1KKCA

Crystal structure of aspergillus fumigatus mnsod
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
200
structure length
200
Chain Sequence
QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINWAEAENRYIAGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Manganese Superoxide Dismutase
publication title Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
pubmed rcsb
source organism Aspergillus fumigatus
total genus 78
structure length 200
sequence length 200
chains with identical sequence B, X, Y
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1kkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1kkcA02
3C3SA 1AVMA 1WB7A 1QNMA 5AG2A 1N0JA 1XUQA 1EM1A 2ADPA 1JA8A 1ZTEA 1KKCA 1IXBA 1AR4A 1GN2A 1MMMA 2QKAA 4YIOA 3LSUA 3MDSA 3C3TA 1AP6A 1EN4A 2ADQB 3OT7A 1Y67A 1BT8A 1VARA 4FFKA 4E4EA 1P7GA 1WB8A 2CDYA 1I08A 1IX9A 1D5NA 1LUWA 3TJTA 1PL4A 2CE4A 4C7UA 4BR6A 1BSMA 1XDCA 4JZGA 1IDSA 3CEIA 4X9QA 4YIPA 1B06A 2QKCA 5A9GA 1LUVA 3BFRA 3AK3A 1PM9A 3QVNA 1BS3A 1ZSPA 3EVKA 2RCVA 1XILA 1AR5A 1EN6A 1MNGA 1N0NA 1JR9A 4JYYA 1MA1A 3IC9A 3K9SA 4GUNA 1ZLZA 2GDSA 3DC5A 1GN6A 1ZUQA 1MSDA 3AK1A 1VEWA 1I0HA 1XREA 1EN5A 3KKYA 3DC6A 1GN4A 2AW9A 2P4KA 1GN3A 1AP5A 4JZ2A 3AK2A 3RN4A 1SZXA 4F6EA
chains in the Genus database with same CATH superfamily
5EBLC 1SRYA 1H2SB 3ZX6A 1R6TA 2NLJC 1OCOC 5AG2A 2EJ7A 4B7KA 4FZ0A 2UUBO 2LW1A 1AI6A 2WA4A 1F4MA 3ZN0A 1SQVH 4O4LB 1JNBA 1S5LZ 1PV0A 2Q5ZA 1NVPB 1R6KA 1K33A 4FK5C 5ITZB 1HNZO 1SERA 4YIOA 1HNWO 3ZRWA 5IJ0A 3JD2A 4JI1B 2Q8VA 1L0NH 1URFA 3TCUA 3H1KH 4DR5B 1SQPH 5H5NA 5EIBC 3JAWA 1JQ0A 2WLHA 4BAYA 4DR2B 3E83A 5LA6B 2OT5A 4L87A 3Q4HB 2UUAO 1RSOA 5BY1A 1BCCH 3CCVV 1I94B 2XAQA 3RVZA 5B1AC 3K5OA 1WN7A 1K34A 1WP7A 5EC2C 5JJNB 4FLVA 2QDOA 4H33A 2RCVA 1AR5A 1P4RA 3ZS8C 2DYSB 1JR9A 3I5DA 4CH4A 1YZBA 4U7OA 2HHHB 3BAAA 4D7SA 2LO1A 2PGGA 1K9MW 2KSDA 3KCYA 4H37A 3GB7C 3AK1A 2PUSA 3P3NA 5B1BC 2QR4A 4J42A 2IBZH 2PI5A 2IH3C 1JFFB 3CCSV 5CA0B 3CE2A 3SYCA 4FPPA 4LFAO 4Q6GA 3B77A 5C8YA 3OMAB 4DV2B 1V55C 2AZ2A 1WAZA 1Y74A 3K06A 4JAUA 3QO8A 3TK1A 1WB7A 4JI3B 4BIZA 4P2ZA 5KMGB 3ZMZA 3CCMV 4TV8A 3VQVA 4K0KB 3T1HB 1FFXB 1HW7A 3CX5F 1HR0O 4X8AA 1AB3A 1YXBA 2Y4UA 3CCLV 1BHBA 4NXMB 1VF5B 2KQXA 4MVMA 3A0HZ 4WFBV 4I50A 1YVWA 4LWSA 2RNBA 2R70A 4I55A 4GKKO 4J7JA 2ZIOA 4LF7B 3ZCCA 1KQSU 2GTSA 4EB6A 2ADQB 3WG7C 1NQTA 4CZZA 2VS0A 3OFNG 1RM1B 3E22A 4HBNA 3BY6A 1IX9A 2DWEC 1OCOB 2V7QG 1JVMA 3I55V 4PELA 2IU0A 1H2NA 4FLYA 1SKVA 3FD9A 3CC2V 5DN6G 3AK3A 2OCCC 1GM9A 3R65A 4MVUA 1PM9A 4X1YB 3CCUV 3HKBB 2JGUA 2YIAA 4FVMA 4PHZA 2Q0OC 3K57A 2AXTZ 4ZHQB 1EN6A 1MNGA 5CA1B 4JYYA 1OCZB 2IW5A 3H1LH 3NXSA 2Y0IA 3BPZA 3J81N 1H8HG 1HNXB 1H8EG 1EZVH 2GUZB 1KC8W 4JI4O 1WPXA 2WLIA 3CB2A 1SQQH 3JD1A 4PI0A 4MTGA 3IJ4A 3CCQV 2P5OA 5H2FZ 2DE0X 4LC1A 2ZXWC 1N34O 2UXCB 4O4HB 5FNVB 3RFRA 5B1AB 3E8GA 3CJHB 2LW7A 3JSNA 5CMUA 1WJZA 1WLEA 4GLXA 1KKCA 2XOKG 1X59A 3HKCA 4IIJA 1IBKO 4JYAO 1QHTA 2ZE8A 4MTFA 2EIKC 1EZJA 5B1BB 3W7WA 1Q90D 1IZ3A 3AG4C 4OXSA 3T1YO 4LH6A 1R6NA 3ZHRA 2VWKA 3HKEA 2GSMB 5K1PA 4DV0O 4LF9O 2ZD9A 4RO2A 3LSQA 4R50A 3J7AU 1W0JG 2WLNA 1XL4A 5D5PA 1K4CC 1V54B 1JJOA 1I08A 3A8TA 5LL6Y 4I9QA 3QTCA 4LCUC 1M57C 4IL6Z 2IH1C 4NXNO 5KX5B 3VQWA 1AR1B 4JI2O 2HLDG 2Q7GA 4U3JB 4UVAA 3JATA 2Q67A 4NR1A 2ZNJA 4YJ2A 1BZKA 3EVKA 1YDXA 1N0NA 4Z1VA 3MAQA 3K3WA 2YEVB 3IC9A 2Y4TA 1NJIW 2ZDIA 3ZHSA 3E89A 4LF8B 2EZOA 1Q5OA 4B3SB 3WG7B 3DC5A 1MSDA 4LNUB 1XNQO 5CBFA 3EXAA 3D36C 2PF4E 4FLXA 1Y76B 4PI2A 5LXTB 1YJ9V 4B3TO 1GN4A 4WF9V 1GN3A 4YHHO 2FB5A 2JJ1G 4DYLA 3QG5A 3NR7A 4GX5A 5CN0A 2OCCB 4GX2A 4DV6O 1K5QA 1K3EA 5IYZA 4JASA 2BTQB 2WPDG 2QTOA 2YDEA 1N0JA 4NYKA 3LDCA 2Y48A 4U7NA 4R7CA 3P32A 4PA6A 5FPOA 1GMGA 4IT5A 2B9ZA 2LFRA 2LJ2A 4CC5A 1ORQC 1UPGA 3HB3B 4RQFA 1YIJV 4TOIA 1AJQA 1JOYA 2VWJA 2NN4A 2B1GA 1SC5B 3DXRA 4JI8O 2JDIG 4IHJA 1CEZA 2Q69A 3C3TA 2XAJA 2ZT9B 3IGAC 3M7MX 2UUBB 3C90A 1AP6A 3FKSG 1BT8A 1YTFD 4E4EA 1HNZB 1WA8A 1XNRO 4MTXA 3F7VC 1NZ6A 2XAHA 3UO3A 2ILMA 1IDSA 1PP9H 2ZE6A 3P30A 1BQ0A 3O9OA 4X1KB 1M56C 4ZI7B 2KG7B 1F4NA 4WFHA 2CH7A 1GKFA 4DV4O 1B3QA 3SYPA 2EIKB 4DRXA 1ZSPA 1K5SA 4NVPA 4WBNA 