1KKCA

Crystal structure of aspergillus fumigatus mnsod
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
200
structure length
200
Chain Sequence
QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINWAEAENRYIAGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese Superoxide Dismutase
publication title Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
pubmed rcsb
source organism Aspergillus fumigatus
molecule tags Oxidoreductase
total genus 78
structure length 200
sequence length 200
chains with identical sequence B, X, Y
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1kkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1kkcA02
2RCVA 2GDSA 3K9SA 4JZ2A 1PM9A 1BSMA 3KKYA 1MMMA 3QVNA 1MNGA 2ADQB 1MSDA 3BFRA 1AP6A 1WB8A 1BS3A 1AR4A 3IC9A 4YIPA 1JA8A 4BR6A 1I08A 2CDYA 2ADPA 1EN6A 1ZSPA 1MA1A 1AVMA 1AR5A 1IXBA 1KKCA 2QKAA 3RN4A 4E4EA 4JZGA 1GN4A 4FFKA 1ZUQA 1XDCA 1EN4A 1XREA 1N0NA 1BT8A 3CEIA 1IX9A 1VARA 1XILA 1LUVA 1AP5A 3EVKA 1ZLZA 1XUQA 3AK3A 1P7GA 4YIOA 5A9GA 1JR9A 4JYYA 1VEWA 3AK1A 1D5NA 1GN2A 3C3TA 3LSUA 3DC5A 4X9QA 4C7UA 3OT7A 3C3SA 3MDSA 1GN6A 1SZXA 1IDSA 3DC6A 1PL4A 5AG2A 4F6EA 1Y67A 3TJTA 1QNMA 1LUWA 1ZTEA 1EN5A 1WB7A 4GUNA 1GN3A 1N0JA 2CE4A 1B06A 1EM1A 2P4KA 3AK2A 2AW9A 2QKCA 1I0HA
chains in the Genus database with same CATH superfamily
2JRIA 3K9SA 4YY3B 3ZRWA 3F7VC 2BOCC 3SJBC 2XASA 4I0XA 1NR1A 1WA8A 1DGSA 5EZYB 4X1KA 1VQOV 3M8AA 4DK0A 4KP4A 1PKXA 5EIBD 1E79G 3OM3B 1K9MW 1MA1A 1OHHG 2R9RB 3T1CA 5LGNA 4UVBA 3A2FA 4UCSA 3WFVA 4I50A 3UM7A 5IY5C 4N23A 3ZRVA 4ZOLA 4UB8Z 5J2TB 2Z3YA 3RW0A 1YSCA 3E22A 2LP7A 3RT3C 2ARHA 4EFBA 2GSMB 3ASOC 2P4VA 4MW8A 4J80A 3TCUA 5LMUO 3SPIA 1BGYH 2WA3A 2KSDA 3ZMSA 4UCRA 4X20A 1D5AA 3SYOA 4TUYA 2X6BA 1WAZA 2QM4A 1QHTA 4NYKA 5LMUB 2GHYA 2IJKA 3K58A 1XNRO 4GKKO 1DTOA 2XHBA 5GTIZ 2R9IA 3E8GA 1IVSA 2E74B 3K5LA 2CAZC 3A0HZ 2R72A 1EN5A 5LP6B 4FVMA 3N2KA 4DV3O 5E1AC 1XNRB 3TGUH 3SYPA 1GM8A 4LF9B 4GKKB 2A3QA 3GWOA 3CPWU 1Q82W 4WBNA 2XAJA 4JZ2A 4ASUG 4G27B 2OCCB 4DV3B 4MTOA 3CRMA 3JCZA 1AROP 3HPLC 5ITZB 5LYJB 1H8HG 5EBLC 3X2QB 2WLIB 2H3OA 3LDDA 2IH3C 1CXZB 3CRQA 2IM9A 2CGOA 2D3OW 3Q4HA 4B3MO 4GX5A 4DUZO 3AG4B 4BIZA 4BW5A 1H2MA 1NTKH 2LO1A 2RN9A 3OR6C 3JD1A 1EN4A 1VARA 4B3MB 4DUZB 2QA4V 1COWG 1SQBH 1QVGU 1S3JA 1GKFA 5CA1A 5GW7A 4F6RA 3P30A 2KG7A 2WLLB 2A9HA 3J80N 4UV8A 1QR9A 4I9WA 1KC8W 2EIKC 3M99B 4AHCA 3EFFK 1D5NA 3FD9A 4DR6O 1R3KC 1VQ4V 2AXTZ 1QR8A 4DV4B 4HAMA 1Y74A 5JQGA 3OD4A 1FS0G 4GT1A 2YC0A 4BIUA 1WP7A 1N8RW 4DO2A 5KX5A 2IU0A 1LNQA 1K4CC 1FFTB 3OEHG 3AEIA 3RYIA 3B8MA 3OMIB 1RM1C 1QVFU 1VF6C 3F5TA 4EFEA 1RSOB 4J7KA 1H2LA 1FFXB 4LF6O 2DN9A 2OIGA 3ASNB 4KHPB 4HZ3A 4UXNA 2CTQA 4F4LA 1MNGA 2JDIG 4DW1A 1N34O 1GTOA 4RQFA 1BHBA 4PA7A 5KAIZ 4TV8A 4DXWA 5FPOA 1AI6A 3W7SA 4LF6B 1YEWA 1DK1A 3JARA 1JPXA 1N34B 4RUFA 2ADPA 3J81N 3L70H 1XBLA 1Q86W 3WB2A 2F95B 2JGUA 5EYPB 4I4TA 1XOUA 5LXTA 4LR3A 4MW3A 2Q68A 1CPYA 5B3SC 4DW0A 4BWAA 4K8ZA 4MTGA 4CS4A 3RYHA 2PZSA 2ZE6A 1XNQO 1DLBA 4NTYA 3B4SA 3K57A 2HFEC 3RBZA 5BMVB 3CWBH 4QJFB 1K97A 1P7GA 1IXMA 3THOA 1VEWA 2DYSC 1S5JA 1XNQB 2GTAA 3DC5A 1XHXA 5L3FA 1OCCC 4AILC 3DC6A 1TVKB 4O4IA 5JVDB 1KKDA 1QNMA 4LFBB 2QDOA 2HKOA 3ZJZA 5FNVB 4CZZA 3TK1A 5JH7A 1Y76B 4HNAB 5KA5A 1OCRB 3A0RA 1L0NH 1OCZB 2P06A 1Q90D 4Q20A 2B1IA 4JYAO 1RPOA 3K5MA 3OTOO 2B1GA 4WFGA 3BFRA 4LCUC 3L75H 1BS3A 3WU2Z 1VMGA 3IAYA 3MHSC 2UUAO 4JYAB 1K33A 2DWEC 3OTOB 3RYFA 5H9CA 4RWUA 3ABMB 1H2KA 2JJ1G 4HYOA 1M4UA 4WF9V 2UUAB 3K79A 1AI7A 1HNZO 5IYZB 3B77A 1KMIZ 3OUFA 2JEUA 1ZWIC 2P67A 1YIJV 1FXKB 4OXSA 4DV1O 2YI8A 1LUVA 1OV9A 1Q6HA 4QIWF 1HNZB 2Q5ZA 4JAUA 4O2AB 3G6BA 3AG3C 5IJ0A 2W0XA 4NB5A 4DV1B 2FKXA 1OZ0A 2CK3G 1H2SB 3JASB 5FPRA 3AK1A 1B04A 1HWYA 3CCEV 5DECA 2DJVA 3IJ4A 4XBFA 2X6AA 1THZA 2IJIA 5JJEB 1SZTA 1F4MA 2PGGA 4KFMA 4DR1O 4WCEV 5CB4A 5CMUA 3CJHB 1E1RG 1EZJA 4BIOA 3D3QA 4FFBA 2Q6AA 2QM7A 1AJPA 2GV9A 3RFRA 3OFNG 3C90A 1M57C 4BAYA 5H6RA 1W59A 4X1YA 4DV7O 2RCVA 5D5PA 4JAVA 4YJ2B 3RVZA 1XMOO 3K59A 2ZXWC 2QE7G 4CH3A 3KKYA 2G38A 2KKWA 3SJCC 2ATKC 3BHPA 2ADQB 4DV7B 1R3LC 1VF6A 1ENVA 1WB8A 3BABA 4JI3O 3CXCU 2M6YA 1H5WA 1XMOB 5C8YB 