1KKCA

Crystal structure of aspergillus fumigatus mnsod
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
200
structure length
200
Chain Sequence
b'QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINWAEAENRYIAGDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Manganese Superoxide Dismutase
publication title Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
pubmed rcsb
source organism Aspergillus fumigatus
molecule tags Oxidoreductase
total genus 78
structure length 200
sequence length 200
chains with identical sequence B, X, Y
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1kkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1kkcA02
1BSMA 4JYYA 1AR5A 1BT8A 1EN4A 1ZUQA 3KKYA 1IDSA 1ZSPA 3C3TA 4FFKA 2P4KA 3BFRA 1GN2A 1XILA 2ADQB 1N0NA 1MNGA 3OT7A 1VEWA 1GN3A 3LSUA 1EM1A 3RN4A 2GDSA 1MA1A 1N0JA 1AP5A 1MMMA 3DC5A 1ZLZA 3C3SA 3AK1A 1ZTEA 2CDYA 4C7UA 1XREA 1LUVA 1IX9A 1I0HA 3QVNA 1P7GA 1PL4A 1WB8A 2CE4A 1D5NA 1KKCA 1IXBA 4YIPA 4GUNA 4BR6A 2QKCA 5A9GA 3K9SA 4F6EA 3CEIA 3TJTA 1VARA 1AP6A 1XUQA 1AVMA 2QKAA 1XDCA 4X9QA 1MSDA 1I08A 1WB7A 2RCVA 1JR9A 1EN6A 1QNMA 3MDSA 4JZ2A 1SZXA 1Y67A 5AG2A 3AK2A 1GN6A 3EVKA 1BS3A 2ADPA 1PM9A 1AR4A 4E4EA 1LUWA 1GN4A 3IC9A 4JZGA 1EN5A 2AW9A 4YIOA 3AK3A 3DC6A 1JA8A 1B06A
chains in the Genus database with same CATH superfamily
3H01A 4MVSA 1FKAO 1H2KA 2QM8A 3CCEV 1J95A 2LW7A 5EYPB 5IDJA 3G6EV 2OWOA 1WP8A 3STZC 4ABMA 2DWDC 3TK1A 4YY3B 3LDEA 1AR1B 1NH2B 3U10A 5ITZB 2KG7B 3BABA 1N32B 4IYIA 2GDSA 1OCRB 4E2LA 5CBHA 4F6RA 4YY3O 2XAGA 2PUSA 4YJ2B 3ABKC 2OTLV 2E3CA 2B5UA 4L8JA 4X20B 5LA6A 4FLYA 1XREA 1N32O 3ABTA 2X7RB 1OCCC 4I55A 2D2CB 1W0JG 4DR5B 4IGGA 4LF4B 1G1XB 5LHGA 1JJ2U 1SQVH 4P9OA 2RDCA 5CN0A 3K9SA 4G27B 1PNMA 4MVRA 4F6EA 2DJVA 3A0HZ 4QE9A 1L8DA 3Q4HB 2Y48A 5IYDO 4DR5O 1JJOA 5KHJA 1A32A 4LF4O 3FYEB 1V55C 4Z1MG 4YJ3A 1NQTA 1US6A 1M56C 2IU3A 4J42A 3MD0A 4JAVA 3CXHF 4TWKA 3K08A 2ZE5A 3OUFA 2WLIB 4RQFA 3RW0A 4EFEA 5HFLA 4GX5A 3LNNA 3SJAC 1YTFD 2QWPB 4JGSA 1HR0O 2BOBC 3CC4V 3ABLB 4EB6A 3L72H 2BSKB 2IH1C 4RUFA 1AI4A 1VQ5V 2CH7B 1FFXA 5TISZ 2BE3A 4AI8A 4DK1A 2N05A 1VQ9V 1RFYA 3J7AU 2JJ2G 1BHBA 3THOA 1J5EB 2AZ2A 1U96A 1BL8A 1S3JA 1SQFA 4RWUA 3T2MA 1D2DA 2Z3YA 4DV7B 4CS2A 2Q0AA 3E22A 5FPRA 3RYCA 5E79Z 2N04A 1J5EO 4J10A 1QHTA 1XEQA 3D36C 1KUQA 2UXXA 2XOKG 3QNEA 1THZA 1ZTEA 4NTYA 4DV7O 3K5MA 1IX9A 3ZRVA 1FFTB 1R3IC 1EBOA 3RGBA 4BWAA 4RQEA 2ZE6A 1M5IA 3QTCA 3JASA 3SR2C 3HPLC 4UCVA 4LF6O 1FXKC 3TJTA 1AI7A 3K3WA 2WLLB 3CC7V 5B66Z 1Q7YW 1MZFA 2EIKB 3TETA 5LA6B 3ZS8C 1Q81W 4PD4F 2ILMA 4R50A 5CB4A 2F66C 2WWWA 4I50A 3FFQA 1F7YA 2IM9A 2ZT9B 5JQGB 2XUMA 4I55B 1QBZA 5GONA 3UQ8A 5IYZA 2X6BA 5DECA 4UCOA 3T4DA 2YC0A 4H33A 2W6IG 4L87A 5EBLC 4X8AA 4NB5A 2YSUB 1N34O 4FK5C 3DC6A 1ENVA 2BTQB 1BSMA 1O9GA 2W0FC 4JYAB 4JI7B 4FLTA 3LSSA 4HNAA 1K34A 3VQWA 1GH6A 1T5EA 5B3SC 2Q73A 3CMEV 4JYAO 1RM1B 3BHPA 1K9MW 4JI7O 1YF2A 5IY5C 1KBHA 1GM7A 4DW1A 4EB6B 3JYCA 1SC5B 2K9PA 4QJFB 1Q82W 5EZYB 3OMNB 3E8GA 4UCTA 4I4TA 4MW3A 4Z1VA 1RPRA 4GT1A 4LH7A 2UXDB 1BCCH 3IC7A 3SYAA 3AG7A 3I56V 1BQZA 1DGSA 1YTFB 1AI6A 2G38A 1OCZC 2VRZA 3J81N 3ZRXA 2UXDO 3D3QA 2Y0IA 3SYQA 4GYCB 2EBOA 1OCRC 3RYCB 4UCRA 3AEIA 1VQPV 4QGPA 1AP6A 3BVOA 2ZINA 1IURA 2H3OA 1AVMA 2XAQA 2V7QG 3RYHA 2CTPA 2QR4A 5KAFZ 2QDOA 2XASA 2X6CA 1FJGB 1YJ9V 3TXSA 1YVWA 4DW0A 2JS3A 4TV8A 2R70A 1OV9A 2QTOA 3EVKA 1ZX3A 2ZIOA 1FJGO 1MG1A 1M90W 1FD9A 3OE7G 2UUBB 2VQFB 4RAIA 1RPOA 4ASUG 4ICGA 1GAXA 4UVAA 4P2ZA 2QSAA 3JCZA 4DUZB 5CB4B 4B3RB 2BTOA 3CSXA 4I50B 3TGUH 5BMVB 3E2EA 2JEXA 1FPOA 5IJ0A 4DV3B 5H9CA 1HNXB 2WPDG 2VQFO 4GKKB 5GONB 1VQNV 5IYZB 4EEQA 1R73A 3H1LH 1NTZH 4UCUA 4DUZO 3BA9A 4B3RO 4WCEV 3BPZA 5LMNB 4DV3O 