1US6A 4KP4A 4XDLA 3ZN1A 2UU9O 1N4CA 4RUFA 4JI6B 3JAKA 4JI0O 2UUAB 4YJ3A 2DYRC 4X66O 4XDKA 4HNAA 3MHHC 1OCCC 4DV3O 3JASA 1W59A 5LMUB 1NH2D 4CS3A 2P4KA 2QTSA 4A5UB 4B3RB 2ZE5A 2D3OW 4J9ZB 1SZXA 2QM8A 2YUAA 3ZRWB 5IJ0B 1KD1W 3APOA 3C3SA 4DK0A 1YI2V 4KFMA 4N23A 4DW1A 2X6AA 4CH5A 1H38A 5LP6C 3JAWB 2N74A 2JS3A 4AHCA 1MMMA 4Z2WA 3HR0A 2MK3A 4IYHA 4O2AA 4LFAB 2JRIA 2QM4A 1H5WA 2ZKOA 1KP3A 5IDJA 1XL6A 4K3AA 1RSOB 3ZIAG 1GO3F 3BHPA 1EBOA 2UXBO 5DECA 2ODMA 1EN4A 1SZTA 2F23A 3CRCA 3CRAA 1T5EA 3JALA 4F6RA 3N2GA 1KU9A 2F93B 1VQMV 4DR3O 4DV5O 2XAGA 3ICXA 4DW0A 1TUEB 5IJ9A 2CTRA 4TSFG 1FXHA 2YIBA 2NR5A 4QPJA 2DYSC 4Z1MG 3K0GA 1R3LC 3SYAA 4UV9A 1QQCA 2P06A 2EIMC 4JTAB 3M8AA 3ZRSA 1FD9A 1VF6C 3PN1A 1VMGA 4DV1B 1PNKA 1GRJA 2ETNA 3ML0A 5C8YB 3QO7A 1XMOB 1KKDA 1DF4A 2WLLA 3ZHUA 1Y74B 3ASOB 4HYOA 2VQEO 3ABLB 3AG1C 4TV8B 5B3SB 1EN5A 3G4SV 4JPRA 5JQGA 5FL7G 3APQA 4X65O 4I0XA 5L3EA 4FM2A 3FYEB 5GTIZ 4RQEA 3OMNB 1G4YB 2RMKB 3ABKB 4I50B 4LWSB 1QBZA 4I55B 3T2MA 3A2FA 4GX0A 2YXLA 4J41A 3OW2U 4GCZA 4EB6B 2DYRB 1ZX3A 1MZFA 4QJFB 3F5TA 1M5IA 3GVMA 1N34B 2YS8A 2QWRB 2CAZC 2WAMA 3BA8A 2P22C 1H2MA 3K03A 1VF7A 1VQNV 3RYFA 1RM1C 4DR7O 4UCRA 3MDSA 3N2KA 3SYQA 2YIBD 1IBKB 4JYAB 2AHYA 2ZQMA 4TWKA 1MABG 1P7GA 5KLVH 2VRZA 1FJGO 2N05A 1SETA 1DGSA 3UT5A 5KHJA 3TJTA 4BW5A 2Q6AA 3CD6V 1SA0A 1J95A 4UVBA 5LP6B 1SQFA 4DV0B 4LF9B 4TV9A 1X4TA 1XHXA 1JJ2U 3G6EV 3ZRXA 1OCZC 5A9GA 1SESA 2BCCH 2WLIB 1PNMA 1BS3A 4OPAA 3SJAC 3JSLA 1FPOA 2A7WA 2HG5C 4NXNB 1S5JA 4P30A 1Z2GA 5EBWC 5JVDB 4XBFA 4JI2B 1GN6A 2YXHA 5LHHA 2UUCB 2P7TC 3RYHA 4PDVA 4F4LA 3DSQA 5IY5C 4PA3A 3FB5C 3HKCB 4IIJB 4LF6O 1MZEA 2OIEA 2HVJC 1AP5A 2X6BA 3RN4A 4JI7O 1WNSA 1M90W 1P7BA 1OCRC 1TVKA 1DK1A 1MOFA 1QLNA 2K1EA 3HKEB 5FLXN 1OZ0A 2EIMB 4MTOA 2ITCC 1TGOA 3CRQA 2ZCEA 4RUEA 2QKSA 2KB1A 4B3TB 1NTMH 1IXBA 4KHPO 4YHHB 1YSCA 2YC0A 1I5YA 5IE9A 4JAAA 4MVOA 2F66C 1K73W 2F95B 4ZKIA 4B7EA 3AG1B 2E5LB 3S3WA 1V54C 3L74H 3K58A 2XAFA 3OM3B 1FAFA 3JATB 3KZIZ 2CTWA 4YJ2B 4PDRA 3SGIA 5H6QA 4QIWF 1YJWV 3RYIA 5EYPA 1GM8A 4BR6A 3A0BZ 1AJPA 3D8CA 1BQZA 2QE7G 4XDJA 2UXDO 3G6BA 5GTHZ 3CP1A 3WB2A 3ZHTA 2PYJA 5EK0A 1ZWIC 2WSSG 3TXSA 5TISZ 3FB7C 2P6JA 3QF7A 4R8CA 1VQLV 1S76D 1XNRB 3IC7A 1RP3B 4FLTA 2A3QA 2JGDA 1I5XA 1KUQA 3R66A 5KAFZ 5IYBO 1MA1A 2RJZA 3ABUA 4PDMA 4O4JA 4J7KA 4I5SA 1N36O 5IYZB 1NH2B 4GX1A 4TUYA 1I0HA 4DV4B 1SF9A 5DEDA 3K5MA 1RPRA 2BSKA 2HEPA 2UU9B 2ZM6O 4EFBA 4JI0B 4X1IA 4UCVA 3U0ZA 1SQXH 4LF5O 4RAIA 5JCOA 3SJBC 3OGCC 3BEHA 4P9OA 1AVMA 4DV3B 3CS5A 1QNMA 3G71V 1JCHA 4IHJB 4LFBB 1XUQA 2OTLV 1EM1A 4YXWG 3IFXA 2PI4A 1QR9A 3BA9A 3JD0A 5ITZA 1D5AA 1JPXA 1WA8B 2Q0AA 1QLEC 3K5NA 1NBMG 2B5UA 2P67A 3K08A 3QO5A 3RYCA 5IY5B 2KKWA 5CB4A 4CH3A 5L3BA 1DTOA 4QE7A 1OJHA 5C93A 3ZHVA 1AI7A 4D7TA 2CH7B 5D5QA 1JMKC 1W0KG 3ZMVA 4BIOA 2F43G 1OCRB 4DRXB 2ZE7A 2CDYA 4WBNB 1LUWA 1PL4A 3JAKB 4YJ3B 4QPKA 4DO2A 4LH7A 3N27A 1PKXA 1XDCA 2DQ3A 2UXXA 4QNHB 1R73A 5JWPA 2Z3YA 1R3JC 2P4VA 2EIJB 4ICGA 4JF3A 3JASB 1PNLA 1VQ5V 5H9CA 5LYJB 5E1AC 1BMFG 2AZ0A 2WA3A 1GK9A 4DV5B 4UFZA 5B5EZ 1YJNV 2W6IG 2XT9A 3ZJZA 1SQGA 1RPOA 1ZLZA 4FIPC 1XHZA 3RW0A 2DWDC 1N33B 4J10A 5IWAO 3U11A 1HDJA 5KA5A 1H2LA 3DTUB 1AROP 2N04A 3G67A 4MS2A 4X89A 4O2AB 1NVPD 2QEXV 3OR7C 3H1HH 1Q8IA 5EZYA 1PPJH 2JS5A 4B08A 5JH7B 1FXKA 3VOUA 4FFBA 1IBMO 1R1BA 2VQEB 1E1QG 3QNEA 5LMNO 2W0FC 4LBEC 5BXZA 4GYCB 3SPCA 3L73H 1L8DA 4X65B 3JALB 3K59A 4TQFA 3CXCU 5IT9N 3ASNB 3FAVA 2QKAA 2JEXA 2RN9A 2HHHO 5IJ9B 2EILB 4DUYO 2QGNA 1J5EO 5CBHA 1BL8A 2EJRA 4H13B 5J2TA 4UVCA 2Q73A 1LR1A 2GHYA 3AG3B 1TUBA 4LR3A 4CS2A 4DV2O 4O4IA 4JZGA 4DR7B 2WLLB 2IJIA 4JAVA 4JI3O 4DUZO 3G80A 2CTQA 1QLEB 3X2QC 1M1KW 4K0KO 3CCEV 1FJGB 4D6TH 3ASOC 1CPYA 1HWYA 2E74B 4I0XB 4MSWC 5L3DA 3ABLC 1HNWB 5LGNA 5B3SC 5L3GA 2CGNA 3OEHG 4H44B 5KAIZ 2DQ0A 3TGUH 3JD3A 1F7YA 3B4SA 3KG2A 2V1DA 2Q7EA 3ABKC 3E8HA 4X62O 1IXMA 3K79A 2HR3A 3TXQA 1PL0A 4X64O 1IVSA 3ETDA 5EC1C 3UM7A 4JV5O 2EINB 3RYFB 1FXVA 2ZR2A 1N32O 3PJSK 1G1XB 3N2KB 2IJHA 3STZC 4RWUA 2ZIMA 1H2KA 4LF6B 1I7FA 1Z5WA 3RBZA 3MHSC 3THOA 4YY3O 3UT5B 1KYOF 4HZ3A 2HP8A 3OUSA 4K35A 3S3XA 1SA0B 4TV9B 3SJQC 3JD4A 4X88A 2DOSA 4G27B 4G2KA 4JI5O 