1X59A 4EEQA 1FXKA 2WLJA 1FXVA 4J7JA 5J2UA 4IIJB 3H1HH 1PL0A 1SQGA 5IYDO 1YXBA 3BVOA 3I56V 3ABUA 2ETNA 1R1BA 4O2BA 4JI3B 4CC6A 2ZR2A 3K04A 3QO7A 3K9AA 4EB6A 1IXBA 1KKCA 1GN4A 1WNSA 4I55A 1K3EA 1BT8A 3JD4A 4O4JA 1K34A 5LGTA 3H1IH 3EVKA 4P30A 3ABLC 3IGAC 1M56B 1XL6A 3CRCA 3OEEG 2FMLA 3SGIA 1QQCA 1I94O 1U97A 3ZRWB 1AILA 2XAHA 2E3CA 4I0XB 1NH2B 3N27A 1WA8B 4JI2O 2PUSA 2K1EA 4JTDB 1K5QA 3R66A 4X1KB 4DV0O 1I94B 2VS0A 4C7UA 4PD4F 4LFCO 2JK5C 2P90A 1W0JG 2ZT9B 4JI2B 1EBOA 2UXCO 4NXNB 2YI9A 4U3FH 3CE2A 1JOYA 2Q9LA 2XAQA 1FXHA 2H94A 1QU7A 5BZBA 2CTRA 4DV0B 2LGQA 2EIJC 1N0JA 4TQDA 4LFCB 2VWJA 4H44B 1YJWV 4I50B 4RAIA 5B1BB 1YCIA 2QGNA 4K0KO 4ZOLB 4LF8O 3E22B 4TOIA 4BW9A 4ZI7A 2PYJA 1QLEB 5J9PC 3IC7A 5D5QA 1NR7A 2OCCC 1AJQA 3B2EE 1JFFA 2V7QG 3ZMZA 2JS3A 4X20B 4LF8B 4TUYB 5LMNO 3G67A 4DR3O 1Q8IA 3CX5F 3X2QC 2BSKA 2L35A 2Y0PA 1G6UA 3CRAA 4PDMA 1MZFA 3FFQA 1JCHA 2FL4A 4IYIA 4QE7A 3OTFA 2PTMA 5LMNB 3E2EA 4DR3B 3H1KH 4JZGA 1L8DA 3ZHVA 3ZRXA 3H1LH 1EZVH 3N2KB 1JX9A 3DGEA 4TQFA 4FM2A 2Q0OC 4WBNB 1YVWA 2YUAA 4GX2A 4A5UB 2EIMC 4GCZA 1ROPA 3AK3A 1XI1A 2L6LA 2JIZG 1S0VA 3HKEA 3UCSC 4DK1A 4KUMA 2HP8A 3BRCA 2RJZA 1M93A 2MW2B 1PD3A 2BTQB 3AG2B 2VRZA 4FMTA 3N2GA 4DYLA 5EIBC 4P2ZA 5K1XA 3Q4HB 4MVQA 5DEDA 5DN6G 4D7SA 1SA0A 1KB9F 1W2BU 3AG1C 1US6A 3M7MX 3SPHA 5LOVA 3FAVA 1VQ8V 2NN4A 1WLEA 4DV5O 5KMGA 1OJHA 5CA1B 4DR7O 4F6RB 2KG7B 5CA0A 1VF5B 3CB2A 4DR4O 3SYQA 5GONA 4JAAA 1N36O 2XAGA 3JALA 4DV5B 1NVPB 3JAKA 3I55V 1OCOB 1L1FA 1Y74B 5JQGB 4DR7B 2A7WA 2OYQA 1VQNV 2HR3A 4EKWA 1PNMA 3SYCA 4DR4B 2AHYA 4L87A 2F66C 4MVSA 1PV0A 5E79Z 3STLC 1N36B 3K03A 1LR1A 2BCCH 1YJNV 2F93B 5KX5B 1IX9A 5EBMC 3W7TA 3OE7G 2BTQA 1AP5A 3H01A 3RYIB 1S72V 2EULA 2BTOA 1ORQC 3KZIZ 1XMQO 3H1JH 3D36C 1IBKO 3T1HO 3K0GA 4OX9O 3FKSG 4CH5A 1JVMA 4TV8B 3OW2U 1XMQB 4CC5A 4YJ3A 3QF7A 3T1HB 3CC4V 3JARB 4JI4O 3OAAG 1GN6A 1BL8A 3QO5A 4OX9B 3WB1A 1IDSA 1GH6A 2OCHA 1V55B 5EBWC 2JGDA 2WLHA 4NTWA 4IHJA 4I4TB 4JI4B 5LXTB 1XQ8A 1KBHA 3T4DA 1WP8A 1ZX3A 1SQVH 2EINC 4JYCA 1QBZA 3BCCH 1OCRC 3RYHB 5H6QA 2ZE7A 5LA6A 4N21A 2GBOA 3VQVA 2E75B 4DR5O 4U7NA 5IY5B 4JI5O 2DYRB 4DR6B 4JI8O 4OGQB 4PHZA 1BE3H 5B5EZ 1PP9H 1JA8A 3ASOB 1TA8A 4DR5B 1YITV 1URFA 4GYCB 4JI5B 4Q6GA 2Y4UA 3LSSA 2ZCEA 4FLWA 4JI8B 1MSWD 2IBZH 1YJ9V 1AVMA 2QWPB 1L0LH 1AR5A 4JI0O 2XNDG 3HKCB 2HJDA 4O4IB 2QWRB 1Q43A 3RGBA 2C2AA 2RMKB 5KUKA 3CEIA 1V54C 1XILA 3K5OA 3OMAB 2YXHA 5JH7B 2UU9O 4JI0B 5KHHA 2UXDO 4K35A 4X89A 3LDCA 4ZKIA 1IBLO 2EILC 4DV6O 1FJGO 3FB5C 1H38A 3P3NA 2ODMA 4LF5O 2F1MA 1P7BA 3VQYA 3VBBA 1M90W 1GM7A 2UU9B 2UXDB 3PN1A 1PNLA 2HVKC 1IBLB 4WFHA 4DV6B 1FJGB 3C3TA 1H8EG 3SYAA 1RFYA 2DMXA 4LF5B 4Z2WA 2QWNB 4MS2A 1F7YA 1VP7A 4GX0A 4PI2A 2EX3A 3RYFB 3E8BA 3SR2C 1PL4A 5IT9N 1PPJH 1Y67A 1U96A 5JWPA 5DM6V 3TJTA 2PY5A 4UCOA 4O4LA 2HJFC 2QM8A 2YEVA 1KU9A 1WB7A 1B06A 1R73A 2CGNA 4I7ZB 2Y0IA 2RNBA 2QKCA 1I08A 1WPXA 3K08A 1BSMA 1D2DA 4MVOA 4LC1A 2FB5A 2OTJV 3U10A 2R9AA 1SQPH 3HKCA 1UFIA 4R6ZA 3BEHA 1XL4A 2WA4A 1AP6A 2XUMA 2PF4E 5IJ0B 4XDLA 1HW7A 3LNNA 4MTFA 4B3TO 1SERA 3GB7C 4BR6A 5TISZ 1Q6IA 4QNHB 4Z1MG 5FLXN 2IJJA 3ETDA 1XEQA 1ZL8A 4PI0A 2AHZA 4B3RO 4B3TB 2NNUA 1NH2D 2LGWA 3OMNB 5L3GA 2Q0AA 5CB4B 2BOBC 1R6NA 3JAMN 3L9DA 5LBQA 4U3JA 1XDCA 1J95A 4P9OA 4FFBB 1AI4A 1S5HC 1SF9A 4B3RB 2CH7A 3L71H 3HKBA 2WSSG 2RQ6A 5B1AB 4D7TA 4X1YB 4QE9A 3T1YO 2Q7GA 4D6TH 1M56C 3D8CA 5JJNB 5IWAO 1VQ9V 5EK0A 5FL7G 1Z5WA 2ZE8A 3J7AU 3UKMA 1EFRG 1E1QG 3T1YB 2Y69C 1R3IC 4FJCC 3K06A 3D36A 5J2UB 3BA9A 4PA4A 5H5NA 3PJSK 5IWAB 2N04A 4I5SA 1CEZA 2ZIMA 4DUYO 1AI5A 5AG2A 4ICGA 1GMGA 4O2BB 2XOKG 1IJGA 4AQYO 4EB6B 2CE4A 4B3SO 4CS3A 1R3JC 4MSWC 3STZC 2O57A 4O4HA 4DR2O 4I55B 4DUYB 1NT2B 3CCRV 1J5EO 4CH6A 3ETQA 5KHKA 2GDSA 1SETA 4X88A 4O4JB 4JTCB 5B1BC 3FYEB 1QLNA 2Q7EA 4MVRA 1N4CA 5C93A 4AQYB 5IE9A 4B3SB 4DR2B 2GUZA 4H37A 1J5EB 4JPRA 4DV2O 1F4NA 4LH6A 2P7TC 2W0FC 3WG7B 4YIPA 2YIDA 4KL1A 1S77D 1DF4A 3ZN1A 1SS3A 3ZN0A 4DR1B 4DRXA 1I5XA 4ZIBA 1QCEA 4HBNA 4WFBV 4DV2B 1TAEA 3DXRA 2RDCA 1K92A 2Y48A 2Q7HA 2HVJC 1I7FA 4E4EA 5K1PA 4X62O 2CUGA 1FKAO 1ZUQA 1TGOA 1IBMO 4CBCA 4X8AA 1VQPV 1VQ7V 4WFFA 3VQWA 2P22C 1TUBA 3CCMV 2QKSA 4X62B 5L3DA 