3B2EE 1HNXO 1NZ6A 1X59A 3ABLC 4IT5A 4PELA 5A2QN 1K33A 1N4CA 5LMNO 2IJHA 3AG1B 2HKOA 2YI8A 4DV6B 4U7NA 1HNZB 1WJZA 2LP7A 3E35A 1PV0A 2P90A 2KSDA 4J7JA 5C8YA 4FM2A 4HAMA 5J2TA 4DV6O 1HNZO 1GM8A 4LBEC 4LF9B 2YIAA 2A9HA 4J11A 3CEIA 2QKSA 3KZIZ 3JARB 1F23A 2YDEA 5KA6A 1Q8IA 4I4TB 3ZCCA 1O9HA 3SJQC 1P49A 4LFBB 4LF9O 2C2AA 4Z2WA 4LF8B 1WPBA 4Q20A 5GTIZ 1BMFG 4JTAB 1K7DA 1SKVA 1L0NH 1Q3EA 4LFBO 4FVMA 4X62B 3FKSG 3ASOC 2A06H 4LF8O 4UCSA 3N2GB 3ICXA 2YIBD 4UV8A 3W7SA 2EINB 3JATB 2NN4A 3RYHB 1SQGA 2EIKC 1NTKH 2EJ7A 1KU9A 1Y74A 4JI4B 1S76D 2XAJA 2PYLA 1NU1H 2RMKB 4TV8B 4WFBV 1H8EG 2Z5UA 2CGNA 1BT8A 2PY5A 3MAQA 1KP2A 3OGCC 3KG2A 5LP6B 3C3TA 3ZHRA 2P4KA 3PN1A 4PV1B 5KX5A 2NLJC 1B6QA 4JI4O 2DE0X 3SGIA 5KA5A 1UJWB 2YIBA 1YXBA 2WAMA 1CPYA 1B3QA 3AG4B 1KC8W 1QR8A 3QO8A 1Y76A 1NKDA 4WFGA 3T4ZA 1OHHG 3CD6V 2R9AA 4XDKA 1HDJA 1URFA 2Z0AA 2CDYA 3DXRB 2Q5ZA 4LP8A 3JD3A 4GX2A 3H9VA 1BGYH 3UKMA 1AJPA 2GBOA 2BCCH 3UCSC 1TAEA 1RM1C 2P06A 3IAYA 3HKEA 3WG7B 2D3OW 1JQ0A 4ZHQA 4ZI7A 1XUQA 4ZIBA 4DV2B 2ZXWB 4TV9A 3G6BA 3IFXA 4KFMA 2UUAB 4BAYA 1WAZA 1SZXA 3R66A 4DV2O 4B08A 3L9DA 4MTGA 5J2TB 2AHZA 4PA3A 3CX5F 4WFFA 5B1BB 3U0ZA 2UUAO 1F51A 2DN9A 4JI8B 1GTOA 4DR7B 2R72A 3ZHSA 3W7UA 3DTUB 2CTRA 2DYSB 4WFHA 4O4IA 2YIDA 1WP7A 2CK3G 1ROPA 4X1YB 5D5QA 2WLJA 1PNKA 2P4VA 4BW9A 4JI8O 4NTXA 5BR8B 3OFNG 1DF4A 3UO3A 1TUEB 2E74B 4MTFA 4W4KA 1Q5OA 5CBGA 1GK9A 2LJ2A 2W0XA 4PDRA 3QO5A 2WLMA 5GW7A 5FNVA 3OR6C 5H6RA 1R3KC 5BR8O 2YICA 4WBNB 3RWRD 4XDJA 3ETGA 2X6AA 1MA1A 2JGDA 1FS0G 1F4NA 2Q7GA 1Y74B 3O65A 1SRYA 3JSLA 3OR7C 3A8TA 5CA0A 1OJHA 5L3CA 1P84F 4O4JB 2UXNA 1Q6IA 3GVMA 4MTOA 5LGUA 4OPAA 5KX5B 3O9OA 1GKFA 4FPPA 1IXBA 1HP8A 1NI8A 3GWOA 4CH6A 4FMTA 4LC1A 2OCHA 4TUYA 3CCUV 4O2BB 3AG1C 4IYHA 1XDCA 3ZN1A 1AJQA 3FX7A 2HLDG 2IJJA 1DLBA 1I08A 5LOVA 2VS0A 1ZL8A 4J41A 2PGGA 3OW2U 3OM3B 5C93A 1K4DC 1VQ7V 3RVYA 4PJ0Z 1KECA 5B5EZ 3SPCA 2GTAA 3B09A 4UB6Z 3ZJZA 3DGEA 3HKCA 4OPHA 3HKEB 1Q6UA 4LNUA 1R1BA 4LF5B 4ZHQB 2FMLA 3F7YC 4ZI7B 3CYOA 1NT2B 1MSWD 4TV9B 2E5LB 4UVCA 1JNBA 2GTSA 4DV4B 1VQMV 3FAVB 1GO3F 4J7ZA 4X65B 3SPIA 4LF5O 4FIPC 3ZMTA 2A0LA 1HWYA 2E75B 2YEVA 1OCOB 2E5LO 2IJIA 4DV4O 4DR3B 1KD1W 4N21A 4X65O 4PA6A 3TCUA 3H1HH 2EINC 3B77A 4CS4A 2DYRB 2DW4A 2EILB 4FFBA 4FM1A 4DR3O 1SESA 1PD3A 3FB7C 4FLWA 5CA3A 1YJNV 5DN6G 1LUVA 2ZDIA 2F95B 3G4SV 5LP6C 1WB8A 4JI0B 5FNVB 3JD2A 4LFCB 4JASA 1SZTA 1E1QG 1M57B 1I7FA 2LO1A 4DRXA 5A9GA 2IBZH 4H44B 3AG4C 3CCLV 2Q7HA 4FJCC 5FL7G 4PI2A 3S3WA 3CRRA 4LFCO 1LNQA 3KCYA 2YXHA 4B3MB 2QKAA 5CA0B 2KB1A 1AROP 1BZKA 4NR1A 4EFBA 4DV5B 4TSFG 4WFAV 1NBMG 3HKBA 2ZM6B 2JJ1G 3K79A 1NTMH 4B3MO 2LGQA 4B3TB 3L73H 4F6RB 2YI9A 4JF3A 4N23A 4DV5O 3F7VC 3WG7C 1YCIA 2F1MA 2ZM6O 3UO2A 5FPOA 1LUWA 4B3TO 2ZXWC 2DWEC 1GM9A 1JA8A 5CMUA 1VF6A 2GV9A 2CUGA 1B06A 3G67A 1ZL8B 1QVGU 4JYYA 2RQ6A 2QGNA 2KKWA 2XT9A 3F5TA 3W7WA 4J80A 3ZX6A 1MOFA 2B1IA 2NNUA 1G6UA 4LNUB 1VEWA 1Q43A 4YJ3B 2JVDA 4UFZA 3MHSC 3CCSV 2DYSC 3DC5A 4H13B 1ZLZA 2ZD9A 5IJ9A 3WB0A 4DR2B 3CB2A 2AGAA 1N8RW 3ETDA 1FOUA 1GMGA 4OX9B 2DOSA 2V4DA 3CCMV 3M99B 2ITDC 2Q4PA 4DR2O 1VIBA 3E8FA 1W2BU 2JEUA 4OX9O 1S5JA 1JFFA 3KDRA 1H38A 1XOUA 2ETNA 1JVMA 1FFXB 1V54B 1UFIA 4HBNA 2ZQMA 2X0LA 2PZSA 3AG2B 3LUTB 4KUMA 5B1AB 4KL1A 1R3JC 3B8NA 4JPRA 2QM7A 1CEZA 1I94B 1DF5A 3JSNA 2EX3A 4DRXB 5IYBO 3E22B 3HKDA 4I7ZB 5JCOA 3CE2A 1IJGA 2M6YA 4TQFA 4DUYB 1QQCA 1XHZA 1IXMA 2XNDG 1AR4A 1B04A 5DEDA 3K04A 5L3BA 2VWKA 3F5WC 1I94O 4UXNA 1SS3A 2WLNA 4CH3A 1CP9A 1L0LH 4DUYO 1NR7A 3HKBB 4TQDA 3BA8A 1EN4A 3JASB 4Q6GA 4OXSA 5LHHA 1TVKA 3ZEDA 5DM6V 2YS8A 1N0NA 1AB3A 1N36B 3CJHA 4JI3B 1SF9A 3CRQA 4DV0B 4PA4A 1GN3A 3K9AA 3ZRWA 3ZHTA 3RN4A 4MVQA 2HP8A 4MS2A 5IE9A 2HVKC 1N36O 1TUBA 4LR3A 2UUBO 