4KHPB 1B04A 3A0RA 5BMVA 2VQFO 4Q20A 3O65A 3SPGA 4DK1A 5KUKA 4J80A 1KB9F 1Q43A 2L6LA 1Q6UA 4K8ZA 3ETQA 3OTFA 2X6CA 5EIBD 1O9HA 1B06A 3RYHB 2FMLA 2A9HA 1HR0B 3W7UA 1THZA 4FZ1A 1XILA 2LGQA 3CXHF 4J7ZA 5KUMA 4GUNA 1FFTB 4GKKB 2UXDB 1TVKB 2GBOA 3SPIA 2JJ2G 5J9PC 2PYLA 4CS4A 3E2EA 4JTDB 1WPBA 4OX9O 2MW2B 2R9RB 1AJNA 4MW8A 1NTZH 5JJEB 5DM6V 3H1IH 4KUMA 2YXYA 2XHBA 3X2QB 1Q3EA 5K1XA 2WLJA 3ZMTA 5J2UA 2RDCA 3OAAG 1FOUA 4DR6O 3OMIB 4EKWA 3F5WC 1ZTEA 3H1JH 3FFQA 4DR4O 3JYCA 1VIBA 3K9AA 1YEWA 1ZL8A 5LOVA 4JYBA 4LFCO 2L35A 2JK5C 1E79G 3L9DA 4UB6Z 1VQKV 1EFRG 3RYIB 5EYPB 3H9VA 3WB0A 3JCUZ 3LDDA 2P90A 2FKXA 2ZR3A 4WFFA 1B6QA 5LHGA 4OPHA 4JI4B 2Y69B 1M4UA 2ZDIC 3OT7A 1UJWB 1FXKC 1M93A 4FFKA 1IBLO 1UFIA 2XUMA 4WFAV 2Q7HA 3E22B 2CE4A 3RWRD 4G28B 1G6UA 2IU3A 3ZBHA 5GONA 1BGYH 4O4JB 1E1RG 1BE3H 3CEIA 4JTCB 2Q68A 3RT3C 3CMEV 2GTAA 2YI8A 2FTKA 2QWQB 4OGQB 4TUYB 1M9NA 1L1FA 4UUJC 3RGBA 3J80N 3QVNA 1K4DC 2LGWA 2BSKB 2W0XA 2AHZA 3ABTA 4X1IB 4LF4O 4W4LA 4UCUA 4ZOLA 1BHAA 1KECA 3T1YB 3EFFK 1S5HC 1ZUQA 4AQYO 3ETEA 4O2BA 2RQ6A 3VQYA 3LDEA 2M7WA 3OUFA 2QWPB 1K92A 3RYCB 1VQ4V 5CB4B 1L0LH 3HPLC 4WFGA 2DJVA 1S0VA 4WCEV 1TA8A 3UKMA 5IWAB 5LBQA 5LGUA 5A2QN 4NB5A 1F51A 3CWBH 4NKGB 1VQPV 4I9WA 2EZPA 1FYJA 2Y0PA 4JI6O 2H3OA 3D36A 5HFLA 1R3KC 4EEQA 1YHQV 3JARA 1IBMB 3KCXA 2ATKC 1NR7A 5LMNB 1P84F 2F1MA 1XNQB 2H94A 1MG1A 1QCEA 2IJJA 5H6RA 1V9PA 1VARA 1Y67A 5LMUO 2EIJC 2CTPA 1AI4A 4B3RO 3B2EE 1ZAUA 2PZSA 3WB1A 4DV6B 5CA3A 3B09A 4DV7O 4DUYB 2EULA 1N8RW 1YTFB 1LNQA 1J5EB 1NR1A 3VQXA 2F4VO 4GKJO 1NTKH 4QE9A 2E76B 5HFMA 3OTOO 4IYIA 5B1NA 5BR8O 3BVOA 3UCSC 2OTJV 2EX3A 3ABMB 3E35A 2QWNB 3FX7A 4PDLA 1HP8A 5EZYB 4JI8B 1COWG 1FXKB 4KXRA 4FFBB 4DUZB 2OYQA 3FB8C 1YF2A 4FMTA 3B8NA 2PTMA 3ZEDA 3SDLA 1VQOV 2HJFC 3IAYA 5LGTA 3FAVB 3AK2A 4X20A 1Q81W 2H8PC 2NNUA 3CSXA 1NU1H 2YI9A 1K8AW 1JX9A 4I4TA 2PY5A 4ZBMA 4MW3A 1S3JA 3ASNC 1IURA 2IM9A 1Y6XA 4BW9A 2EILC 4X62B 5J2TB 4DR1O 1GAXA 1GN2A 1F23A 3LSSA 1SS3A 3T1CA 4X64B 1GH6A 3LSUA 3HKDA 2JIZG 2O57A 3ZMSA 1TUBB 2E75B 4DV1O 4JV5B 4X66B 1XMOO 2IJKA 4O4IB 3AG3C 4UCSA 3BCCH 4B3MO 3DXRB 4J11A 1N32B 3LUTB 2Z5UA 2DN9A 4WFEA 3RVYA 1QVGU 4O4LA 1FS0G 4YY3B 1MSWD 1D5NA 3GWOA 5BZBA 2V4DA 5LP6A 1Y66A 3LNNA 1WP8A 4CC6A 1Y4MA 2AGAA 4MVRA 3W7TA 4U3FH 4JI5B 2CK3G 1RFYA 2VQFB 5LA6A 4PA7A 1Q86W 3Q4HA 3K9SA 2R72A 4FLZA 5JVDA 3VBBA 1XMQO 3UO2A 4HNAB 5LHIA 2UXBB 1VEWA 1SQBH 1VQ9V 2EINC 1GTOA 3DC6A 4LP8A 4DR3B 1NS1A 1XBLA 5F2VO 4F6EA 1NKDA 5L3FA 4JI1O 4PA4A 1KP2A 4FLWA 1Q6IA 3K04A 3M99B 4DR5O 1K7DA 4ABMA 2BE3A 2ADPA 1JA8A 1VF6A 4GZRB 2HVKC 1JFFA 1Q6HA 4K8XA 1V55B 3T4DA 5CA0A 5EBMC 4OX9B 2XASA 1H2GA 4DR2O 5BMVB 2YICA 4JYCA 4CBCA 4N21A 1VQ7V 3SPJA 2JVDA 1I94O 4DR6B 3P3PA 2UUCO 5KMGA 4HAMA 4DR4B 1FFXA 3AEIA 3U10A 4FJCC 4LFCB 2DMXA 4NTWA 3SPHA 4F6RB 3T4ZA 3N2GB 2DW4A 2R9AA 4IGGA 1BSMA 5B66Z 3AG2C 1YITV 4YIPA 3CC7V 3FB6C 2QKCA 3B8MA 2A0LA 1TAEA 5KHIA 3OEEG 1IBLB 4I7ZB 2B1IA 3CMAV 3W7SA 4FM0A 2UXNA 3GWKC 5IYDO 4FM1A 5IYCO 3CYOA 4UV8A 3OE7G 1D2DA 2D2CB 2E5LO 2Z0AA 3D3QA 5KHGA 5J2UB 4H0LB 4DXWA 4UCTA 1R3IC 3E8FA 4X1YA 3T1HO 3KKYA 3HKBA 1DLBA 1ZL8B 5JQGB 4PV1B 4ZHQA 5LOVB 5CA1A 3SR2C 4LF4B 3ETGA 2LP7A 2YIDA 4NXMO 1U96A 2JEUA 2ZINA 2HKOA 3L71H 4AQYB 3UQ8A 3SYOA 4LF7O 2GUZA 1VQ8V 4MVZA 2HFEC 2ZXWB 1NT2B 4ZIBA 1AR4A 2M6YA 2YSUB 4O4HA 2Y69C 5FNVA 4ASUG 2BOCC 4L8JA 3CJHA 5GONB 2ZNIA 4J9YB 1K97A 1IJGA 1CXZB 4JGSA 3AG7A 2QSAA 3CRRA 5L3CA 3AG4B 4CH6A 1OHHG 1WB8A 2OCHA 3CHXA 1ENVA 3BABA 4JI7B 3D3IA 3LNMB 2FYUH 4ZOLB 1Q82W 4R6ZA 2QWOB 3STLC 1VQ6V 4X9QA 1HNXO 2A06H 4LFBO 4O2BB 3BFRA 3BRCA 2CGOA 1XOUA 5LYJA 1M57B 5JCOC 3CPWU 1AILA 5FPRA 1XEQA 2FL4A 3MD0A 4PA9A 3B40A 3F7YC 1KMIZ 2WLMA 2UXCO 4DV7B 5KX5A 3SJCC 3WFVA 5CBGA 4U3JA 2F4VB 5KHHA 4GKJB 3ZHQA 1XREA 4PJ0Z 4EFEA 4GT1A 3KDRA 3OTOB 4AI8A 2AW9A 3AG2B 5BR8B 5KHKA 3CCRV 4JZ2A 2YEVA 4KL1A 2G38A 4UCOA 3OGIB 2QA4V 5JH7A 2BOBC 3JARB 2LQTA 4LNUA 1YCIA 1GM7A 1Q7YW 4E2LA 2XTAA 4MVQA 1Y76A 5LXTA 3FYIB 4UXNA 3DGEA 1VP7A 1OV9A 2EBOA 3ZMUA 3OR6C 3OD4A 2GV9A 1KBHA 1XI1A 4TQDA 4QGPA 2Q9LA 1QR8A 2QJ1A 4FLUA 1PD3A 2BTQA 1N36B 4MVSA 3L75H 3JCZA 1QVFU 4P9PA 2OWOA 1QU7A 4UB8Z 3JAMN 3ZRVA 1N33O 4DR1B 1A32A 4PD4F 3WU2Z 2ZM6B 1AI5A 2X0LA 1O9GA 5B1OA 4LF5B 2BTOA 4C7UA 1P49A 2E3CA 2C2AA 1G8MA 3E8BA 1U97A 4LF8O 4B3MB 4W4KA 4NTYA 2OIGA 4B3SO 3TETA 2K9PA 2A79B 2XNDG 1FKAO 3CC4V 2WLKA 1DF5A 1LUVA 3ABMC 2X7RB 3I56V 1S72V 2ARHA 2W6JG 3K0DA 2JGDB 1M56B 2CUGA 3CRMA 1XQ8A 4MT8A 4X20B 2R9IA 4I4TB 2ITDC 5JJJB 2GDSA 4X1KA 4ZI7A 2KG7A 3CCJV 2LFSA 5GW7A 1W2BU 1Z5VA 3L70H 3EHBB 4AILC 3E86A 3H01A 2Q4PA 3L72H 1CP9A 1NI8A 2WWWA 4TT3G 1OCCB 5KA6A 4BWAA 2QM7A 1S77D 3W7XA 4NTXA 3HKDB 1ROPA 4BIUA 5E79Z 3K5LA 2HJDA 1XMQB
