4MT8 A;  1PL0 A;  2UXN A;  1WJZ A;  1JFF A;  1Z2G A;  4JI0 O;  3ZHQ A;  1QU7 A;  1OHH G;  4DR3 B;  1Y4M A;  3WB0 A;  3ZX6 A;  4TUY A;  1H8E G;  1JPX A;  5EYP B;  5KX5 A;  4JI3 O;  3CC2 V;  2JDI G;  3TJT A;  1R1B A;  1Y76 A;  3H1K H;  4LFA B; 
#chains in the Genus database with same CATH homology
 1GN6 A;  3LSU A;  1XRE A;  1BSM A;  1EN6 A;  2QKC A;  1D5N A;  4E4E A;  1AR5 A;  1AR4 A;  4FFK A;  1B06 A;  1MSD A;  1IX9 A;  1BT8 A;  1GN4 A;  1Y67 A;  1I08 A;  2CE4 A;  3KKY A;  4JZG A;  3RN4 A;  4JYY A;  4JZ2 A;  3BFR A;  4YIP A;  1GN3 A;  1AVM A;  1AP5 A;  3CEI A;  1GN2 A;  2ADQ B;  1ZSP A;  3QVN A;  4YIO A;  1IDS A;  1MA1 A;  4GUN A;  1PM9 A;  3DC5 A;  1EN5 A;  2GDS A;  1XIL A;  1ZUQ A;  3DC6 A;  1MMM A;  3C3T A;  1JR9 A;  3IC9 A;  2QKA A;  4BR6 A;  3K9S A;  1LUW A;  1IXB A;  1XDC A;  1XUQ A;  3C3S A;  2ADP A;  1WB7 A;  3KDR A;  1VAR A;  1ZLZ A;  4X9Q A;  2RCV A;  1I0H A;  1N0N A;  1EN4 A;  1QNM A;  3MDS A;  1AP6 A;  1PL4 A;  1MNG A;  1N0J A;  3OT7 A;  4C7U A;  3AK3 A;  1VEW A;  1EM1 A;  3AK2 A;  1JA8 A;  3EVK A;  1WB8 A;  2P4K A;  4F6E A;  1ZTE A;  5AG2 A;  3AK1 A;  1SZX A;  3TJT A;  5A9G A;  1LUV A;  1BS3 A;  1KKC A;  2AW9 A;  2CDY A;  1P7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...