2W6JG 4JI3O 3CHXA 5HFMA 4DV0O 3OGIB 4X89A 2JGUA 1I0HA 3FYIB 3VQVA 1OCOC 3D36A 2B9ZA 4IL6Z 4JTDB 5B1OA 2CE4A 1D5NA 3ML0A 4LWSA 4B3SB 4GKKO 3SPGA 1SERA 1S5LZ 2IU0A 3STLC 5BXZA 2A7WA 5IJ9B 2IH3C 2EILC 4B3SO 4IHJA 3MHHC 4GX1A 1FXKA 3VBBA 3IJ4A 4HNAB 1EZVH 1YEWA 3X2QB 3H1IH 1KKDA 3JD0A 5J2UA 2F93B 1GRJA 2ZNJA 2ATKC 1M57C 4BIZA 5L3FA 2FTKA 3SPJA 2E76B 3WB1A 3JAKA 5CA1A 5LGTA 1VQ8V 5LGNA 4W4LA 5E1AC 2BOCC 4P9PA 2XAFA 3CCVV 3EHBB 4KP4A 3OMIB 1RSOA 2Q8VA 3W7XA 2QEXV 3UT5A 4QE7A 2EJRA 3G80A 1TGOA 1RP3B 1TA8A 1HNWB 1ORQC 2WA3A 2Q68A 1FYJA 3LDDA 2PI5A 4JI2B 3HKDB 1S0VA 3B40A 3WU2Z 2HFEC 3QG5A 2UXCB 4XBFA 3JAMN 4ZBMA 1S77D 4GZRB 3D3IA 5JVDA 1HNWO 1EFRG 3EXAA 2Q7EA 4X62O 4G2KA 4FZ1A 4JI2O 3FD9A 3C3SA 3P3NA 4PDMA 1H2GA 3CXCU 2HEPA 2Q0OC 2GSMB 2UXCO 1QVFU 1Y6XA 2ZE7A 3RT3C 1K3EA 2ARHA 1IZ3A 3A0RA 3ZMVA 5KAIZ 4FLUA 2ZE8A 4NTWA 5EYPA 4BR6A 1QCEA 3ZRWB 1NVPD 3RYFA 5H6QA 3C90A 2GHYA 5IJ0B 2LW1A 2XHBA 1JMKC 1TUBB 1KP3A 4R8CA 5ITZA 4I5SA 2O57A 3K5LA 5GTHZ 4KHPB 4D7TA 5KLVH 3E89A 5LXTA 2N74A 4JZ2A 1CXZB 2EZPA 4LWSB 3ZHQA 3CMAV 1VF5B 4GLXA 3AK2A 5JJJB 3J80N 4KHPO 2AZ0A 1WA8A 3N27A 1WPXA 1V54C 4UB8Z 2HJFC 4X1IA 3IC9A 4O2AA 3AG2C 4D7SA 1H2SB 4MVZA 5B1AC 5C8YB 1WLEA 2ZDIC 1XQ8A 3CRAA 3Q4HA 1FAFA 5KHHA 4AHCA 5J2UB 2WA4A 5B1NA 3ZMUA 4O4LA 2MK3A 5BZBA 2A3QA 4XDLA 5EC1C 3JAKB 3ABMB 4QNHB 5CA1B 1EM1A 3I55V 4O4HA 3OTOB 1N0JA 4DR6B 1E79G 3GB7C 2Q6AA 4DR7O 5KUKA 3N2KA 3UT5B 2JIZG 3FB8C 2DMXA 2YXLA 1IBMB 3BY6A 3WB2A 3QVNA 2EIMB 1P7GA 4I9QA 3AG3B 1WNSA 2YXYA 4JV5B 1VQ4V 4OGQB 4WFEA 2AXTZ 4JYCA 1YIJV 4B7EA 4MSWC 1PKXA 2A79B 1IBMO 4GKJB 5JVDB 2RN9A 1M4UA 5LL6Y 3QF7A 3ZN0A 4PI0A 1P7BA 4JV5O 1OZ0A 4CC6A 1VF6C 2FKXA 5EK0A 5H2FZ 1MZEA 2OIGA 4GKJO 3ASNB 3RYIA 3JAWA 3K58A 1G8MA 4U7OA 3NR7A 3SYOA 3QO7A 1ZWIC 2Q69A 2IW5A 1Y76B 2R9IA 3RYFB 3WFVA 4MT8A 1SQBH 1PL0A 1EZJA 5KHKA 1XHXA 3B8MA 1OCZB 2QTSA 2VQEB 1QLNA 2WLKA 4TT3G 1SQXH 5KHGA 2WLLA 1SQQH 2Y69B 4BIUA 5LXTB 3X2QC 4G28B 3I5DA 1ZUQA 2UUCB 1IBLB 2H94A 1VQLV 5EIBD 5F2VO 2H8PC 1NJIW 4FFKA 3K5OA 1PP9H 2VQEO 1GN2A 3VOUA 5JQGA 1NVPB 2JRIA 1WA8B 5KMGA 2M7WA 5IYCO 3OD4A 3K06A 5EBMC 4X1IB 2UUCO 3CPWU 1IBLO 4O2AB 1UPGA 1KMIZ 2K1EA 1WN7A 3FB5C 4HYOA 3CCRV 4GX0A 3OEHG 1Q86W 2V1DA 3GWKC 1Y4MA 2ODMA 1H2NA 4O4LB 3R65A 1Q90D 2WSSG 1Y66A 1L1FA 2BTQA 5JCOC 3APOA 4YIPA 1HR0B 3NXSA 4GUNA 1IBKB 4O4IB 1XL4A 4O4HB 3RBZA 2HVJC 1VARA 2QM4A 3ETQA 4JI1B 3CP1A 4IIJA 4DK0A 1SA0A 1PPJH 4HZ3A 1NS1A 3N2KB 4JI5B 3BRCA 1IBKO 1R6TA 1XL6A 1QLEB 4I9WA 4AQYB 5L3DA 2L35A 5EZYA 1JR9A 3RVZA 4JI1O 1EN6A 1N33B 4JI5O 2WLHA 1QU7A 3P32A 3M8AA 1KB9F 2HG5C 2CTWA 2JGDB 3K57A 3ZHUA 1BS3A 4JI0O 4AQYO 3K0GA 2JK5C 4P30A 3JALA 1N33O 4E4EA 3FB6C 3L75H 3SYCA 3CWBH 2AW9A 5H5NA 4YIOA 1U97A 2ZKOA 1YZBA 3RYIB 3JAWB 3ZHVA 1JOYA 2ZR2A 1AR5A 2UU9B 3OAAG 4CBCA 1ZSPA 1XILA 3SPHA 3P3PA 4LF6B 1X4TA 2YUAA 3H1KH 4TUYB 3ABUA 3OT7A 3OTFA 4PA9A 2UU9O 2Y4TA 5LOVB 3ASOB 5JJEB 2ZNIA 1PNLA 3OMAB 2HR3A 4EKWA 4PDLA 4C7UA 2IJKA 3HKCB 4AILC 5B1BC 1PL4A 1H2MA 3T1HB 5BMVA 1XMQB 5IWAB 4RO2A 1YHQV 2PYJA 3H1JH 4NYKA 3VQYA 3A2FA 5KMGB 2VWJA 3BEHA 3ABMC 2QKCA 2P5OA 4X66B 1VQ6V 1M1KW 1S72V 5JH7A 1VMGA 1N34B 1DTOA 3T1HO 1XMQO 3S3XA 5IWAO 1G4YB 2RNBA 3SJBC 2FB5A 1JCHA 4X66O 5EC2C 2YEVB 3ETEA 2LFSA 1JPXA 2PI4A 2QWQB 1K92A 2EIMC 1QNMA 3AG3C 5L3EA 2Q9LA 3SDLA 3E86A 4X1KA 4JAAA 1H2LA 4TOIA 1GN6A 4FLZA 1VQOV 4UV9A 4FFBB 4JTCB 2ZIMA 4J9ZB 4IIJB 4JI6B 4MVUA 1SA0B 2EIJB 3DSQA 1EN5A 4PA7A 3BAAA 4ZKIA 3ASNC 1JX9A 4A5UB 2HHHB 2OCCB 1XI1A 1VP7A 3JARA 5CBFA 4MW8A 4JI6O 1AI5A 3CCJV 3KKYA 3LSQA 2OTJV 3ZMSA 2QWNB 3K59A 2ADQB 2HHHO 2GUZA 2F43G 3E83A 3JALB 3JCUZ 3LSUA 3L74H 5J9PC 1BE3H 4CH5A 4DR4B 5LYJA 1AP5A 1MMMA 1XBLA 2Q67A 1XNQB 3N2GA 4F4LA 1IVSA 5K1PA 2QJ1A 