chains in the Genus database with same CATH topology
3C3SA 1AVMA 1WB7A 1QNMA 5AG2A 1N0JA 1XUQA 1EM1A 2ADPA 1JA8A 1ZTEA 1KKCA 1IXBA 1AR4A 1GN2A 1MMMA 2QKAA 4YIOA 3LSUA 3MDSA 3C3TA 1AP6A 1EN4A 2ADQB 3OT7A 1Y67A 1BT8A 1VARA 4FFKA 4E4EA 1P7GA 1WB8A 2CDYA 1I08A 1IX9A 1D5NA 1LUWA 3TJTA 1PL4A 2CE4A 4C7UA 4BR6A 1BSMA 1XDCA 4JZGA 1IDSA 3CEIA 4X9QA 4YIPA 1B06A 2QKCA 5A9GA 1LUVA 3BFRA 3AK3A 1PM9A 3QVNA 1BS3A 1ZSPA 3EVKA 2RCVA 1XILA 1AR5A 1EN6A 1MNGA 1N0NA 1JR9A 4JYYA 1MA1A 3IC9A 3K9SA 4GUNA 1ZLZA 2GDSA 3DC5A 1GN6A 1ZUQA 1MSDA 3AK1A 1VEWA 1I0HA 1XREA 1EN5A 3KKYA 3DC6A 3KDRA 1GN4A 2AW9A 2P4KA 1GN3A 1AP5A 4JZ2A 3AK2A 3RN4A 1SZXA 4F6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3S A;  1AVM A;  1WB7 A;  1QNM A;  5AG2 A;  1N0J A;  1XUQ A;  1EM1 A;  2ADP A;  1JA8 A;  1ZTE A;  1KKC A;  1IXB A;  1AR4 A;  1GN2 A;  1MMM A;  2QKA A;  4YIO A;  3LSU A;  3MDS A;  3C3T A;  1AP6 A;  1EN4 A;  2ADQ B;  3OT7 A;  1Y67 A;  1BT8 A;  1VAR A;  4FFK A;  4E4E A;  1P7G A;  1WB8 A;  2CDY A;  1I08 A;  1IX9 A;  1D5N A;  1LUW A;  3TJT A;  1PL4 A;  2CE4 A;  4C7U A;  4BR6 A;  1BSM A;  1XDC A;  4JZG A;  1IDS A;  3CEI A;  4X9Q A;  4YIP A;  1B06 A;  2QKC A;  5A9G A;  1LUV A;  3BFR A;  3AK3 A;  1PM9 A;  3QVN A;  1BS3 A;  1ZSP A;  3EVK A;  2RCV A;  1XIL A;  1AR5 A;  1EN6 A;  1MNG A;  1N0N A;  1JR9 A;  4JYY A;  1MA1 A;  3IC9 A;  3K9S A;  4GUN A;  1ZLZ A;  2GDS A;  3DC5 A;  1GN6 A;  1ZUQ A;  1MSD A;  3AK1 A;  1VEW A;  1I0H A;  1XRE A;  1EN5 A;  3KKY A;  3DC6 A;  1GN4 A;  2AW9 A;  2P4K A;  1GN3 A;  1AP5 A;  4JZ2 A;  3AK2 A;  3RN4 A;  1SZX A;  4F6E A; 
#chains in the Genus database with same CATH topology
 5EBL C;  1SRY A;  1H2S B;  3ZX6 A;  1R6T A;  2NLJ C;  1OCO C;  5AG2 A;  2EJ7 A;  4B7K A;  4FZ0 A;  2UUB O;  2LW1 A;  1AI6 A;  2WA4 A;  1F4M A;  3ZN0 A;  1SQV H;  4O4L B;  1JNB A;  1S5L Z;  1PV0 A;  2Q5Z A;  1NVP B;  1R6K A;  1K33 A;  4FK5 C;  5ITZ B;  1HNZ O;  1SER A;  4YIO A;  1HNW O;  3ZRW A;  5IJ0 A;  3JD2 A;  4JI1 B;  2Q8V A;  1L0N H;  1URF A;  3TCU A;  3H1K H;  4DR5 B;  1SQP H;  5H5N A;  5EIB C;  3JAW A;  1JQ0 A;  2WLH A;  4BAY A;  4DR2 B;  3E83 A;  5LA6 B;  2OT5 A;  4L87 A;  3Q4H B;  2UUA O;  1RSO A;  5BY1 A;  1BCC H;  3CCV V;  1I94 B;  2XAQ A;  3RVZ A;  5B1A C;  3K5O A;  1WN7 A;  1K34 A;  1WP7 A;  5EC2 C;  5JJN B;  4FLV A;  2QDO A;  4H33 A;  2RCV A;  1AR5 A;  1P4R A;  3ZS8 C;  2DYS B;  1JR9 A;  3I5D A;  4CH4 A;  1YZB A;  4U7O A;  2HHH B;  3BAA A;  4D7S A;  2LO1 A;  2PGG A;  1K9M W;  2KSD A;  3KCY A;  4H37 A;  3GB7 C;  3AK1 A;  2PUS A;  3P3N A;  5B1B C;  2QR4 A;  4J42 A;  2IBZ H;  2PI5 A;  2IH3 C;  1JFF B;  3CCS V;  5CA0 B;  3CE2 A;  3SYC A;  4FPP A;  4LFA O;  4Q6G A;  3B77 A;  5C8Y A;  3OMA B;  4DV2 B;  1V55 C;  2AZ2 A;  1WAZ A;  1Y74 A;  3K06 A;  4JAU A;  3QO8 A;  3TK1 A;  1WB7 A;  4JI3 B;  4BIZ A;  4P2Z A;  5KMG B;  3ZMZ A;  3CCM V;  4TV8 A;  3VQV A;  4K0K B;  3T1H B;  1FFX B;  1HW7 A;  3CX5 F;  1HR0 O;  4X8A A;  1AB3 A;  1YXB A;  2Y4U A;  3CCL V;  1BHB A;  4NXM B;  1VF5 B;  2KQX A;  4MVM A;  3A0H Z;  4WFB V;  4I50 A;  1YVW A;  4LWS A;  2RNB A;  2R70 A;  4I55 A;  4GKK O;  4J7J A;  2ZIO A;  4LF7 B;  3ZCC A;  1KQS U;  2GTS A;  4EB6 A;  2ADQ B;  3WG7 C;  1NQT A;  4CZZ A;  2VS0 A;  3OFN G;  1RM1 B;  3E22 A;  4HBN A;  3BY6 A;  1IX9 A;  2DWE C;  1OCO B;  2V7Q G;  1JVM A;  3I55 V;  4PEL A;  2IU0 A;  1H2N A;  4FLY A;  1SKV A;  3FD9 A;  3CC2 V;  5DN6 G;  3AK3 A;  2OCC C;  1GM9 A;  3R65 A;  4MVU A;  1PM9 A;  4X1Y B;  3CCU V;  3HKB B;  2JGU A;  2YIA A;  4FVM A;  4PHZ A;  2Q0O C;  3K57 A;  2AXT Z;  