2Q69A 3RVYA 4FPPA 4PA9A 4ZI7B 2PI5A 4NVPA 1JFFB 1Z2GA 1Q6UA 1YDXA 3OUSA 4FZ1A 3SJAC 2YIBA 2Z0AA 2ZR3A 3OT7A 3IFXA 2XAFA 3MDSA 3CD6V 2BSKB 3CC2V 3OR7C 1GAXA 2PYLA 3OGCC 4X65O 2UXXA 3ABKB 2GTSA 4J10A 2UXBO 4GUNA 1Q81W 5LHHA 1FAFA 4X66O 3QNEA 3QTCA 1NVPD 2ZNJA 2B9ZA 2AW9A 3JD2A 1MOFA 1Q7YW 4UB6Z 4X65B 1Q5OA 2UXBB 2ZINA 5B1NA 3G4SV 5KAFZ 4X66B 4X1IA 4FM0A 3BPZA 1H2GA 2P5OA 3TXSA 5CBHA 5LL6Y 4LFAO 5B66Z 1O9GA 4LBEC 3SPCA 3HKEB 1NS1A 5LP6C 2UXCB 4JGSA 4W4LA 3S3WA 2CTWA 3AG3B 2NLJC 4LFAB 2OWOA 1H2NA 2LQTA 3N2GB 1WJZA 2X6CA 2WLNA 4L8JA 1KECA 2VQFO 3ZHQA 1GRJA 4K0KB 4ZHQA 2LFSA 4RO2A 3CMEV 2CTPA 2EZPA 1SA0B 1K4DC 1BQ0A 4J41A 3D3IA 1SRYA 1BHAA 2VQFB 1N32O 1YTFB 5LOVB 4J42A 3FAVB 3DSQA 4TSFG 3ZIAG 3CP1A 1NU1H 1FPOA 4TWKA 4FM1A 3JAWA 5KMGB 1M57B 3AG4C 3BAAA 5CA0B 1F23A 1N32B 2DWDC 2ZXWB 4X9QA 2YDEA 5GONB 4LWSA 3JALB 2IJHA 2OTLV 3I5DA 3JSLA 3JAKB 3R65A 1SC5B 4GX1A 1SZXA 1VQLV 4FLXA 3ZS8C 1FOUA 5EC1C 1BQZA 1KUQA 4TV9A 1GN3A 1V55C 1O9HA 4W4KA 2EBOA 1NTZH 5LGUA 3MD0A 2P4KA 1WN7A 2QTSA 1N33O 3ML0A 4FLUA 1M1KW 3ZEDA 3ZHUA 4MVUA 1K8AW 2QR4A 2ZQMA 3T2MA 2ZKOA 3QVNA 2Q4PA 5KA6A 2QWOB 5L3EA 3CCVV 1N33B 5IJ9A 2DYRC 3CCUV 5GTHZ 1HDJA 3ABLB 1G8MA 1NJIW 3JATA 4J9YB 1M5IA 3ABTA 1AJNA 2DE0X 4IYHA 1SKVA 2A06H 1F51A 2JJ2G 4MVMA 4YJ3B 1UJWB 1EN6A 1FD9A 3APQA 2WLKA 2HG5C 1HNXO 2EJ7A 1HR0O 1Y4MA 4H13B 3TXQA 3ASNC 4LH7A 2K9PA 5KLVH 1Z5VA 3HB3B 2JGDB 5LHGA 3HKDA 1MZEA 4IHJB 4FZ0A 1HNXB 2W6IG 2VQEO 1HR0B 4LF9O 1IURA 5HFLA 2Q73A 3L74H 4UVAA 1JJ2U 1XUQA 1NI8A 1NZ6A 2EIJB 2E5LO 1DF5A 3CCSV 3L73H 5EZYA 5LA6B 1BMFG 2WPDG 1VQ6V 4G28B 2VQEB 4YIOA 1JR9A 1MG1A 3A0BZ 1SQFA 4K3AA 5KHGA 1GN2A 3RYCB 2ZIOA 2E5LB 4J11A 1NQTA 1X4TA 1JNBA 1V9PA 3OGIB 1KQSU 4MTXA 4ZBMA 4FLTA 5KUMA 2JEXA 1JJOA 1TUEB 2WAMA 4CH4A 5J2TA 1S76D 2R70A 3CS5A 3ZMTA 1EM1A 5CA3A 2FYUH 4E2LA 4P9PA 1IBKB 2DOSA 3CC7V 3FB6C 4QPJA 5IYBO 2JVDA 1VQ5V 3SJQC 4AI8A 4UUJC 4NXMO 2EJRA 5CBGA 4OPHA 2EIMB 2CDYA 4MT8A 5EC2C 4JI1O 4DV4O 4GLXA 1BCCH 1ZSPA 1OCZC 4JI6O 3P3PA 5LP6A 4PA6A 2XT9A 4LF7O 4NXMB 2QKAA 3ICXA 2Q67A 5JCOC 4FFKA 3UT5B 4O4LB 2YEVB 3RYCA 4JI1B 3DTUB 1FYJA 4X64O 4JI6B 4LF7B 2OIEA 2LJ2A 4B7EA 3VOUA 2LFRA 4WFEA 3QO8A 4IL6Z 2N74A 5B1AC 5ITZA 5LYJA 3ABMC 3AG1B 4X64B 1KD1W 3ETEA 2ZD9A 4RUEA 2WLIA 4KHPO 3UO3A 3CHXA 3CCQV 1P49A 1K7DA 5IYCO 2AZ2A 1P84F 2YIBD 3FYIB 3B8NA 4XDJA 1FXKC 3H9VA 3G6EV 2ZNIA 3ZHTA 4RQEA 1WPBA 1AB3A 2UXNA 3LNMB 4PDLA 4NR1A 1VF7A 4WFAV 1ZL8B 4YHHO 1JQ0A 2D2CB 3EHBB 2MK3A 1GM9A 3KCYA 2EZOA 2ILMA 3O65A 1SESA 3K0DA 3W7XA 4PA3A 4U3JB 4LNUB 1SQXH 3QG5A 3RWRD 4YHHB 2CH7B 3ZBHA 2WLLA 3BA8A 3JYCA 3O9OA 3HKBB 2X7RB 3KCXA 5B1OA 3UT5A 4J7ZA 2ZDIC 4KXRA 3UQ8A 5H2FZ 1YHQV 5KHJA 4I9QA 3SDLA 5CBFA 4K8XA 3WG7C 5CN0A 3LDEA 1AR1B 4MVZA 4IT5A 3ZHSA 1Y6XA 2LW1A 3GVMA 2JS5A 4JYBA 3U0ZA 3E89A 3RN4A 4FLVA 2QSAA 4NKGB 4PV1B 3CCJV 4YXWG 2WWWA 2DW4A 4LFBO 1N0NA 1NKDA 1UPGA 4UVCA 2YS8A 3NXSA 1RSOA 4O4HB 1FFXA 1ZLZA 2IH1C 3K3WA 3L72H 3U11A 3ZX6A 2BE3A 1HP8A 4LF4O 1R6KA 2VWKA 3EXAA 2EIKB 3KG2A 5BXZA 2GUZB 2DQ3A 4JYYA 2X0LA 2A79B 3E86A 2EINB 4LNUA 5KHIA 2WLMA 3ZRSA 4FIPC 4LF4B 5L3BA 4PELA 3W7UA 4JV5O 4UCVA 4DRXB 3JCUZ 5EYPA 2DQ0A 3DXRB 4GKJO 3G71V 4H0LB 1R6TA 1GK9A 2NR5A 2E76B 4OPAA 3ABKC 5A2QN 4FK5C 1RM1B 4JV5B 3SPJA 3AK2A 2HLDG 4GKJB 3CMAV 3ZCCA 4R8CA 3CXHF 5BMVA 4R7CA 2M7WA 1TUBB 3ZHRA 2QTOA 1MMMA 1YZBA 3LUTB 4FLZA 3MAQA 1HNWO 3NR7A 4FLYA 2YXYA 1NTMH 2B5UA 1V54B 2V1DA 2YICA 2QWQB 2Y4TA 2EILB 2KQXA 1HNWB 1YTFD 1TVKA 2F43G 1A32A 5JVDA 3E35A 2IW5A 5L3CA 2A0LA 3MHHC 5IDJA 5BY1A 5FNVA 1QLEC 5B3SB 2Z5UA 3A8TA 2QEXV 4G2KA 3VQXA 1Y76A 3E8HA 2N05A 4HNAA 4GZRB 3K5NA 3W7WA 4Z1VA 3FB7C 2F4VO 1YI2V 1KP2A 5JCOA 4R50A 4JI7O 1RPRA 1T5EA 1YF2A 2F4VB 2DYSB 4X1IB 4B08A 2YSUB 5A9GA 3GWKC 4UV9A 1Q3EA 4JI7B 2W6JG 3JD3A 2HEPA 2ITCC 1OCCB 3LSUA 2KB1A 2P6JA 3C3SA 4J9ZB 1K5SA 3CYOA 5IYZA 1IBMB 1RP3B 1ZTEA 4ABMA 1Y66A 1ZAUA 3F5WC 3KDRA 3B40A 2F23A 3E83A 2ITDC 1I5YA 3BY6A 3SPGA 4ZHQB 5HFMA 1VIBA 1VQKV 1I0HA 2UUCO 1M9NA 3LSQA 1PM9A 4O2AA 3HR0A 3TETA 4PJ0Z 4U7OA 1KP3A 4UCUA 1NBMG 1GO3F 1VQMV 3WB0A 3AG2C 3JASA 3JSNA 5LHIA 1SQQH 3B09A 1MSDA 4JASA 4QPKA 2UUCB 2OT5A 1AR4A 3IC9A 3E8FA 4H33A 2Q8VA 3JAWB 4IGGA 1BZKA 5BR8O 4LP8A 2HHHO 2ZE5A 2ZDIA 4LWSB 3CJHA 2UUBO 3UO2A 2AGAA 4CS2A 2QJ1A 2FTKA 5BR8B 2YIAA 1MABG 2Y69B 2PI4A 4NXNO 1PNKA 2HHHB 3CSXA 4TV9B 1XREA 5JJJB 4NTXA 1KYOF 3F7YC 4YJ2A 4XDKA 1S5LZ 1B3QA 5F2VO 2UUBB 1K73W 1XHZA 4QGPA 1OCOC 3APOA 3G80A 5C8YA 4PDRA 4JF3A 4IIJA 1JMKC 2H8PC 5IJ9B 3FX7A 3S3XA 1CP9A 2XTAA 3AG7A 3ZMVA 3CCLV 3JD0A 2ZM6O 3JATB 3CRRA 1IZ3A 3FB8C 1W0KG 4JTAB 4UCTA 4B7KA 3ZMUA 4F6EA 3T4ZA 4TT3G 2LW7A 1P4RA 4PDVA 1LUWA 1G1XB 1B6QA 4UFZA 4YY3O 3P32A 2IU3A 2YXLA 2ZM6B 1G4YB 2AZ0A 2V4DA 3HKDB 3ETGA