4JAUA 2Y69C 3LNMB 3JATA 2XAHA 4DR4O 1F4MA 1H8HG 5L3GA 4YHHB 1XNQO 4X88A 1KKCA 1K5QA 2P67A 4UUJC 4U3JA 3BCCH 1LR1A 5LP6A 1YJWV 1I5YA 3G71V 2QWOB 1XNRB 4YHHO 4NVPA 1ZAUA 1I5XA 1Z5VA 4FZ0A 1R6KA 1V9PA 4B7KA 4LCUC 4R7CA 1DK1A 1XNRO 3L71H 4ZOLA 2OT5A 2CTQA 3DXRA 1Z5WA 1P4RA 3M7MX 4FM0A 2DYRC 3P30A 5JH7B 4K8ZA 1M93A 4PDVA 2DQ0A 3OUSA 1YSCA 1YDXA 4FLVA 1GN4A 4DXWA 4JZGA 4H0LB 4RUEA 4MVOA 2JS5A 4H37A 4X64B 5BY1A 3K0DA 3AK3A 3ABKB 1QLEC 4FLXA 4LF7B 1FXHA 2F4VB 1JFFB 1OCCB 1K5SA 4U3FH 4X1KB 4X64O 2FL4A 3BFRA 4CZZA 4K35A 4CH4A 5K1XA 2DQ3A 1QR9A 4KXRA 3K03A 2P22C 1KQSU 4LF7O 2F4VO 1R6NA 2B1GA 1SQPH 3OEEG 2AHYA 4PHZA 3EFFK 1V55B 4QIWF 1K4CC 4QPKA 2ITCC 2LGWA 1M56B 3E8BA 3JD1A 2JDIG 3T1YB 4WF9V 4R6ZA 1W59A 4X1YA 2OIEA 1YITV 2GUZB 2NR5A 1Q6HA 2KQXA 3KCXA 4I0XA 4MVMA 2Y0PA 3T1YO 1NH2D 3HB3B 3SYPA 3TXQA 1FXVA 5LYJB 1K97A 2L6LA 2Y4UA 1W0KG 4WBNA 3RFRA 2P7TC 1TVKB 1WB7A 2QA4V 2PF4E 5LBQA 3CJHB 4DR1B 1E1RG 5LMUB 2PTMA 4O4JA 4U3JB 5AG2A 2R9RB 1PM9A 3PJSK 4QPJA 4JYBA 4MTXA 2CAZC 2KG7A 4DR1O 5LMUO 4CS3A 4DYLA 1BQ0A 4YJ2A 2LFRA 3IGAC 4X20A 5EIBC 4O2BA 2UXBB 4ZOLB 2XTAA 3ZBHA 4LFAB 2FYUH 2P6JA 1IDSA 1K73W 2LQTA 3ZRSA 1MNGA 4IHJB 5JJNB 1COWG 2UXBO 4LFAO 4BW5A 1FXKB 1SETA 3B4SA 1NR1A 2EIJC 3T1CA 3E8HA 3ZMZA 2QWRB 3APQA 1AJNA 3JD4A 3AK1A 4NXMB 2OCCC 5LHIA 1D5AA 1M9NA 4K8XA 4NKGB 4DO2A 3CRMA 4BIOA 4NXNB 3U11A 3FAVA 2CGOA 4NXMO 2WLIA 3LDCA 1YI2V 4DV1B 3ZIAG 1S5HC 1RSOB 3CCQV 4NXNO 1K8AW 1VQKV 4GCZA 1KYOF 3CC2V 5EBWC 4J7KA 2QE7G 4DV1O 2BSKA 4J9YB 3OTOO 4K0KB 4X9QA 2EULA 5KHIA 2RJZA 1MSDA 4DR6O 3A0BZ 2CH7A 1XMOB 2RCVA 2ZCEA 4LH6A 2ZR3A 3MDSA 3K5NA 3HR0A 1Y67A 3L70H 3D8CA 4K0KO 4K3AA 1VF7A 3SJCC 2HJDA 1BHAA 2ADPA 1XMOO 3CRCA 2EZOA 4I0XB 5B3SB 4CC5A 2MW2B 4UVBA 3CS5A 4D6TH 1R3LC 5IY5B 1MABG 1AILA 5JWPA 1Z2GA 5IT9N 2OYQA 1HW7A 2F23A 3UM7A 5FLXN 1H5WA 4YXWG 3VQXA 5D5PA 3W7TA 5KUMA
chains in the Genus database with same CATH topology
1BSMA 4JYYA 1AR5A 1BT8A 1EN4A 1ZUQA 3KKYA 1IDSA 1ZSPA 3C3TA 4FFKA 2P4KA 3BFRA 1GN2A 1XILA 2ADQB 1N0NA 1MNGA 3OT7A 1VEWA 1GN3A 3LSUA 1EM1A 3RN4A 2GDSA 1MA1A 1N0JA 1AP5A 1MMMA 3DC5A 1ZLZA 3C3SA 3AK1A 1ZTEA 2CDYA 4C7UA 1XREA 1LUVA 1IX9A 1I0HA 3QVNA 1P7GA 1PL4A 1WB8A 2CE4A 1D5NA 1KKCA 1IXBA 4YIPA 4GUNA 4BR6A 2QKCA 5A9GA 3KDRA 3K9SA 4F6EA 3CEIA 3TJTA 1VARA 1AP6A 1XUQA 1AVMA 2QKAA 1XDCA 4X9QA 1MSDA 1I08A 1WB7A 2RCVA 1JR9A 1EN6A 1QNMA 3MDSA 4JZ2A 1SZXA 1Y67A 5AG2A 3AK2A 1GN6A 3EVKA 1BS3A 2ADPA 1PM9A 1AR4A 4E4EA 1LUWA 1GN4A 3IC9A 4JZGA 1EN5A 2AW9A 4YIOA 3AK3A 3DC6A 1JA8A 1B06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BSM A;  4JYY A;  1AR5 A;  1BT8 A;  1EN4 A;  1ZUQ A;  3KKY A;  1IDS A;  1ZSP A;  3C3T A;  4FFK A;  2P4K A;  3BFR A;  1GN2 A;  1XIL A;  2ADQ B;  1N0N A;  1MNG A;  3OT7 A;  1VEW A;  1GN3 A;  3LSU A;  1EM1 A;  3RN4 A;  2GDS A;  1MA1 A;  1N0J A;  1AP5 A;  1MMM A;  3DC5 A;  1ZLZ A;  3C3S A;  3AK1 A;  1ZTE A;  2CDY A;  4C7U A;  1XRE A;  1LUV A;  1IX9 A;  1I0H A;  3QVN A;  1P7G A;  1PL4 A;  1WB8 A;  2CE4 A;  1D5N A;  1KKC A;  1IXB A;  4YIP A;  4GUN A;  4BR6 A;  2QKC A;  5A9G A;  3K9S A;  4F6E A;  3CEI A;  3TJT A;  1VAR A;  1AP6 A;  1XUQ A;  1AVM A;  2QKA A;  1XDC A;  4X9Q A;  1MSD A;  1I08 A;  1WB7 A;  2RCV A;  1JR9 A;  1EN6 A;  1QNM A;  3MDS A;  4JZ2 A;  1SZX A;  1Y67 A;  5AG2 A;  3AK2 A;  1GN6 A;  3EVK A;  1BS3 A;  2ADP A;  1PM9 A;  1AR4 A;  4E4E A;  1LUW A;  1GN4 A;  3IC9 A;  4JZG A;  1EN5 A;  2AW9 A;  4YIO A;  3AK3 A;  3DC6 A;  1JA8 A;  1B06 A; 
#chains in the Genus database with same CATH topology