4ZHQ B;  1EN6 A;  1MNG A;  5CA1 B;  4JYY A;  1OCZ B;  2IW5 A;  3H1L H;  3NXS A;  2Y0I A;  3BPZ A;  3J81 N;  1H8H G;  1HNX B;  1H8E G;  1EZV H;  2GUZ B;  1KC8 W;  4JI4 O;  1WPX A;  2WLI A;  3CB2 A;  1SQQ H;  3JD1 A;  4PI0 A;  4MTG A;  3IJ4 A;  3CCQ V;  2P5O A;  5H2F Z;  2DE0 X;  4LC1 A;  2ZXW C;  1N34 O;  2UXC B;  4O4H B;  5FNV B;  3RFR A;  5B1A B;  3E8G A;  3CJH B;  2LW7 A;  3JSN A;  5CMU A;  1WJZ A;  1WLE A;  4GLX A;  1KKC A;  2XOK G;  1X59 A;  3HKC A;  4IIJ A;  1IBK O;  4JYA O;  1QHT A;  2ZE8 A;  4MTF A;  2EIK C;  1EZJ A;  5B1B B;  3W7W A;  1Q90 D;  1IZ3 A;  3AG4 C;  4OXS A;  3T1Y O;  4LH6 A;  1R6N A;  3ZHR A;  2VWK A;  3HKE A;  2GSM B;  5K1P A;  4DV0 O;  4LF9 O;  2ZD9 A;  4RO2 A;  3LSQ A;  4R50 A;  3J7A U;  1W0J G;  2WLN A;  1XL4 A;  5D5P A;  1K4C C;  1V54 B;  1JJO A;  1I08 A;  3A8T A;  5LL6 Y;  4I9Q A;  3QTC A;  4LCU C;  1M57 C;  4IL6 Z;  2IH1 C;  4NXN O;  5KX5 B;  3VQW A;  1AR1 B;  4JI2 O;  2HLD G;  2Q7G A;  4U3J B;  4UVA A;  3JAT A;  2Q67 A;  4NR1 A;  2ZNJ A;  4YJ2 A;  1BZK A;  3EVK A;  1YDX A;  1N0N A;  4Z1V A;  3MAQ A;  3K3W A;  2YEV B;  3IC9 A;  2Y4T A;  1NJI W;  2ZDI A;  3ZHS A;  3E89 A;  4LF8 B;  2EZO A;  1Q5O A;  4B3S B;  3WG7 B;  3DC5 A;  1MSD A;  4LNU B;  1XNQ O;  5CBF A;  3EXA A;  3D36 C;  2PF4 E;  4FLX A;  1Y76 B;  4PI2 A;  5LXT B;  1YJ9 V;  4B3T O;  1GN4 A;  4WF9 V;  1GN3 A;  4YHH O;  2FB5 A;  2JJ1 G;  4DYL A;  3QG5 A;  3NR7 A;  4GX5 A;  5CN0 A;  2OCC B;  4GX2 A;  4DV6 O;  1K5Q A;  1K3E A;  5IYZ A;  4JAS A;  2BTQ B;  2WPD G;  2QTO A;  2YDE A;  1N0J A;  4NYK A;  3LDC A;  2Y48 A;  4U7N A;  4R7C A;  3P32 A;  4PA6 A;  5FPO A;  1GMG A;  4IT5 A;  2B9Z A;  2LFR A;  2LJ2 A;  4CC5 A;  1ORQ C;  1UPG A;  3HB3 B;  4RQF A;  1YIJ V;  4TOI A;  1AJQ A;  1JOY A;  2VWJ A;  2NN4 A;  2B1G A;  1SC5 B;  3DXR A;  4JI8 O;  2JDI G;  4IHJ A;  1CEZ A;  2Q69 A;  3C3T A;  2XAJ A;  2ZT9 B;  3IGA C;  3M7M X;  2UUB B;  3C90 A;  1AP6 A;  3FKS G;  1BT8 A;  1YTF D;  4E4E A;  1HNZ B;  1WA8 A;  1XNR O;  4MTX A;  3F7V C;  1NZ6 A;  2XAH A;  3UO3 A;  2ILM A;  1IDS A;  1PP9 H;  2ZE6 A;  3P30 A;  1BQ0 A;  3O9O A;  4X1K B;  1M56 C;  4ZI7 B;  2KG7 B;  1F4N A;  4WFH A;  2CH7 A;  1GKF A;  4DV4 O;  1B3Q A;  3SYP A;  2EIK B;  4DRX A;  1ZSP A;  1K5S A;  4NVP A;  4WBN A;  1US6 A;  4KP4 A;  4XDL A;  3ZN1 A;  2UU9 O;  1N4C A;  4RUF A;  4JI6 B;  3JAK A;  4JI0 O;  2UUA B;  4YJ3 A;  2DYR C;  4X66 O;  4XDK A;  4HNA A;  3MHH C;  1OCC C;  4DV3 O;  3JAS A;  1W59 A;  5LMU B;  1NH2 D;  4CS3 A;  2P4K A;  2QTS A;  4A5U B;  4B3R B;  2ZE5 A;  2D3O W;  4J9Z B;  1SZX A;  2QM8 A;  2YUA A;  3ZRW B;  5IJ0 B;  1KD1 W;  3APO A;  3C3S A;  4DK0 A;  1YI2 V;  4KFM A;  4N23 A;  4DW1 A;  2X6A A;  4CH5 A;  1H38 A;  5LP6 C;  3JAW B;  2N74 A;  2JS3 A;  4AHC A;  1MMM A;  4Z2W A;  3HR0 A;  2MK3 A;  4IYH A;  4O2A A;  4LFA B;  2JRI A;  2QM4 A;  1H5W A;  2ZKO A;  1KP3 A;  5IDJ A;  1XL6 A;  4K3A A;  1RSO B;  3ZIA G;  1GO3 F;  3BHP A;  1EBO A;  2UXB O;  5DEC A;  2ODM A;  1EN4 A;  1SZT A;  2F23 A;  3CRC A;  3CRA A;  1T5E A;  3JAL A;  4F6R A;  3N2G A;  1KU9 A;  2F93 B;  1VQM V;  4DR3 O;  4DV5 O;  2XAG A;  3ICX A;  4DW0 A;  1TUE B;  5IJ9 A;  2CTR A;  4TSF G;  1FXH A;  2YIB A;  2NR5 A;  4QPJ A;  2DYS C;  4Z1M G;  3K0G A;  1R3L C;  3SYA A;  4UV9 A;  1QQC A;  2P06 A;  2EIM C;  4JTA B;  3M8A A;  3ZRS A;  1FD9 A;  1VF6 C;  3PN1 A;  1VMG A;  4DV1 B;  1PNK A;  1GRJ A;  2ETN A;  3ML0 A;  5C8Y B;  3QO7 A;  1XMO B;  1KKD A;  1DF4 A;  2WLL A;  3ZHU A;  1Y74 B;  3ASO B;  4HYO A;  2VQE O;  3ABL B;  3AG1 C;  4TV8 B;  5B3S B;  1EN5 A;  3G4S V;  4JPR A;  5JQG A;  5FL7 G;  3APQ A;  4X65 O;  4I0X A;  5L3E A;  4FM2 A;  3FYE B;  5GTI Z;  4RQE A;  3OMN B;  1G4Y B;  2RMK B;  3ABK B;  4I50 B;  4LWS B;  1QBZ A;  4I55 B;  3T2M A;  3A2F A;  4GX0 A;  2YXL A;  4J41 A;  3OW2 U;  4GCZ A;  4EB6 B;  2DYR B;  1ZX3 A;  1MZF A;  4QJF B;  3F5T A;  1M5I A;  3GVM A;  1N34 B;  2YS8 A;  2QWR B;  2CAZ C;  2WAM A;  3BA8 A;  2P22 C;  1H2M A;  3K03 A;  1VF7 A;  1VQN V;  3RYF A;  1RM1 C;  4DR7 O;  4UCR A;  3MDS A;  3N2K A;  3SYQ A;  2YIB D;  1IBK B;  4JYA B;  2AHY A;  2ZQM A;  