chains in the Genus database with same CATH topology
2RCVA 2GDSA 3K9SA 4JZ2A 1PM9A 1BSMA 3KKYA 1MMMA 3QVNA 1MNGA 2ADQB 1MSDA 3BFRA 1AP6A 1WB8A 1BS3A 1AR4A 3IC9A 4YIPA 1JA8A 4BR6A 1I08A 2CDYA 2ADPA 1EN6A 1ZSPA 1MA1A 1AVMA 1AR5A 1IXBA 1KKCA 2QKAA 3RN4A 4E4EA 4JZGA 1GN4A 4FFKA 1ZUQA 1XDCA 1EN4A 1XREA 1N0NA 1BT8A 3CEIA 1IX9A 1VARA 1XILA 1LUVA 1AP5A 3EVKA 1ZLZA 1XUQA 3AK3A 1P7GA 4YIOA 5A9GA 1JR9A 4JYYA 1VEWA 3AK1A 1D5NA 1GN2A 3C3TA 3LSUA 3DC5A 4X9QA 4C7UA 3OT7A 3C3SA 3MDSA 1GN6A 1SZXA 1IDSA 3DC6A 1PL4A 5AG2A 4F6EA 1Y67A 3TJTA 1QNMA 1LUWA 1ZTEA 1EN5A 1WB7A 4GUNA 1GN3A 1N0JA 2CE4A 3KDRA 1B06A 1EM1A 2P4KA 3AK2A 2AW9A 2QKCA 1I0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCV A;  2GDS A;  3K9S A;  4JZ2 A;  1PM9 A;  1BSM A;  3KKY A;  1MMM A;  3QVN A;  1MNG A;  2ADQ B;  1MSD A;  3BFR A;  1AP6 A;  1WB8 A;  1BS3 A;  1AR4 A;  3IC9 A;  4YIP A;  1JA8 A;  4BR6 A;  1I08 A;  2CDY A;  2ADP A;  1EN6 A;  1ZSP A;  1MA1 A;  1AVM A;  1AR5 A;  1IXB A;  1KKC A;  2QKA A;  3RN4 A;  4E4E A;  4JZG A;  1GN4 A;  4FFK A;  1ZUQ A;  1XDC A;  1EN4 A;  1XRE A;  1N0N A;  1BT8 A;  3CEI A;  1IX9 A;  1VAR A;  1XIL A;  1LUV A;  1AP5 A;  3EVK A;  1ZLZ A;  1XUQ A;  3AK3 A;  1P7G A;  4YIO A;  5A9G A;  1JR9 A;  4JYY A;  1VEW A;  3AK1 A;  1D5N A;  1GN2 A;  3C3T A;  3LSU A;  3DC5 A;  4X9Q A;  4C7U A;  3OT7 A;  3C3S A;  3MDS A;  1GN6 A;  1SZX A;  1IDS A;  3DC6 A;  1PL4 A;  5AG2 A;  4F6E A;  1Y67 A;  3TJT A;  1QNM A;  1LUW A;  1ZTE A;  1EN5 A;  1WB7 A;  4GUN A;  1GN3 A;  1N0J A;  2CE4 A;  1B06 A;  1EM1 A;  2P4K A;  3AK2 A;  2AW9 A;  2QKC A;  1I0H A; 
#chains in the Genus database with same CATH topology
 2JRI A;  3K9S A;  4YY3 B;  3ZRW A;  3F7V C;  2BOC C;  3SJB C;  2XAS A;  4I0X A;  1NR1 A;  1WA8 A;  1DGS A;  5EZY B;  4X1K A;  1VQO V;  3M8A A;  4DK0 A;  4KP4 A;  1PKX A;  5EIB D;  1E79 G;  3OM3 B;  1K9M W;  1MA1 A;  1OHH G;  2R9R B;  3T1C A;  5LGN A;  4UVB A;  3A2F A;  4UCS A;  3WFV A;  4I50 A;  3UM7 A;  5IY5 C;  4N23 A;  3ZRV A;  4ZOL A;  4UB8 Z;  5J2T B;  2Z3Y A;  3RW0 A;  1YSC A;  3E22 A;  2LP7 A;  3RT3 C;  2ARH A;  4EFB A;  2GSM B;  3ASO C;  2P4V A;  4MW8 A;  4J80 A;  3TCU A;  5LMU O;  3SPI A;  1BGY H;  2WA3 A;  2KSD A;  3ZMS A;  4UCR A;  4X20 A;  1D5A A;  3SYO A;  4TUY A;  2X6B A;  1WAZ A;  2QM4 A;  1QHT A;  4NYK A;  5LMU B;  2GHY A;  2IJK A;  3K58 A;  1XNR O;  4GKK O;  1DTO A;  2XHB A;  5GTI Z;  2R9I A;  3E8G A;  1IVS A;  2E74 B;  3K5L A;  2CAZ C;  3A0H Z;  2R72 A;  1EN5 A;  5LP6 B;  4FVM A;  3N2K A;  4DV3 O;  5E1A C;  1XNR B;  3TGU H;  3SYP A;  1GM8 A;  4LF9 B;  4GKK B;  2A3Q A;  3GWO A;  3CPW U;  1Q82 W;  4WBN A;  2XAJ A;  4JZ2 A;  4ASU G;  4G27 B;  2OCC B;  4DV3 B;  4MTO A;  3CRM A;  3JCZ A;  1ARO P;  3HPL C;  5ITZ B;  5LYJ B;  1H8H G;  5EBL C;  3X2Q B;  2WLI B;  2H3O A;  3LDD A;  2IH3 C;  1CXZ B;  3CRQ A;  2IM9 A;  2CGO A;  2D3O W;  3Q4H A;  4B3M O;  4GX5 A;  4DUZ O;  3AG4 B;  4BIZ A;  4BW5 A;  1H2M A;  1NTK H;  2LO1 A;  2RN9 A;  3OR6 C;  3JD1 A;  1EN4 A;  1VAR A;  4B3M B;  4DUZ B;  2QA4 V;  1COW G;  1SQB H;  1QVG U;  1S3J A;  1GKF A;  5CA1 A;  5GW7 A;  4F6R A;  3P30 A;  2KG7 A;  2WLL B;  2A9H A;  3J80 N;  4UV8 A;  1QR9 A;  4I9W A;  1KC8 W;  2EIK C;  3M99 B;  4AHC A;  3EFF K;  1D5N A;  3FD9 A;  4DR6 O;  1R3K C;  1VQ4 V;  2AXT Z;  1QR8 A;  4DV4 B;  4HAM A;  1Y74 A;  5JQG A;  3OD4 A;  1FS0 G;  4GT1 A;  2YC0 A;  4BIU A;  1WP7 A;  1N8R W;  4DO2 A;  5KX5 A;  2IU0 A;  1LNQ A;  1K4C C;  1FFT B;  3OEH G;  3AEI A;  3RYI A;  3B8M A;  3OMI B;  1RM1 C;  1QVF U;  1VF6 C;  3F5T A;  4EFE