 3H01 A;  4MVS A;  1FKA O;  1H2K A;  2QM8 A;  3CCE V;  1J95 A;  2LW7 A;  5EYP B;  5IDJ A;  3G6E V;  2OWO A;  1WP8 A;  3STZ C;  4ABM A;  2DWD C;  3TK1 A;  4YY3 B;  3LDE A;  1AR1 B;  1NH2 B;  3U10 A;  5ITZ B;  2KG7 B;  3BAB A;  1N32 B;  4IYI A;  2GDS A;  1OCR B;  4E2L A;  5CBH A;  4F6R A;  4YY3 O;  2XAG A;  2PUS A;  4YJ2 B;  3ABK C;  2OTL V;  2E3C A;  2B5U A;  4L8J A;  4X20 B;  5LA6 A;  4FLY A;  1XRE A;  1N32 O;  3ABT A;  2X7R B;  1OCC C;  4I55 A;  2D2C B;  1W0J G;  4DR5 B;  4IGG A;  4LF4 B;  1G1X B;  5LHG A;  1JJ2 U;  1SQV H;  4P9O A;  2RDC A;  5CN0 A;  3K9S A;  4G27 B;  1PNM A;  4MVR A;  4F6E A;  2DJV A;  3A0H Z;  4QE9 A;  1L8D A;  3Q4H B;  2Y48 A;  5IYD O;  4DR5 O;  1JJO A;  5KHJ A;  1A32 A;  4LF4 O;  3FYE B;  1V55 C;  4Z1M G;  4YJ3 A;  1NQT A;  1US6 A;  1M56 C;  2IU3 A;  4J42 A;  3MD0 A;  4JAV A;  3CXH F;  4TWK A;  3K08 A;  2ZE5 A;  3OUF A;  2WLI B;  4RQF A;  3RW0 A;  4EFE A;  5HFL A;  4GX5 A;  3LNN A;  3SJA C;  1YTF D;  2QWP B;  4JGS A;  1HR0 O;  2BOB C;  3CC4 V;  3ABL B;  4EB6 A;  3L72 H;  2BSK B;  2IH1 C;  4RUF A;  1AI4 A;  1VQ5 V;  2CH7 B;  1FFX A;  5TIS Z;  2BE3 A;  4AI8 A;  4DK1 A;  2N05 A;  1VQ9 V;  1RFY A;  3J7A U;  2JJ2 G;  1BHB A;  3THO A;  1J5E B;  2AZ2 A;  1U96 A;  1BL8 A;  1S3J A;  1SQF A;  4RWU A;  3T2M A;  1D2D A;  2Z3Y A;  4DV7 B;  4CS2 A;  2Q0A A;  3E22 A;  5FPR A;  3RYC A;  5E79 Z;  2N04 A;  1J5E O;  4J10 A;  1QHT A;  1XEQ A;  3D36 C;  1KUQ A;  2UXX A;  2XOK G;  3QNE A;  1THZ A;  1ZTE A;  4NTY A;  4DV7 O;  3K5M A;  1IX9 A;  3ZRV A;  1FFT B;  1R3I C;  1EBO A;  3RGB A;  4BWA A;  4RQE A;  2ZE6 A;  1M5I A;  3QTC A;  3JAS A;  3SR2 C;  3HPL C;  4UCV A;  4LF6 O;  1FXK C;  3TJT A;  1AI7 A;  3K3W A;  2WLL B;  3CC7 V;  5B66 Z;  1Q7Y W;  1MZF A;  2EIK B;  3TET A;  5LA6 B;  3ZS8 C;  1Q81 W;  4PD4 F;  2ILM A;  4R50 A;  5CB4 A;  2F66 C;  2WWW A;  4I50 A;  3FFQ A;  1F7Y A;  2IM9 A;  2ZT9 B;  5JQG B;  2XUM A;  4I55 B;  1QBZ A;  5GON A;  3UQ8 A;  5IYZ A;  2X6B A;  5DEC A;  4UCO A;  3T4D A;  2YC0 A;  4H33 A;  2W6I G;  4L87 A;  5EBL C;  4X8A A;  4NB5 A;  2YSU B;  1N34 O;  4FK5 C;  3DC6 A;  1ENV A;  2BTQ B;  1BSM A;  1O9G A;  2W0F C;  4JYA B;  4JI7 B;  4FLT A;  3LSS A;  4HNA A;  1K34 A;  3VQW A;  1GH6 A;  1T5E A;  5B3S C;  2Q73 A;  3CME V;  4JYA O;  1RM1 B;  3BHP A;  1K9M W;  4JI7 O;  1YF2 A;  5IY5 C;  1KBH A;  1GM7 A;  4DW1 A;  4EB6 B;  3JYC A;  1SC5 B;  2K9P A;  4QJF B;  1Q82 W;  5EZY B;  3OMN B;  3E8G A;  4UCT A;  4I4T A;  4MW3 A;  4Z1V A;  1RPR A;  4GT1 A;  4LH7 A;  2UXD B;  1BCC H;  3IC7 A;  3SYA A;  3AG7 A;  3I56 V;  1BQZ A;  1DGS A;  1YTF B;  1AI6 A;  2G38 A;  1OCZ C;  2VRZ A;  3J81 N;  3ZRX A;  2UXD O;  3D3Q A;  2Y0I A;  3SYQ A;  4GYC B;  2EBO A;  1OCR C;  3RYC B;  4UCR A;  3AEI A;  1VQP V;  4QGP A;  1AP6 A;  3BVO A;  2ZIN A;  1IUR A;  2H3O A;  1AVM A;  2XAQ A;  2V7Q G;  3RYH A;  2CTP A;  2QR4 A;  5KAF Z;  2QDO A;  2XAS A;  2X6C A;  1FJG B;  1YJ9 V;  3TXS A;  1YVW A;  4DW0 A;  2JS3 A;  4TV8 A;  2R70 A;  1OV9 A;  2QTO A;  3EVK A;  1ZX3 A;  2ZIO A;  1FJG O;  1MG1 A;  1M90 W;  1FD9 A;  3OE7 G;  2UUB B;  2VQF B;  4RAI A;  1RPO A;  4ASU G;  4ICG A;  1GAX A;  4UVA A;  4P2Z A;  2QSA A;  3JCZ A;  4DUZ B;  5CB4 B;  4B3R B;  2BTO A;  3CSX A;  4I50 B;  3TGU H;  5BMV B;  3E2E A;  2JEX A;  1FPO A;  5IJ0 A;  4DV3 B;  5H9C A;  1HNX B;  2WPD G;  2VQF O;  4GKK B;  5GON B;  1VQN V;  5IYZ B;  4EEQ A;  1R73 A;  3H1L H;  1NTZ H;  4UCU A;  4DUZ O;  3BA9 A;  4B3R O;  4WCE V;  3BPZ A;  5LMN B;  4DV3 O;  3B2E E;  1HNX O;  1NZ6 A;  1X59 A;  3ABL C;  4IT5 A;  4PEL A;  5A2Q N;  1K33 A;  1N4C A;  5LMN O;  2IJH A;  3AG1 B;  2HKO A;  2YI8 A;  4DV6 B;  4U7N A;  1HNZ B;  1WJZ A;  2LP7 A;  3E35 A;  1PV0 A;  2P90 A;  2KSD A;  4J7J A;  5C8Y A;  4FM2 A;  4HAM A;  5J2T A;  4DV6 O;  1HNZ O;  1GM8 A;  4LBE C;  4LF9 B;  2YIA A;  2A9H A;  4J11 A;  