4TWK A;  1MAB G;  1P7G A;  5KLV H;  2VRZ A;  1FJG O;  2N05 A;  1SET A;  1DGS A;  3UT5 A;  5KHJ A;  3TJT A;  4BW5 A;  2Q6A A;  3CD6 V;  1SA0 A;  1J95 A;  4UVB A;  5LP6 B;  1SQF A;  4DV0 B;  4LF9 B;  4TV9 A;  1X4T A;  1XHX A;  1JJ2 U;  3G6E V;  3ZRX A;  1OCZ C;  5A9G A;  1SES A;  2BCC H;  2WLI B;  1PNM A;  1BS3 A;  4OPA A;  3SJA C;  3JSL A;  1FPO A;  2A7W A;  2HG5 C;  4NXN B;  1S5J A;  4P30 A;  1Z2G A;  5EBW C;  5JVD B;  4XBF A;  4JI2 B;  1GN6 A;  2YXH A;  5LHH A;  2UUC B;  2P7T C;  3RYH A;  4PDV A;  4F4L A;  3DSQ A;  5IY5 C;  4PA3 A;  3FB5 C;  3HKC B;  4IIJ B;  4LF6 O;  1MZE A;  2OIE A;  2HVJ C;  1AP5 A;  2X6B A;  3RN4 A;  4JI7 O;  1WNS A;  1M90 W;  1P7B A;  1OCR C;  1TVK A;  1DK1 A;  1MOF A;  1QLN A;  2K1E A;  3HKE B;  5FLX N;  1OZ0 A;  2EIM B;  4MTO A;  2ITC C;  1TGO A;  3CRQ A;  2ZCE A;  4RUE A;  2QKS A;  2KB1 A;  4B3T B;  1NTM H;  1IXB A;  4KHP O;  4YHH B;  1YSC A;  2YC0 A;  1I5Y A;  5IE9 A;  4JAA A;  4MVO A;  2F66 C;  1K73 W;  2F95 B;  4ZKI A;  4B7E A;  3AG1 B;  2E5L B;  3S3W A;  1V54 C;  3L74 H;  3K58 A;  2XAF A;  3OM3 B;  1FAF A;  3JAT B;  3KZI Z;  2CTW A;  4YJ2 B;  4PDR A;  3SGI A;  5H6Q A;  4QIW F;  1YJW V;  3RYI A;  5EYP A;  1GM8 A;  4BR6 A;  3A0B Z;  1AJP A;  3D8C A;  1BQZ A;  2QE7 G;  4XDJ A;  2UXD O;  3G6B A;  5GTH Z;  3CP1 A;  3WB2 A;  3ZHT A;  2PYJ A;  5EK0 A;  1ZWI C;  2WSS G;  3TXS A;  5TIS Z;  3FB7 C;  2P6J A;  3QF7 A;  4R8C A;  1VQL V;  1S76 D;  1XNR B;  3IC7 A;  1RP3 B;  4FLT A;  2A3Q A;  2JGD A;  1I5X A;  1KUQ A;  3R66 A;  5KAF Z;  5IYB O;  1MA1 A;  2RJZ A;  3ABU A;  4PDM A;  4O4J A;  4J7K A;  4I5S A;  1N36 O;  5IYZ B;  1NH2 B;  4GX1 A;  4TUY A;  1I0H A;  4DV4 B;  1SF9 A;  5DED A;  3K5M A;  1RPR A;  2BSK A;  2HEP A;  2UU9 B;  2ZM6 O;  4EFB A;  4JI0 B;  4X1I A;  4UCV A;  3U0Z A;  1SQX H;  4LF5 O;  4RAI A;  5JCO A;  3SJB C;  3OGC C;  3BEH A;  4P9O A;  1AVM A;  4DV3 B;  3CS5 A;  1QNM A;  3G71 V;  1JCH A;  4IHJ B;  4LFB B;  1XUQ A;  2OTL V;  1EM1 A;  4YXW G;  3IFX A;  2PI4 A;  1QR9 A;  3BA9 A;  3JD0 A;  5ITZ A;  1D5A A;  1JPX A;  1WA8 B;  2Q0A A;  1QLE C;  3K5N A;  1NBM G;  2B5U A;  2P67 A;  3K08 A;  3QO5 A;  3RYC A;  5IY5 B;  2KKW A;  5CB4 A;  4CH3 A;  5L3B A;  1DTO A;  4QE7 A;  1OJH A;  5C93 A;  3ZHV A;  1AI7 A;  4D7T A;  2CH7 B;  5D5Q A;  1JMK C;  1W0K G;  3ZMV A;  4BIO A;  2F43 G;  1OCR B;  4DRX B;  2ZE7 A;  2CDY A;  4WBN B;  1LUW A;  1PL4 A;  3JAK B;  4YJ3 B;  4QPK A;  4DO2 A;  4LH7 A;  3N27 A;  1PKX A;  1XDC A;  2DQ3 A;  2UXX A;  4QNH B;  1R73 A;  5JWP A;  2Z3Y A;  1R3J C;  2P4V A;  2EIJ B;  4ICG A;  4JF3 A;  3JAS B;  1PNL A;  1VQ5 V;  5H9C A;  5LYJ B;  5E1A C;  1BMF G;  2AZ0 A;  2WA3 A;  1GK9 A;  4DV5 B;  4UFZ A;  5B5E Z;  1YJN V;  2W6I G;  2XT9 A;  3ZJZ A;  1SQG A;  1RPO A;  1ZLZ A;  4FIP C;  1XHZ A;  3RW0 A;  2DWD C;  1N33 B;  4J10 A;  5IWA O;  3U11 A;  1HDJ A;  5KA5 A;  1H2L A;  3DTU B;  1ARO P;  2N04 A;  3G67 A;  4MS2 A;  4X89 A;  4O2A B;  1NVP D;  2QEX V;  3OR7 C;  3H1H H;  1Q8I A;  5EZY A;  1PPJ H;  2JS5 A;  4B08 A;  5JH7 B;  1FXK A;  3VOU A;  4FFB A;  1IBM O;  1R1B A;  2VQE B;  1E1Q G;  3QNE A;  5LMN O;  2W0F C;  4LBE C;  5BXZ A;  4GYC B;  3SPC A;  3L73 H;  1L8D A;  4X65 B;  3JAL B;  3K59 A;  4TQF A;  3CXC U;  5IT9 N;  3ASN B;  3FAV A;  2QKA A;  2JEX A;  2RN9 A;  2HHH O;  5IJ9 B;  2EIL B;  4DUY O;  2QGN A;  1J5E O;  5CBH A;  1BL8 A;  2EJR A;  4H13 B;  5J2T A;  4UVC A;  2Q73 A;  1LR1 A;  2GHY A;  3AG3 B;  1TUB A;  4LR3 A;  4CS2 A;  4DV2 O;  4O4I A;  4JZG A;  4DR7 B;  2WLL B;  2IJI A;  4JAV A;  4JI3 O;  4DUZ O;  3G80 A;  2CTQ A;  1QLE B;  3X2Q C;  1M1K W;  4K0K O;  3CCE V;  1FJG B;  4D6T H;  3ASO C;  1CPY A;  1HWY A;  2E74 B;  4I0X B;  4MSW C;  5L3D A;  3ABL C;  1HNW B;  5LGN A;  5B3S C;  5L3G A;  2CGN A;  3OEH G;  4H44 B;  5KAI Z;  2DQ0 A;  3TGU H;  3JD3 A;  1F7Y A;  3B4S A;  3KG2 A;  2V1D A;  2Q7E A;  3ABK C;  3E8H A;  4X62 O;  1IXM A;  3K79 A;  2HR3 A;  3TXQ A;  1PL0 A;  4X64 O;  1IVS A;  3ETD A;  5EC1 C;  3UM7 A;  4JV5 O;  2EIN B;  3RYF B;  1FXV A;  2ZR2 A;  1N32 O;  3PJS K;  1G1X B;  3N2K B;  2IJH A;  3STZ C;  4RWU A;  2ZIM