A;  1RSO B;  4J7K A;  1H2L A;  1FFX B;  4LF6 O;  2DN9 A;  2OIG A;  3ASN B;  4KHP B;  4HZ3 A;  4UXN A;  2CTQ A;  4F4L A;  1MNG A;  2JDI G;  4DW1 A;  1N34 O;  1GTO A;  4RQF A;  1BHB A;  4PA7 A;  5KAI Z;  4TV8 A;  4DXW A;  5FPO A;  1AI6 A;  3W7S A;  4LF6 B;  1YEW A;  1DK1 A;  3JAR A;  1JPX A;  1N34 B;  4RUF A;  2ADP A;  3J81 N;  3L70 H;  1XBL A;  1Q86 W;  3WB2 A;  2F95 B;  2JGU A;  5EYP B;  4I4T A;  1XOU A;  5LXT A;  4LR3 A;  4MW3 A;  2Q68 A;  1CPY A;  5B3S C;  4DW0 A;  4BWA A;  4K8Z A;  4MTG A;  4CS4 A;  3RYH A;  2PZS A;  2ZE6 A;  1XNQ O;  1DLB A;  4NTY A;  3B4S A;  3K57 A;  2HFE C;  3RBZ A;  5BMV B;  3CWB H;  4QJF B;  1K97 A;  1P7G A;  1IXM A;  3THO A;  1VEW A;  2DYS C;  1S5J A;  1XNQ B;  2GTA A;  3DC5 A;  1XHX A;  5L3F A;  1OCC C;  4AIL C;  3DC6 A;  1TVK B;  4O4I A;  5JVD B;  1KKD A;  1QNM A;  4LFB B;  2QDO A;  2HKO A;  3ZJZ A;  5FNV B;  4CZZ A;  3TK1 A;  5JH7 A;  1Y76 B;  4HNA B;  5KA5 A;  1OCR B;  3A0R A;  1L0N H;  1OCZ B;  2P06 A;  1Q90 D;  4Q20 A;  2B1I A;  4JYA O;  1RPO A;  3K5M A;  3OTO O;  2B1G A;  4WFG A;  3BFR A;  4LCU C;  3L75 H;  1BS3 A;  3WU2 Z;  1VMG A;  3IAY A;  3MHS C;  2UUA O;  4JYA B;  1K33 A;  2DWE C;  3OTO B;  3RYF A;  5H9C A;  4RWU A;  3ABM B;  1H2K A;  2JJ1 G;  4HYO A;  1M4U A;  4WF9 V;  2UUA B;  3K79 A;  1AI7 A;  1HNZ O;  5IYZ B;  3B77 A;  1KMI Z;  3OUF A;  2JEU A;  1ZWI C;  2P67 A;  1YIJ V;  1FXK B;  4OXS A;  4DV1 O;  2YI8 A;  1LUV A;  1OV9 A;  1Q6H A;  4QIW F;  1HNZ B;  2Q5Z A;  4JAU A;  4O2A B;  3G6B A;  3AG3 C;  5IJ0 A;  2W0X A;  4NB5 A;  4DV1 B;  2FKX A;  1OZ0 A;  2CK3 G;  1H2S B;  3JAS B;  5FPR A;  3AK1 A;  1B04 A;  1HWY A;  3CCE V;  5DEC A;  2DJV A;  3IJ4 A;  4XBF A;  2X6A A;  1THZ A;  2IJI A;  5JJE B;  1SZT A;  1F4M A;  2PGG A;  4KFM A;  4DR1 O;  4WCE V;  5CB4 A;  5CMU A;  3CJH B;  1E1R G;  1EZJ A;  4BIO A;  3D3Q A;  4FFB A;  2Q6A A;  2QM7 A;  1AJP A;  2GV9 A;  3RFR A;  3OFN G;  3C90 A;  1M57 C;  4BAY A;  5H6R A;  1W59 A;  4X1Y A;  4DV7 O;  2RCV A;  5D5P A;  4JAV A;  4YJ2 B;  3RVZ A;  1XMO O;  3K59 A;  2ZXW C;  2QE7 G;  4CH3 A;  3KKY A;  2G38 A;  2KKW A;  3SJC C;  2ATK C;  3BHP A;  2ADQ B;  4DV7 B;  1R3L C;  1VF6 A;  1ENV A;  1WB8 A;  3BAB A;  4JI3 O;  3CXC U;  2M6Y A;  1H5W A;  1XMO B;  5C8Y B;  1X59 A;  4EEQ A;  1FXK A;  2WLJ A;  1FXV A;  4J7J A;  5J2U A;  4IIJ B;  3H1H H;  1PL0 A;  1SQG A;  5IYD O;  1YXB A;  3BVO A;  3I56 V;  3ABU A;  2ETN A;  1R1B A;  4O2B A;  4JI3 B;  4CC6 A;  2ZR2 A;  3K04 A;  3QO7 A;  3K9A A;  4EB6 A;  1IXB A;  1KKC A;  1GN4 A;  1WNS A;  4I55 A;  1K3E A;  1BT8 A;  3JD4 A;  4O4J A;  1K34 A;  5LGT A;  3H1I H;  3EVK A;  4P30 A;  3ABL C;  3IGA C;  1M56 B;  1XL6 A;  3CRC A;  3OEE G;  2FML A;  3SGI A;  1QQC A;  1I94 O;  1U97 A;  3ZRW B;  1AIL A;  2XAH A;  2E3C A;  4I0X B;  1NH2 B;  3N27 A;  1WA8 B;  4JI2 O;  2PUS A;  2K1E A;  4JTD B;  1K5Q A;  3R66 A;  4X1K B;  4DV0 O;  1I94 B;  2VS0 A;  4C7U A;  4PD4 F;  4LFC O;  2JK5 C;  2P90 A;  1W0J G;  2ZT9 B;  4JI2 B;  1EBO A;  2UXC O;  4NXN B;  2YI9 A;  4U3F H;  3CE2 A;  1JOY A;  2Q9L A;  2XAQ A;  1FXH A;  2H94 A;  1QU7 A;  5BZB A;  2CTR A;  4DV0 B;  2LGQ A;  2EIJ C;  1N0J A;  4TQD A;  4LFC B;  2VWJ A;  4H44 B;  1YJW V;  4I50 B;  4RAI A;  5B1B B;  1YCI A;  2QGN A;  4K0K O;  4ZOL B;  4LF8 O;  3E22 B;  4TOI A;  4BW9 A;  4ZI7 A;  2PYJ A;  1QLE B;  5J9P C;  3IC7 A;  5D5Q A;  1NR7 A;  2OCC C;  1AJQ A;  3B2E E;  1JFF A;  2V7Q G;  3ZMZ A;  2JS3 A;  4X20 B;  4LF8 B;  4TUY B;  5LMN O;  3G67 A;  4DR3 O;  1Q8I A;  3CX5 F;  3X2Q C;  2BSK A;  2L35 A;  2Y0P A;  1G6U A;  3CRA A;  4PDM A;  1MZF A;  3FFQ A;  1JCH A;  2FL4 A;  4IYI A;  4QE7 A;  3OTF A;  2PTM A;  5LMN B;  3E2E A;  4DR3 B;  3H1K H;  4JZG A;  1L8D A;  3ZHV A;  3ZRX A;  3H1L H;  1EZV H;  3N2K B;  1JX9 A;  3DGE A;  4TQF A;  4FM2 A;  2Q0O C;  4WBN B;  1YVW A;  2YUA A;  4GX2 A;  4A5U B;  2EIM C;  4GCZ A;  1ROP A;  3AK3 A;  1XI1 A;  2L6L A;  2JIZ G;  1S0V A;  3HKE A;  3UCS C;  4DK1 A;  4KUM A;  2HP8 A;  3BRC A;  2RJZ A;  1M93 A;  2MW2 B;  1PD3 A;  2BTQ B;  3AG2 B;  2VRZ A;  4FMT A;  3N2G A;  4DYL A;  5EIB C;  4P2Z A;  5K1X A;  3Q4H B;  