3CEI A;  2QKS A;  3KZI Z;  3JAR B;  1F23 A;  2YDE A;  5KA6 A;  1Q8I A;  4I4T B;  3ZCC A;  1O9H A;  3SJQ C;  1P49 A;  4LFB B;  4LF9 O;  2C2A A;  4Z2W A;  4LF8 B;  1WPB A;  4Q20 A;  5GTI Z;  1BMF G;  4JTA B;  1K7D A;  1SKV A;  1L0N H;  1Q3E A;  4LFB O;  4FVM A;  4X62 B;  3FKS G;  3ASO C;  2A06 H;  4LF8 O;  4UCS A;  3N2G B;  3ICX A;  2YIB D;  4UV8 A;  3W7S A;  2EIN B;  3JAT B;  2NN4 A;  3RYH B;  1SQG A;  2EIK C;  1NTK H;  2EJ7 A;  1KU9 A;  1Y74 A;  4JI4 B;  1S76 D;  2XAJ A;  2PYL A;  1NU1 H;  2RMK B;  4TV8 B;  4WFB V;  1H8E G;  2Z5U A;  2CGN A;  1BT8 A;  2PY5 A;  3MAQ A;  1KP2 A;  3OGC C;  3KG2 A;  5LP6 B;  3C3T A;  3ZHR A;  2P4K A;  3PN1 A;  4PV1 B;  5KX5 A;  2NLJ C;  1B6Q A;  4JI4 O;  2DE0 X;  3SGI A;  5KA5 A;  1UJW B;  2YIB A;  1YXB A;  2WAM A;  1CPY A;  1B3Q A;  3AG4 B;  1KC8 W;  1QR8 A;  3QO8 A;  1Y76 A;  1NKD A;  4WFG A;  3T4Z A;  1OHH G;  3CD6 V;  2R9A A;  4XDK A;  1HDJ A;  1URF A;  2Z0A A;  2CDY A;  3DXR B;  2Q5Z A;  4LP8 A;  3JD3 A;  4GX2 A;  3H9V A;  1BGY H;  3UKM A;  1AJP A;  2GBO A;  2BCC H;  3UCS C;  1TAE A;  1RM1 C;  2P06 A;  3IAY A;  3HKE A;  3WG7 B;  2D3O W;  1JQ0 A;  4ZHQ A;  4ZI7 A;  1XUQ A;  4ZIB A;  4DV2 B;  2ZXW B;  4TV9 A;  3G6B A;  3IFX A;  4KFM A;  2UUA B;  4BAY A;  1WAZ A;  1SZX A;  3R66 A;  4DV2 O;  4B08 A;  3L9D A;  4MTG A;  5J2T B;  2AHZ A;  4PA3 A;  3CX5 F;  4WFF A;  5B1B B;  3U0Z A;  2UUA O;  1F51 A;  2DN9 A;  4JI8 B;  1GTO A;  4DR7 B;  2R72 A;  3ZHS A;  3W7U A;  3DTU B;  2CTR A;  2DYS B;  4WFH A;  4O4I A;  2YID A;  1WP7 A;  2CK3 G;  1ROP A;  4X1Y B;  5D5Q A;  2WLJ A;  1PNK A;  2P4V A;  4BW9 A;  4JI8 O;  4NTX A;  5BR8 B;  3OFN G;  1DF4 A;  3UO3 A;  1TUE B;  2E74 B;  4MTF A;  4W4K A;  1Q5O A;  5CBG A;  1GK9 A;  2LJ2 A;  2W0X A;  4PDR A;  3QO5 A;  2WLM A;  5GW7 A;  5FNV A;  3OR6 C;  5H6R A;  1R3K C;  5BR8 O;  2YIC A;  4WBN B;  3RWR D;  4XDJ A;  3ETG A;  2X6A A;  1MA1 A;  2JGD A;  1FS0 G;  1F4N A;  2Q7G A;  1Y74 B;  3O65 A;  1SRY A;  3JSL A;  3OR7 C;  3A8T A;  5CA0 A;  1OJH A;  5L3C A;  1P84 F;  4O4J B;  2UXN A;  1Q6I A;  3GVM A;  4MTO A;  5LGU A;  4OPA A;  5KX5 B;  3O9O A;  1GKF A;  4FPP A;  1IXB A;  1HP8 A;  1NI8 A;  3GWO A;  4CH6 A;  4FMT A;  4LC1 A;  2OCH A;  4TUY A;  3CCU V;  4O2B B;  3AG1 C;  4IYH A;  1XDC A;  3ZN1 A;  1AJQ A;  3FX7 A;  2HLD G;  2IJJ A;  1DLB A;  1I08 A;  5LOV A;  2VS0 A;  1ZL8 A;  4J41 A;  2PGG A;  3OW2 U;  3OM3 B;  5C93 A;  1K4D C;  1VQ7 V;  3RVY A;  4PJ0 Z;  1KEC A;  5B5E Z;  3SPC A;  2GTA A;  3B09 A;  4UB6 Z;  3ZJZ A;  3DGE A;  3HKC A;  4OPH A;  3HKE B;  1Q6U A;  4LNU A;  1R1B A;  4LF5 B;  4ZHQ B;  2FML A;  3F7Y C;  4ZI7 B;  3CYO A;  1NT2 B;  1MSW D;  4TV9 B;  2E5L B;  4UVC A;  1JNB A;  2GTS A;  4DV4 B;  1VQM V;  3FAV B;  1GO3 F;  4J7Z A;  4X65 B;  3SPI A;  4LF5 O;  4FIP C;  3ZMT A;  2A0L A;  1HWY A;  2E75 B;  2YEV A;  1OCO B;  2E5L O;  2IJI A;  4DV4 O;  4DR3 B;  1KD1 W;  4N21 A;  4X65 O;  4PA6 A;  3TCU A;  3H1H H;  2EIN C;  3B77 A;  4CS4 A;  2DYR B;  2DW4 A;  2EIL B;  4FFB A;  4FM1 A;  4DR3 O;  1SES A;  1PD3 A;  3FB7 C;  4FLW A;  5CA3 A;  1YJN V;  5DN6 G;  1LUV A;  2ZDI A;  2F95 B;  3G4S V;  5LP6 C;  1WB8 A;  4JI0 B;  5FNV B;  3JD2 A;  4LFC B;  4JAS A;  1SZT A;  1E1Q G;  1M57 B;  1I7F A;  2LO1 A;  4DRX A;  5A9G A;  2IBZ H;  4H44 B;  3AG4 C;  3CCL V;  2Q7H A;  4FJC C;  5FL7 G;  4PI2 A;  3S3W A;  3CRR A;  4LFC O;  1LNQ A;  3KCY A;  2YXH A;  4B3M B;  2QKA A;  5CA0 B;  2KB1 A;  1ARO P;  1BZK A;  4NR1 A;  4EFB A;  4DV5 B;  4TSF G;  4WFA V;  1NBM G;  3HKB A;  2ZM6 B;  2JJ1 G;  3K79 A;  1NTM H;  4B3M O;  2LGQ A;  4B3T B;  3L73 H;  4F6R B;  2YI9 A;  4JF3 A;  4N23 A;  4DV5 O;  3F7V C;  3WG7 C;  1YCI A;  2F1M A;  2ZM6 