A;  1H2K A;  4LF6 B;  1I7F A;  1Z5W A;  3RBZ A;  3MHS C;  3THO A;  4YY3 O;  3UT5 B;  1KYO F;  4HZ3 A;  2HP8 A;  3OUS A;  4K35 A;  3S3X A;  1SA0 B;  4TV9 B;  3SJQ C;  3JD4 A;  4X88 A;  2DOS A;  4G27 B;  4G2K A;  4JI5 O;  4KHP B;  1B04 A;  3A0R A;  5BMV A;  2VQF O;  4Q20 A;  3O65 A;  3SPG A;  4DK1 A;  5KUK A;  4J80 A;  1KB9 F;  1Q43 A;  2L6L A;  1Q6U A;  4K8Z A;  3ETQ A;  3OTF A;  2X6C A;  5EIB D;  1O9H A;  1B06 A;  3RYH B;  2FML A;  2A9H A;  1HR0 B;  3W7U A;  1THZ A;  4FZ1 A;  1XIL A;  2LGQ A;  3CXH F;  4J7Z A;  5KUM A;  4GUN A;  1FFT B;  4GKK B;  2UXD B;  1TVK B;  2GBO A;  3SPI A;  2JJ2 G;  5J9P C;  2PYL A;  4CS4 A;  3E2E A;  4JTD B;  1WPB A;  4OX9 O;  2MW2 B;  2R9R B;  1AJN A;  4MW8 A;  1NTZ H;  5JJE B;  5DM6 V;  3H1I H;  4KUM A;  2YXY A;  2XHB A;  3X2Q B;  1Q3E A;  5K1X A;  2WLJ A;  3ZMT A;  5J2U A;  2RDC A;  3OAA G;  1FOU A;  4DR6 O;  3OMI B;  4EKW A;  3F5W C;  1ZTE A;  3H1J H;  3FFQ A;  4DR4 O;  3JYC A;  1VIB A;  3K9A A;  1YEW A;  1ZL8 A;  5LOV A;  4JYB A;  4LFC O;  2L35 A;  2JK5 C;  1E79 G;  3L9D A;  4UB6 Z;  1VQK V;  1EFR G;  3RYI B;  5EYP B;  3H9V A;  3WB0 A;  3JCU Z;  3LDD A;  2P90 A;  2FKX A;  2ZR3 A;  4WFF A;  1B6Q A;  5LHG A;  4OPH A;  4JI4 B;  2Y69 B;  1M4U A;  2ZDI C;  3OT7 A;  1UJW B;  1FXK C;  1M93 A;  4FFK A;  1IBL O;  1UFI A;  2XUM A;  4WFA V;  2Q7H A;  3E22 B;  2CE4 A;  3RWR D;  4G28 B;  1G6U A;  2IU3 A;  3ZBH A;  5GON A;  1BGY H;  4O4J B;  1E1R G;  1BE3 H;  3CEI A;  4JTC B;  2Q68 A;  3RT3 C;  3CME V;  2GTA A;  2YI8 A;  2FTK A;  2QWQ B;  4OGQ B;  4TUY B;  1M9N A;  1L1F A;  4UUJ C;  3RGB A;  3J80 N;  3QVN A;  1K4D C;  2LGW A;  2BSK B;  2W0X A;  2AHZ A;  3ABT A;  4X1I B;  4LF4 O;  4W4L A;  4UCU A;  4ZOL A;  1BHA A;  1KEC A;  3T1Y B;  3EFF K;  1S5H C;  1ZUQ A;  4AQY O;  3ETE A;  4O2B A;  2RQ6 A;  3VQY A;  3LDE A;  2M7W A;  3OUF A;  2QWP B;  1K92 A;  3RYC B;  1VQ4 V;  5CB4 B;  1L0L H;  3HPL C;  4WFG A;  2DJV A;  1S0V A;  4WCE V;  1TA8 A;  3UKM A;  5IWA B;  5LBQ A;  5LGU A;  5A2Q N;  4NB5 A;  1F51 A;  3CWB H;  4NKG B;  1VQP V;  4I9W A;  2EZP A;  1FYJ A;  2Y0P A;  4JI6 O;  2H3O A;  3D36 A;  5HFL A;  1R3K C;  4EEQ A;  1YHQ V;  3JAR A;  1IBM B;  3KCX A;  2ATK C;  1NR7 A;  5LMN B;  1P84 F;  2F1M A;  1XNQ B;  2H94 A;  1MG1 A;  1QCE A;  2IJJ A;  5H6R A;  1V9P A;  1VAR A;  1Y67 A;  5LMU O;  2EIJ C;  2CTP A;  1AI4 A;  4B3R O;  3B2E E;  1ZAU A;  2PZS A;  3WB1 A;  4DV6 B;  5CA3 A;  3B09 A;  4DV7 O;  4DUY B;  2EUL A;  1N8R W;  1YTF B;  1LNQ A;  1J5E B;  1NR1 A;  3VQX A;  2F4V O;  4GKJ O;  1NTK H;  4QE9 A;  2E76 B;  5HFM A;  3OTO O;  4IYI A;  5B1N A;  5BR8 O;  3BVO A;  3UCS C;  2OTJ V;  2EX3 A;  3ABM B;  3E35 A;  2QWN B;  3FX7 A;  4PDL A;  1HP8 A;  5EZY B;  4JI8 B;  1COW G;  1FXK B;  4KXR A;  4FFB B;  4DUZ B;  2OYQ A;  3FB8 C;  1YF2 A;  4FMT A;  3B8N A;  2PTM A;  3ZED A;  3SDL A;  1VQO V;  2HJF C;  3IAY A;  5LGT A;  3FAV B;  3AK2 A;  4X20 A;  1Q81 W;  2H8P C;  2NNU A;  3CSX A;  1NU1 H;  2YI9 A;  1K8A W;  1JX9 A;  4I4T A;  2PY5 A;  4ZBM A;  4MW3 A;  1S3J A;  3ASN C;  1IUR A;  2IM9 A;  1Y6X A;  4BW9 A;  2EIL C;  4X62 B;  5J2T B;  4DR1 O;  1GAX A;  1GN2 A;  1F23 A;  3LSS A;  1SS3 A;  3T1C A;  4X64 B;  1GH6 A;  3LSU A;  3HKD A;  2JIZ G;  2O57 A;  3ZMS A;  1TUB B;  2E75 B;  4DV1 O;  4JV5 B;  4X66 B;  1XMO O;  2IJK A;  4O4I B;  3AG3 C;  4UCS A;  3BCC H;  4B3M O;  3DXR B;  4J11 A;  1N32 B;  3LUT B;  2Z5U A;  2DN9 A;  4WFE A;  3RVY A;  1QVG U;  4O4L A;  1FS0 G;  4YY3 B;  1MSW D;  1D5N A;  3GWO A;  5BZB A;  2V4D A;  5LP6 A;  1Y66 A;  3LNN A;  1WP8 A;  4CC6 A;  1Y4M A;  2AGA A;  4MVR A;  3W7T A;  4U3F H;  4JI5 B;  2CK3 G;  1RFY A;  2VQF B;  5LA6 A;  4PA7 A;  1Q86 W;  3Q4H A;  3K9S A;  2R72 A;  4FLZ A;  5JVD A;  3VBB A;  1XMQ O;  3UO2 A;  4HNA B;  5LHI A;  2UXB B;  1VEW A;  1SQB H;  1VQ9 V;  2EIN C;  1GTO A;  3DC6 A;  4LP8 A;  4DR3 B;  1NS1 A;  1XBL A;  5F2V O;  4F6E A;  1NKD A;  5L3F A;  4JI1 O;  4PA4 A;  1KP2 A;  4FLW A;  1Q6I A;  3K04 A;  3M99 B;  4DR5 O;  1K7D A;  4ABM A;  2BE3 A;  2ADP A;  1JA8 A;  1VF6 A;  4GZR B;  2HVK C;  1JFF A;  1Q6H A;  4K8X A;  1V55 B;  3T4D