4MVQ A;  5DED A;  5DN6 G;  4D7S A;  1SA0 A;  1KB9 F;  1W2B U;  3AG1 C;  1US6 A;  3M7M X;  3SPH A;  5LOV A;  3FAV A;  1VQ8 V;  2NN4 A;  1WLE A;  4DV5 O;  5KMG A;  1OJH A;  5CA1 B;  4DR7 O;  4F6R B;  2KG7 B;  5CA0 A;  1VF5 B;  3CB2 A;  4DR4 O;  3SYQ A;  5GON A;  4JAA A;  1N36 O;  2XAG A;  3JAL A;  4DV5 B;  1NVP B;  3JAK A;  3I55 V;  1OCO B;  1L1F A;  1Y74 B;  5JQG B;  4DR7 B;  2A7W A;  2OYQ A;  1VQN V;  2HR3 A;  4EKW A;  1PNM A;  3SYC A;  4DR4 B;  2AHY A;  4L87 A;  2F66 C;  4MVS A;  1PV0 A;  5E79 Z;  3STL C;  1N36 B;  3K03 A;  1LR1 A;  2BCC H;  1YJN V;  2F93 B;  5KX5 B;  1IX9 A;  5EBM C;  3W7T A;  3OE7 G;  2BTQ A;  1AP5 A;  3H01 A;  3RYI B;  1S72 V;  2EUL A;  2BTO A;  1ORQ C;  3KZI Z;  1XMQ O;  3H1J H;  3D36 C;  1IBK O;  3T1H O;  3K0G A;  4OX9 O;  3FKS G;  4CH5 A;  1JVM A;  4TV8 B;  3OW2 U;  1XMQ B;  4CC5 A;  4YJ3 A;  3QF7 A;  3T1H B;  3CC4 V;  3JAR B;  4JI4 O;  3OAA G;  1GN6 A;  1BL8 A;  3QO5 A;  4OX9 B;  3WB1 A;  1IDS A;  1GH6 A;  2OCH A;  1V55 B;  5EBW C;  2JGD A;  2WLH A;  4NTW A;  4IHJ A;  4I4T B;  4JI4 B;  5LXT B;  1XQ8 A;  1KBH A;  3T4D A;  1WP8 A;  1ZX3 A;  1SQV H;  2EIN C;  4JYC A;  1QBZ A;  3BCC H;  1OCR C;  3RYH B;  5H6Q A;  2ZE7 A;  5LA6 A;  4N21 A;  2GBO A;  3VQV A;  2E75 B;  4DR5 O;  4U7N A;  5IY5 B;  4JI5 O;  2DYR B;  4DR6 B;  4JI8 O;  4OGQ B;  4PHZ A;  1BE3 H;  5B5E Z;  1PP9 H;  1JA8 A;  3ASO B;  1TA8 A;  4DR5 B;  1YIT V;  1URF A;  4GYC B;  4JI5 B;  4Q6G A;  2Y4U A;  3LSS A;  2ZCE A;  4FLW A;  4JI8 B;  1MSW D;  2IBZ H;  1YJ9 V;  1AVM A;  2QWP B;  1L0L H;  1AR5 A;  4JI0 O;  2XND G;  3HKC B;  2HJD A;  4O4I B;  2QWR B;  1Q43 A;  3RGB A;  2C2A A;  2RMK B;  5KUK A;  3CEI A;  1V54 C;  1XIL A;  3K5O A;  3OMA B;  2YXH A;  5JH7 B;  2UU9 O;  4JI0 B;  5KHH A;  2UXD O;  4K35 A;  4X89 A;  3LDC A;  4ZKI A;  1IBL O;  2EIL C;  4DV6 O;  1FJG O;  3FB5 C;  1H38 A;  3P3N A;  2ODM A;  4LF5 O;  2F1M A;  1P7B A;  3VQY A;  3VBB A;  1M90 W;  1GM7 A;  2UU9 B;  2UXD B;  3PN1 A;  1PNL A;  2HVK C;  1IBL B;  4WFH A;  4DV6 B;  1FJG B;  3C3T A;  1H8E G;  3SYA A;  1RFY A;  2DMX A;  4LF5 B;  4Z2W A;  2QWN B;  4MS2 A;  1F7Y A;  1VP7 A;  4GX0 A;  4PI2 A;  2EX3 A;  3RYF B;  3E8B A;  3SR2 C;  1PL4 A;  5IT9 N;  1PPJ H;  1Y67 A;  1U96 A;  5JWP A;  5DM6 V;  3TJT A;  2PY5 A;  4UCO A;  4O4L A;  2HJF C;  2QM8 A;  2YEV A;  1KU9 A;  1WB7 A;  1B06 A;  1R73 A;  2CGN A;  4I7Z B;  2Y0I A;  2RNB A;  2QKC A;  1I08 A;  1WPX A;  3K08 A;  1BSM A;  1D2D A;  4MVO A;  4LC1 A;  2FB5 A;  2OTJ V;  3U10 A;  2R9A A;  1SQP H;  3HKC A;  1UFI A;  4R6Z A;  3BEH A;  1XL4 A;  2WA4 A;  1AP6 A;  2XUM A;  2PF4 E;  5IJ0 B;  4XDL A;  1HW7 A;  3LNN A;  4MTF A;  4B3T O;  1SER A;  3GB7 C;  4BR6 A;  5TIS Z;  1Q6I A;  4QNH B;  4Z1M G;  5FLX N;  2IJJ A;  3ETD A;  1XEQ A;  1ZL8 A;  4PI0 A;  2AHZ A;  4B3R O;  4B3T B;  2NNU A;  1NH2 D;  2LGW A;  3OMN B;  5L3G A;  2Q0A A;  5CB4 B;  2BOB C;  1R6N A;  3JAM N;  3L9D A;  5LBQ A;  4U3J A;  1XDC A;  1J95 A;  4P9O A;  4FFB B;  1AI4 A;  1S5H C;  1SF9 A;  4B3R B;  2CH7 A;  3L71 H;  3HKB A;  2WSS G;  2RQ6 A;  5B1A B;  4D7T A;  4X1Y B;  4QE9 A;  3T1Y O;  2Q7G A;  4D6T H;  1M56 C;  3D8C A;  5JJN B;  5IWA O;  1VQ9 V;  5EK0 A;  5FL7 G;  1Z5W A;  2ZE8 A;  3J7A U;  3UKM A;  1EFR G;  1E1Q G;  3T1Y B;  2Y69 C;  1R3I C;  4FJC C;  3K06 A;  3D36 A;  5J2U B;  3BA9 A;  4PA4 A;  5H5N A;  3PJS K;  5IWA B;  2N04 A;  4I5S A;  1CEZ A;  2ZIM A;  4DUY O;  1AI5 A;  5AG2 A;  4ICG A;  1GMG A;  4O2B B;  2XOK G;  1IJG A;  4AQY O;  4EB6 B;  2CE4 A;  4B3S O;  4CS3 A;  1R3J C;  4MSW C;  3STZ C;  2O57 A;  4O4H A;  4DR2 O;  4I55 B;  4DUY B;  1NT2 B;  3CCR V;  1J5E O;  4CH6 A;  3ETQ A;  5KHK A;  2GDS A;  1SET A;  4X88 A;  4O4J B;  4JTC B;  5B1B C;  3FYE B;  1QLN A;  2Q7E A;  4MVR A;  1N4C A;  5C93 A;  4AQY B;  5IE9 A;  4B3S B;  4DR2 B;  2GUZ A;  4H37 A;  1J5E B;  4JPR A;  4DV2 O;  1F4N A;  4LH6 A;  2P7T C;  2W0F C;  3WG7 B;  4YIP A;  2YID A;  4KL1 A;  1S77 D;  1DF4 A;  3ZN1 A;  1SS3 A;  3ZN0 A;  4DR1 B;  4DRX A;  1I5X A;  4ZIB A;  1QCE A;  4HBN A;  4WFB V;  4DV2 B;  1TAE A;  3DXR A;  2RDC A;  1K92 A;  2Y48 A;  2Q7H A;  