O;  3UO2 A;  5FPO A;  1LUW A;  4B3T O;  2ZXW C;  2DWE C;  1GM9 A;  1JA8 A;  5CMU A;  1VF6 A;  2GV9 A;  2CUG A;  1B06 A;  3G67 A;  1ZL8 B;  1QVG U;  4JYY A;  2RQ6 A;  2QGN A;  2KKW A;  2XT9 A;  3F5T A;  3W7W A;  4J80 A;  3ZX6 A;  1MOF A;  2B1I A;  2NNU A;  1G6U A;  4LNU B;  1VEW A;  1Q43 A;  4YJ3 B;  2JVD A;  4UFZ A;  3MHS C;  3CCS V;  2DYS C;  3DC5 A;  4H13 B;  1ZLZ A;  2ZD9 A;  5IJ9 A;  3WB0 A;  4DR2 B;  3CB2 A;  2AGA A;  1N8R W;  3ETD A;  1FOU A;  1GMG A;  4OX9 B;  2DOS A;  2V4D A;  3CCM V;  3M99 B;  2ITD C;  2Q4P A;  4DR2 O;  1VIB A;  3E8F A;  1W2B U;  2JEU A;  4OX9 O;  1S5J A;  1JFF A;  3KDR A;  1H38 A;  1XOU A;  2ETN A;  1JVM A;  1FFX B;  1V54 B;  1UFI A;  4HBN A;  2ZQM A;  2X0L A;  2PZS A;  3AG2 B;  3LUT B;  4KUM A;  5B1A B;  4KL1 A;  1R3J C;  3B8N A;  4JPR A;  2QM7 A;  1CEZ A;  1I94 B;  1DF5 A;  3JSN A;  2EX3 A;  4DRX B;  5IYB O;  3E22 B;  3HKD A;  4I7Z B;  5JCO A;  3CE2 A;  1IJG A;  2M6Y A;  4TQF A;  4DUY B;  1QQC A;  1XHZ A;  1IXM A;  2XND G;  1AR4 A;  1B04 A;  5DED A;  3K04 A;  5L3B A;  2VWK A;  3F5W C;  1I94 O;  4UXN A;  1SS3 A;  2WLN A;  4CH3 A;  1CP9 A;  1L0L H;  4DUY O;  1NR7 A;  3HKB B;  4TQD A;  3BA8 A;  1EN4 A;  3JAS B;  4Q6G A;  4OXS A;  5LHH A;  1TVK A;  3ZED A;  5DM6 V;  2YS8 A;  1N0N A;  1AB3 A;  1N36 B;  3CJH A;  4JI3 B;  1SF9 A;  3CRQ A;  4DV0 B;  4PA4 A;  1GN3 A;  3K9A A;  3ZRW A;  3ZHT A;  3RN4 A;  4MVQ A;  2HP8 A;  4MS2 A;  5IE9 A;  2HVK C;  1N36 O;  1TUB A;  4LR3 A;  2UUB O;  2W6J G;  4JI3 O;  3CHX A;  5HFM A;  4DV0 O;  3OGI B;  4X89 A;  2JGU A;  1I0H A;  3FYI B;  3VQV A;  1OCO C;  3D36 A;  2B9Z A;  4IL6 Z;  4JTD B;  5B1O A;  2CE4 A;  1D5N A;  3ML0 A;  4LWS A;  4B3S B;  4GKK O;  3SPG A;  1SER A;  1S5L Z;  2IU0 A;  3STL C;  5BXZ A;  2A7W A;  5IJ9 B;  2IH3 C;  2EIL C;  4B3S O;  4IHJ A;  3MHH C;  4GX1 A;  1FXK A;  3VBB A;  3IJ4 A;  4HNA B;  1EZV H;  1YEW A;  3X2Q B;  3H1I H;  1KKD A;  3JD0 A;  5J2U A;  2F93 B;  1GRJ A;  2ZNJ A;  2ATK C;  1M57 C;  4BIZ A;  5L3F A;  2FTK A;  3SPJ A;  2E76 B;  3WB1 A;  3JAK A;  5CA1 A;  5LGT A;  1VQ8 V;  5LGN A;  4W4L A;  5E1A C;  2BOC C;  4P9P A;  2XAF A;  3CCV V;  3EHB B;  4KP4 A;  3OMI B;  1RSO A;  2Q8V A;  3W7X A;  2QEX V;  3UT5 A;  4QE7 A;  2EJR A;  3G80 A;  1TGO A;  1RP3 B;  1TA8 A;  1HNW B;  1ORQ C;  2WA3 A;  2Q68 A;  1FYJ A;  3LDD A;  2PI5 A;  4JI2 B;  3HKD B;  1S0V A;  3B40 A;  3WU2 Z;  2HFE C;  3QG5 A;  2UXC B;  4XBF A;  3JAM N;  4ZBM A;  1S77 D;  4GZR B;  3D3I A;  5JVD A;  1HNW O;  1EFR G;  3EXA A;  2Q7E A;  4X62 O;  4G2K A;  4FZ1 A;  4JI2 O;  3FD9 A;  3C3S A;  3P3N A;  4PDM A;  1H2G A;  3CXC U;  2HEP A;  2Q0O C;  2GSM B;  2UXC O;  1QVF U;  1Y6X A;  2ZE7 A;  3RT3 C;  1K3E A;  2ARH A;  1IZ3 A;  3A0R A;  3ZMV A;  5KAI Z;  4FLU A;  2ZE8 A;  4NTW A;  5EYP A;  4BR6 A;  1QCE A;  3ZRW B;  1NVP D;  3RYF A;  5H6Q A;  3C90 A;  2GHY A;  5IJ0 B;  2LW1 A;  2XHB A;  1JMK C;  1TUB B;  1KP3 A;  4R8C A;  5ITZ A;  4I5S A;  2O57 A;  3K5L A;  5GTH Z;  4KHP B;  4D7T A;  5KLV H;  3E89 A;  5LXT A;  2N74 A;  4JZ2 A;  1CXZ B;  2EZP A;  4LWS B;  3ZHQ A;  3CMA V;  1VF5 B;  4GLX A;  3AK2 A;  5JJJ B;  3J80 N;  4KHP O;  2AZ0 A;  1WA8 A;  3N27 A;  1WPX A;  1V54 C;  4UB8 Z;  2HJF C;  4X1I A;  3IC9 A;  4O2A A;  3AG2 C;  4D7S A;  1H2S B;  4MVZ A;  5B1A C;  5C8Y B;  1WLE A;  2ZDI C;  1XQ8 A;  3CRA A;  3Q4H A;  1FAF A;  5KHH A;  4AHC A;  5J2U B;  2WA4 A;  5B1N A;  3ZMU A;  4O4L A;  2MK3 A;  5BZB A;  2A3Q A;  4XDL A;  5EC1 C;  3JAK B;  3ABM B;  4QNH B;  5CA1 B;  1EM1 A;  3I55 V;  4O4H A;  3OTO B;  1N0J A;  4DR6 B;  1E79 G;  3GB7 C;  2Q6A A;  4DR7 O;  5KUK A;  3N2K A;  3UT5 B;  2JIZ G;  3FB8 C;  2DMX A;  2YXL A;  1IBM B;  3BY6 A;  