A;  5CA0 A;  5EBM C;  4OX9 B;  2XAS A;  1H2G A;  4DR2 O;  5BMV B;  2YIC A;  4JYC A;  4CBC A;  4N21 A;  1VQ7 V;  3SPJ A;  2JVD A;  1I94 O;  4DR6 B;  3P3P A;  2UUC O;  5KMG A;  4HAM A;  4DR4 B;  1FFX A;  3AEI A;  3U10 A;  4FJC C;  4LFC B;  2DMX A;  4NTW A;  3SPH A;  4F6R B;  3T4Z A;  3N2G B;  2DW4 A;  2R9A A;  4IGG A;  1BSM A;  5B66 Z;  3AG2 C;  1YIT V;  4YIP A;  3CC7 V;  3FB6 C;  2QKC A;  3B8M A;  2A0L A;  1TAE A;  5KHI A;  3OEE G;  1IBL B;  4I7Z B;  2B1I A;  3CMA V;  3W7S A;  4FM0 A;  2UXN A;  3GWK C;  5IYD O;  4FM1 A;  5IYC O;  3CYO A;  4UV8 A;  3OE7 G;  1D2D A;  2D2C B;  2E5L O;  2Z0A A;  3D3Q A;  5KHG A;  5J2U B;  4H0L B;  4DXW A;  4UCT A;  1R3I C;  3E8F A;  4X1Y A;  3T1H O;  3KKY A;  3HKB A;  1DLB A;  1ZL8 B;  5JQG B;  4PV1 B;  4ZHQ A;  5LOV B;  5CA1 A;  3SR2 C;  4LF4 B;  3ETG A;  2LP7 A;  2YID A;  4NXM O;  1U96 A;  2JEU A;  2ZIN A;  2HKO A;  3L71 H;  4AQY B;  3UQ8 A;  3SYO A;  4LF7 O;  2GUZ A;  1VQ8 V;  4MVZ A;  2HFE C;  2ZXW B;  1NT2 B;  4ZIB A;  1AR4 A;  2M6Y A;  2YSU B;  4O4H A;  2Y69 C;  5FNV A;  4ASU G;  2BOC C;  4L8J A;  3CJH A;  5GON B;  2ZNI A;  4J9Y B;  1K97 A;  1IJG A;  1CXZ B;  4JGS A;  3AG7 A;  2QSA A;  3CRR A;  5L3C A;  3AG4 B;  4CH6 A;  1OHH G;  1WB8 A;  2OCH A;  3CHX A;  1ENV A;  3BAB A;  4JI7 B;  3D3I A;  3LNM B;  2FYU H;  4ZOL B;  1Q82 W;  4R6Z A;  2QWO B;  3STL C;  1VQ6 V;  4X9Q A;  1HNX O;  2A06 H;  4LFB O;  4O2B B;  3BFR A;  3BRC A;  2CGO A;  1XOU A;  5LYJ A;  1M57 B;  5JCO C;  3CPW U;  1AIL A;  5FPR A;  1XEQ A;  2FL4 A;  3MD0 A;  4PA9 A;  3B40 A;  3F7Y C;  1KMI Z;  2WLM A;  2UXC O;  4DV7 B;  5KX5 A;  3SJC C;  3WFV A;  5CBG A;  4U3J A;  2F4V B;  5KHH A;  4GKJ B;  3ZHQ A;  1XRE A;  4PJ0 Z;  4EFE A;  4GT1 A;  3KDR A;  3OTO B;  4AI8 A;  2AW9 A;  3AG2 B;  5BR8 B;  5KHK A;  3CCR V;  4JZ2 A;  2YEV A;  4KL1 A;  2G38 A;  4UCO A;  3OGI B;  2QA4 V;  5JH7 A;  2BOB C;  3JAR B;  2LQT A;  4LNU A;  1YCI A;  1GM7 A;  1Q7Y W;  4E2L A;  2XTA A;  4MVQ A;  1Y76 A;  5LXT A;  3FYI B;  4UXN A;  3DGE A;  1VP7 A;  1OV9 A;  2EBO A;  3ZMU A;  3OR6 C;  3OD4 A;  2GV9 A;  1KBH A;  1XI1 A;  4TQD A;  4QGP A;  2Q9L A;  1QR8 A;  2QJ1 A;  4FLU A;  1PD3 A;  2BTQ A;  1N36 B;  4MVS A;  3L75 H;  3JCZ A;  1QVF U;  4P9P A;  2OWO A;  1QU7 A;  4UB8 Z;  3JAM N;  3ZRV A;  1N33 O;  4DR1 B;  1A32 A;  4PD4 F;  3WU2 Z;  2ZM6 B;  1AI5 A;  2X0L A;  1O9G A;  5B1O A;  4LF5 B;  2BTO A;  4C7U A;  1P49 A;  2E3C A;  2C2A A;  1G8M A;  3E8B A;  1U97 A;  4LF8 O;  4B3M B;  4W4K A;  4NTY A;  2OIG A;  4B3S O;  3TET A;  2K9P A;  2A79 B;  2XND G;  1FKA O;  3CC4 V;  2WLK A;  1DF5 A;  1LUV A;  3ABM C;  2X7R B;  3I56 V;  1S72 V;  2ARH A;  2W6J G;  3K0D A;  2JGD B;  1M56 B;  2CUG A;  3CRM A;  1XQ8 A;  4MT8 A;  4X20 B;  2R9I A;  4I4T B;  2ITD C;  5JJJ B;  2GDS A;  4X1K A;  4ZI7 A;  2KG7 A;  3CCJ V;  2LFS A;  5GW7 A;  1W2B U;  1Z5V A;  3L70 H;  3EHB B;  4AIL C;  3E86 A;  3H01 A;  2Q4P A;  3L72 H;  1CP9 A;  1NI8 A;  2WWW A;  4TT3 G;  1OCC B;  5KA6 A;  4BWA A;  2QM7 A;  1S77 D;  3W7X A;  4NTX A;  3HKD B;  1ROP A;  4BIU A;  5E79 Z;  3K5L A;  2HJD A;  1XMQ B; 
#chains in the Genus database with same CATH homology
 3C3S A;  1AVM A;  1WB7 A;  1QNM A;  5AG2 A;  1N0J A;  1XUQ A;  1EM1 A;  2ADP A;  1JA8 A;  1ZTE A;  1KKC A;  1IXB A;  1AR4 A;  1GN2 A;  1MMM A;  2QKA A;  4YIO A;  3LSU A;  3MDS A;  3C3T A;  1AP6 A;  1EN4 A;  2ADQ B;  3OT7 A;  1Y67 A;  1BT8 A;  1VAR A;  4FFK A;  4E4E A;  1P7G A;  1WB8 A;  2CDY A;  1I08 A;  1IX9 A;  1D5N A;  1LUW A;  3TJT A;  1PL4 A;  2CE4 A;  4C7U A;  4BR6 A;  1BSM A;  1XDC A;  4JZG A;  1IDS A;  3CEI A;  4X9Q A;  4YIP A;  1B06 A;  2QKC A;  5A9G A;  1LUV A;  3BFR A;  3AK3 A;  1PM9 A;  3QVN A;  1BS3 A;  1ZSP A;  3EVK A;  2RCV A;  1XIL A;  1AR5 A;  1EN6 A;  1MNG A;  1N0N A;  1JR9 A;  4JYY A;  1MA1 A;  3IC9 A;  3K9S A;  4GUN A;  1ZLZ A;  2GDS A;  3DC5 A;  1GN6 A;  1ZUQ A;  1MSD A;  3AK1 A;  1VEW A;  1I0H A;  1XRE A;  1EN5 A;  3KKY A;  3DC6 A;  3KDR A;  1GN4 A;  2AW9 A;  2P4K A;  1GN3 A;  1AP5 A;  4JZ2 A;  3AK2 A;  3RN4 A;  1SZX A;  4F6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...