2HVJ C;  1I7F A;  4E4E A;  5K1P A;  4X62 O;  2CUG A;  1FKA O;  1ZUQ A;  1TGO A;  1IBM O;  4CBC A;  4X8A A;  1VQP V;  1VQ7 V;  4WFF A;  3VQW A;  2P22 C;  1TUB A;  3CCM V;  2QKS A;  4X62 B;  5L3D A;  2Q69 A;  3RVY A;  4FPP A;  4PA9 A;  4ZI7 B;  2PI5 A;  4NVP A;  1JFF B;  1Z2G A;  1Q6U A;  1YDX A;  3OUS A;  4FZ1 A;  3SJA C;  2YIB A;  2Z0A A;  2ZR3 A;  3OT7 A;  3IFX A;  2XAF A;  3MDS A;  3CD6 V;  2BSK B;  3CC2 V;  3OR7 C;  1GAX A;  2PYL A;  3OGC C;  4X65 O;  2UXX A;  3ABK B;  2GTS A;  4J10 A;  2UXB O;  4GUN A;  1Q81 W;  5LHH A;  1FAF A;  4X66 O;  3QNE A;  3QTC A;  1NVP D;  2ZNJ A;  2B9Z A;  2AW9 A;  3JD2 A;  1MOF A;  1Q7Y W;  4UB6 Z;  4X65 B;  1Q5O A;  2UXB B;  2ZIN A;  5B1N A;  3G4S V;  5KAF Z;  4X66 B;  4X1I A;  4FM0 A;  3BPZ A;  1H2G A;  2P5O A;  3TXS A;  5CBH A;  5LL6 Y;  4LFA O;  5B66 Z;  1O9G A;  4LBE C;  3SPC A;  3HKE B;  1NS1 A;  5LP6 C;  2UXC B;  4JGS A;  4W4L A;  3S3W A;  2CTW A;  3AG3 B;  2NLJ C;  4LFA B;  2OWO A;  1H2N A;  2LQT A;  3N2G B;  1WJZ A;  2X6C A;  2WLN A;  4L8J A;  1KEC A;  2VQF O;  3ZHQ A;  1GRJ A;  4K0K B;  4ZHQ A;  2LFS A;  4RO2 A;  3CME V;  2CTP A;  2EZP A;  1SA0 B;  1K4D C;  1BQ0 A;  4J41 A;  3D3I A;  1SRY A;  1BHA A;  2VQF B;  1N32 O;  1YTF B;  5LOV B;  4J42 A;  3FAV B;  3DSQ A;  4TSF G;  3ZIA G;  3CP1 A;  1NU1 H;  1FPO A;  4TWK A;  4FM1 A;  3JAW A;  5KMG B;  1M57 B;  3AG4 C;  3BAA A;  5CA0 B;  1F23 A;  1N32 B;  2DWD C;  2ZXW B;  4X9Q A;  2YDE A;  5GON B;  4LWS A;  3JAL B;  2IJH A;  2OTL V;  3I5D A;  3JSL A;  3JAK B;  3R65 A;  1SC5 B;  4GX1 A;  1SZX A;  1VQL V;  4FLX A;  3ZS8 C;  1FOU A;  5EC1 C;  1BQZ A;  1KUQ A;  4TV9 A;  1GN3 A;  1V55 C;  1O9H A;  4W4K A;  2EBO A;  1NTZ H;  5LGU A;  3MD0 A;  2P4K A;  1WN7 A;  2QTS A;  1N33 O;  3ML0 A;  4FLU A;  1M1K W;  3ZED A;  3ZHU A;  4MVU A;  1K8A W;  2QR4 A;  2ZQM A;  3T2M A;  2ZKO A;  3QVN A;  2Q4P A;  5KA6 A;  2QWO B;  5L3E A;  3CCV V;  1N33 B;  5IJ9 A;  2DYR C;  3CCU V;  5GTH Z;  1HDJ A;  3ABL B;  1G8M A;  1NJI W;  3JAT A;  4J9Y B;  1M5I A;  3ABT A;  1AJN A;  2DE0 X;  4IYH A;  1SKV A;  2A06 H;  1F51 A;  2JJ2 G;  4MVM A;  4YJ3 B;  1UJW B;  1EN6 A;  1FD9 A;  3APQ A;  2WLK A;  2HG5 C;  1HNX O;  2EJ7 A;  1HR0 O;  1Y4M A;  4H13 B;  3TXQ A;  3ASN C;  4LH7 A;  2K9P A;  5KLV H;  1Z5V A;  3HB3 B;  2JGD B;  5LHG A;  3HKD A;  1MZE A;  4IHJ B;  4FZ0 A;  1HNX B;  2W6I G;  2VQE O;  1HR0 B;  4LF9 O;  1IUR A;  5HFL A;  2Q73 A;  3L74 H;  4UVA A;  1JJ2 U;  1XUQ A;  1NI8 A;  1NZ6 A;  2EIJ B;  2E5L O;  1DF5 A;  3CCS V;  3L73 H;  5EZY A;  5LA6 B;  1BMF G;  2WPD G;  1VQ6 V;  4G28 B;  2VQE B;  4YIO A;  1JR9 A;  1MG1 A;  3A0B Z;  1SQF A;  4K3A A;  5KHG A;  1GN2 A;  3RYC B;  2ZIO A;  2E5L B;  4J11 A;  1NQT A;  1X4T A;  1JNB A;  1V9P A;  3OGI B;  1KQS U;  4MTX A;  4ZBM A;  4FLT A;  5KUM A;  2JEX A;  1JJO A;  1TUE B;  2WAM A;  4CH4 A;  5J2T A;  1S76 D;  2R70 A;  3CS5 A;  3ZMT A;  1EM1 A;  5CA3 A;  2FYU H;  4E2L A;  4P9P A;  1IBK B;  2DOS A;  3CC7 V;  3FB6 C;  4QPJ A;  5IYB O;  2JVD A;  1VQ5 V;  3SJQ C;  4AI8 A;  4UUJ C;  4NXM O;  2EJR A;  5CBG A;  4OPH A;  2EIM B;  2CDY A;  4MT8 A;  5EC2 C;  4JI1 O;  4DV4 O;  4GLX A;  1BCC H;  1ZSP A;  1OCZ C;  4JI6 O;  3P3P A;  5LP6 A;  4PA6 A;  2XT9 A;  4LF7 O;  4NXM B;  2QKA A;  3ICX A;  2Q67 A;  5JCO C;  4FFK A;  3UT5 B;  4O4L B;  2YEV B;  3RYC A;  4JI1 B;  3DTU B;  1FYJ A;  4X64 O;  4JI6 B;  4LF7 B;  2OIE A;  2LJ2 A;  4B7E A;  3VOU A;  2LFR A;  4WFE A;  3QO8 A;  4IL6 Z;  2N74 A;  5B1A C;  5ITZ A;  5LYJ A;  3ABM C;  3AG1 B;  4X64 B;  1KD1 W;  3ETE A;  2ZD9 A;  4RUE A;  2WLI A;  4KHP O;  3UO3 A;  3CHX A;  3CCQ V;  1P49 A;  1K7D A;  5IYC O;  2AZ2 A;  1P84 F;  2YIB D;  3FYI B;  3B8N A;  4XDJ A;  1FXK C;  3H9V A;  3G6E V;  2ZNI A;  3ZHT A;  4RQE A;  1WPB A;  1AB3 A;  2UXN A;  3LNM B;  4PDL A;  4NR1 A;  1VF7 A;  4WFA V;  1ZL8 B;  4YHH O;  1JQ0 A;  2D2C B;  3EHB B;  2MK3 A;  1GM9 A;  3KCY A;  2EZO A;  2ILM A;  3O65 A;  1SES A;  3K0D A;  3W7X A;  4PA3 A;  4U3J B;  4LNU B;  1SQX H;  3QG5 A;  3RWR D;  4YHH B;  2CH7 B;  3ZBH A;  2WLL A;  3BA8 A;  3JYC A;  3O9O A;  3HKB B;  2X7R B;  3KCX A;  5B1O A;  3UT5 A;  4J7Z A;  2ZDI C;  4KXR A;  3UQ8 A;  5H2F Z;  1YHQ V;  5KHJ A;  4I9Q A;  3SDL A;  5CBF A;  4K8X A;  3WG7 C;  5CN0 A;  3LDE A;  1AR1 B;  4MVZ A;  4IT5 A;  3ZHS A;  1Y6X A;  2LW1 A;  3GVM A;  2JS5 A;  4JYB A;  3U0Z A;  3E89 A;  3RN4 A;  4FLV A;  2QSA A;  4NKG B;  4PV1 B;  3CCJ V;  4YXW G;  2WWW A;  2DW4 A;  4LFB O;  1N0N A;  1NKD A;  1UPG A;  4UVC A;  2YS8 A;  3NXS A;  1RSO A;  4O4H B;  1FFX A;  1ZLZ A;  2IH1 C;  3K3W A;  3L72 H;  3U11 A;  3ZX6 A;  2BE3 A;  1HP8 A;  4LF4 O;  1R6K A;  2VWK A;  3EXA A;  2EIK B;  3KG2 A;  5BXZ A;  2GUZ B;  2DQ3 A;  4JYY A;  2X0L A;  2A79 B;  3E86 A;  2EIN B;  4LNU A;  5KHI A;  2WLM A;  3ZRS A;  4FIP C;  4LF4 B;  5L3B A;  4PEL A;  3W7U A;  4JV5 O;  4UCV A;  4DRX B;  3JCU Z;  5EYP A;  2DQ0 A;  3DXR B;  4GKJ O;  3G71 V;  4H0L B;  1R6T A;  1GK9 A;  2NR5 A;  2E76 B;  4OPA A;  3ABK C;  5A2Q N;  4FK5 C;  1RM1 B;  4JV5 B;  3SPJ A;  3AK2 A;  2HLD G;  4GKJ B;  3CMA V;  3ZCC A;  4R8C A;  3CXH F;  5BMV A;  4R7C A;  2M7W A;  1TUB B;  3ZHR A;  2QTO A;  1MMM A;  1YZB A;  3LUT B;  4FLZ A;  3MAQ A;  1HNW O;  3NR7 A;  4FLY A;  2YXY A;  1NTM H;  2B5U A;  1V54 B;  2V1D A;  2YIC A;  2QWQ B;  2Y4T A;  2EIL B;  2KQX A;  1HNW B;  1YTF D;  1TVK A;  2F43 G;  1A32 A;  5JVD A;  3E35 A;  2IW5 A;  5L3C A;  2A0L A;  3MHH C;  5IDJ A;  5BY1 A;  5FNV A;  1QLE C;  5B3S B;  2Z5U A;  3A8T A;  2QEX V;  4G2K A;  3VQX A;  1Y76 A;  3E8H A;  2N05 A;  4HNA A;  4GZR B;  3K5N A;  3W7W A;  4Z1V A;  3FB7 C;  2F4V O;  1YI2 V;  1KP2 A;  5JCO A;  4R50 A;  4JI7 O;  1RPR A;  1T5E A;  1YF2 A;  2F4V B;  2DYS B;  4X1I B;  4B08 A;  2YSU B;  5A9G A;  3GWK C;  4UV9 A;  1Q3E A;  4JI7 B;  2W6J G;  3JD3 A;  2HEP A;  2ITC C;  1OCC B;  3LSU A;  2KB1 A;  2P6J A;  3C3S A;  4J9Z B;  1K5S A;  3CYO A;  5IYZ A;  1IBM B;  1RP3 B;  1ZTE A;  4ABM A;  1Y66 A;  1ZAU A;  3F5W C;  3KDR A;  3B40 A;  2F23 A;  3E83 A;  2ITD C;  1I5Y A;  3BY6 A;  3SPG A;  4ZHQ B;  5HFM A;  1VIB A;  1VQK V;  1I0H A;  2UUC O;  1M9N A;  3LSQ A;  1PM9 A;  4O2A A;  3HR0 A;  3TET A;  4PJ0 Z;  4U7O A;  1KP3 A;  4UCU A;  1NBM G;  1GO3 F;  1VQM V;  3WB0 A;  3AG2 C;  3JAS A;  3JSN A;  5LHI A;  1SQQ H;  3B09 A;  1MSD A;  4JAS A;  4QPK A;  2UUC B;  2OT5 A;  1AR4 A;  3IC9 A;  3E8F A;  4H33 A;  2Q8V A;  3JAW B;  4IGG A;  1BZK A;  5BR8 O;  4LP8 A;  2HHH O;  2ZE5 A;  2ZDI A;  4LWS B;  3CJH A;  2UUB O;  3UO2 A;  2AGA A;  4CS2 A;  2QJ1 A;  2FTK A;  5BR8 B;  2YIA A;  1MAB G;  2Y69 B;  2PI4 A;  4NXN O;  1PNK A;  2HHH B;  3CSX A;  4TV9 B;  1XRE A;  5JJJ B;  4NTX A;  1KYO F;  3F7Y C;  4YJ2 A;  4XDK A;  1S5L Z;  1B3Q A;  5F2V O;  2UUB B;  1K73 W;  1XHZ A;  4QGP A;  1OCO C;  3APO A;  3G80 A;  5C8Y A;  4PDR A;  4JF3 A;  4IIJ A;  1JMK C;  2H8P C;  5IJ9 B;  3FX7 A;  3S3X A;  1CP9 A;  2XTA A;  3AG7 A;  3ZMV A;  3CCL V;  3JD0 A;  2ZM6 O;  3JAT B;  3CRR A;  1IZ3 A;  3FB8 C;  1W0K G;  4JTA B;  4UCT A;  4B7K A;  3ZMU A;  4F6E A;  3T4Z A;  4TT3 G;  2LW7 A;  1P4R A;  4PDV A;  1LUW A;  1G1X B;  1B6Q A;  4UFZ A;  4YY3 O;  3P32 A;  2IU3 A;  2YXL A;  2ZM6 B;  1G4Y B;  2AZ0 A;  2V4D A;  3HKD B;  3ETG A; 
#chains in the Genus database with same CATH homology
 2RCV A;  2GDS A;  3K9S A;  4JZ2 A;  1PM9 A;  1BSM A;  3KKY A;  1MMM A;  3QVN A;  1MNG A;  2ADQ B;  1MSD A;  3BFR A;  1AP6 A;  1WB8 A;  1BS3 A;  1AR4 A;  3IC9 A;  4YIP A;  1JA8 A;  4BR6 A;  1I08 A;  2CDY A;  2ADP A;  1EN6 A;  1ZSP A;  1MA1 A;  1AVM A;  1AR5 A;  1IXB A;  1KKC A;  2QKA A;  3RN4 A;  4E4E A;  4JZG A;  1GN4 A;  4FFK A;  1ZUQ A;  1XDC A;  1EN4 A;  1XRE A;  1N0N A;  1BT8 A;  3CEI A;  1IX9 A;  1VAR A;  1XIL A;  1LUV A;  1AP5 A;  3EVK A;  1ZLZ A;  1XUQ A;  3AK3 A;  1P7G A;  4YIO A;  5A9G A;  1JR9 A;  4JYY A;  1VEW A;  3AK1 A;  1D5N A;  1GN2 A;  3C3T A;  3LSU A;  3DC5 A;  4X9Q A;  4C7U A;  3OT7 A;  3C3S A;  3MDS A;  1GN6 A;  1SZX A;  1IDS A;  3DC6 A;  1PL4 A;  5AG2 A;  4F6E A;  1Y67 A;  3TJT A;  1QNM A;  1LUW A;  1ZTE A;  1EN5 A;  1WB7 A;  4GUN A;  1GN3 A;  1N0J A;  2CE4 A;  3KDR A;  1B06 A;  1EM1 A;  2P4K A;  3AK2 A;  2AW9 A;  2QKC A;  1I0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...