3WB2 A;  3QVN A;  2EIM B;  1P7G A;  4I9Q A;  3AG3 B;  1WNS A;  2YXY A;  4JV5 B;  1VQ4 V;  4OGQ B;  4WFE A;  2AXT Z;  4JYC A;  1YIJ V;  4B7E A;  4MSW C;  1PKX A;  2A79 B;  1IBM O;  4GKJ B;  5JVD B;  2RN9 A;  1M4U A;  5LL6 Y;  3QF7 A;  3ZN0 A;  4PI0 A;  1P7B A;  4JV5 O;  1OZ0 A;  4CC6 A;  1VF6 C;  2FKX A;  5EK0 A;  5H2F Z;  1MZE A;  2OIG A;  4GKJ O;  3ASN B;  3RYI A;  3JAW A;  3K58 A;  1G8M A;  4U7O A;  3NR7 A;  3SYO A;  3QO7 A;  1ZWI C;  2Q69 A;  2IW5 A;  1Y76 B;  2R9I A;  3RYF B;  3WFV A;  4MT8 A;  1SQB H;  1PL0 A;  1EZJ A;  5KHK A;  1XHX A;  3B8M A;  1OCZ B;  2QTS A;  2VQE B;  1QLN A;  2WLK A;  4TT3 G;  1SQX H;  5KHG A;  2WLL A;  1SQQ H;  2Y69 B;  4BIU A;  5LXT B;  3X2Q C;  4G28 B;  3I5D A;  1ZUQ A;  2UUC B;  1IBL B;  2H94 A;  1VQL V;  5EIB D;  5F2V O;  2H8P C;  1NJI W;  4FFK A;  3K5O A;  1PP9 H;  2VQE O;  1GN2 A;  3VOU A;  5JQG A;  1NVP B;  2JRI A;  1WA8 B;  5KMG A;  2M7W A;  5IYC O;  3OD4 A;  3K06 A;  5EBM C;  4X1I B;  2UUC O;  3CPW U;  1IBL O;  4O2A B;  1UPG A;  1KMI Z;  2K1E A;  1WN7 A;  3FB5 C;  4HYO A;  3CCR V;  4GX0 A;  3OEH G;  1Q86 W;  2V1D A;  3GWK C;  1Y4M A;  2ODM A;  1H2N A;  4O4L B;  3R65 A;  1Q90 D;  2WSS G;  1Y66 A;  1L1F A;  2BTQ A;  5JCO C;  3APO A;  4YIP A;  1HR0 B;  3NXS A;  4GUN A;  1IBK B;  4O4I B;  1XL4 A;  4O4H B;  3RBZ A;  2HVJ C;  1VAR A;  2QM4 A;  3ETQ A;  4JI1 B;  3CP1 A;  4IIJ A;  4DK0 A;  1SA0 A;  1PPJ H;  4HZ3 A;  1NS1 A;  3N2K B;  4JI5 B;  3BRC A;  1IBK O;  1R6T A;  1XL6 A;  1QLE B;  4I9W A;  4AQY B;  5L3D A;  2L35 A;  5EZY A;  1JR9 A;  3RVZ A;  4JI1 O;  1EN6 A;  1N33 B;  4JI5 O;  2WLH A;  1QU7 A;  3P32 A;  3M8A A;  1KB9 F;  2HG5 C;  2CTW A;  2JGD B;  3K57 A;  3ZHU A;  1BS3 A;  4JI0 O;  4AQY O;  3K0G A;  2JK5 C;  4P30 A;  3JAL A;  1N33 O;  4E4E A;  3FB6 C;  3L75 H;  3SYC A;  3CWB H;  2AW9 A;  5H5N A;  4YIO A;  1U97 A;  2ZKO A;  1YZB A;  3RYI B;  3JAW B;  3ZHV A;  1JOY A;  2ZR2 A;  1AR5 A;  2UU9 B;  3OAA G;  4CBC A;  1ZSP A;  1XIL A;  3SPH A;  3P3P A;  4LF6 B;  1X4T A;  2YUA A;  3H1K H;  4TUY B;  3ABU A;  3OT7 A;  3OTF A;  4PA9 A;  2UU9 O;  2Y4T A;  5LOV B;  3ASO B;  5JJE B;  2ZNI A;  1PNL A;  3OMA B;  2HR3 A;  4EKW A;  4PDL A;  4C7U A;  2IJK A;  3HKC B;  4AIL C;  5B1B C;  1PL4 A;  1H2M A;  3T1H B;  5BMV A;  1XMQ B;  5IWA B;  4RO2 A;  1YHQ V;  2PYJ A;  3H1J H;  4NYK A;  3VQY A;  3A2F A;  5KMG B;  2VWJ A;  3BEH A;  3ABM C;  2QKC A;  2P5O A;  4X66 B;  1VQ6 V;  1M1K W;  1S72 V;  5JH7 A;  1VMG A;  1N34 B;  1DTO A;  3T1H O;  1XMQ O;  3S3X A;  5IWA O;  1G4Y B;  2RNB A;  3SJB C;  2FB5 A;  1JCH A;  4X66 O;  5EC2 C;  2YEV B;  3ETE A;  2LFS A;  1JPX A;  2PI4 A;  2QWQ B;  1K92 A;  2EIM C;  1QNM A;  3AG3 C;  5L3E A;  2Q9L A;  3SDL A;  3E86 A;  4X1K A;  4JAA A;  1H2L A;  4TOI A;  1GN6 A;  4FLZ A;  1VQO V;  4UV9 A;  4FFB B;  4JTC B;  2ZIM A;  4J9Z B;  4IIJ B;  4JI6 B;  4MVU A;  1SA0 B;  2EIJ B;  3DSQ A;  1EN5 A;  4PA7 A;  3BAA A;  4ZKI A;  3ASN C;  1JX9 A;  4A5U B;  2HHH B;  2OCC B;  1XI1 A;  1VP7 A;  3JAR A;  5CBF A;  4MW8 A;  4JI6 O;  1AI5 A;  3CCJ V;  3KKY A;  3LSQ A;  2OTJ V;  3ZMS A;  2QWN B;  3K59 A;  2ADQ B;  2HHH O;  2GUZ A;  2F43 G;  3E83 A;  3JAL B;  3JCU Z;  3LSU A;  3L74 H;  5J9P C;  1BE3 H;  4CH5 A;  4DR4 B;  5LYJ A;  1AP5 A;  1MMM A;  1XBL A;  2Q67 A;  1XNQ B;  3N2G A;  4F4L A;  1IVS A;  5K1P A;  2QJ1 A;  4JAU A;  2Y69 C;  3LNM B;  3JAT A;  2XAH A;  4DR4 O;  1F4M A;  1H8H G;  5L3G A;  4YHH B;  1XNQ O;  4X88 A;  1KKC A;  1K5Q A;  2P67 A;  4UUJ C;  4U3J A;  3BCC H;  1LR1 A;  5LP6 A;  1YJW V;  1I5Y A;  3G71 V;  2QWO B;  1XNR B;  4YHH O;  4NVP A;  1ZAU A;  1I5X A;  1Z5V A;  4FZ0 A;  1R6K A;  1V9P A;  4B7K A;  4LCU C;  4R7C A;  1DK1 A;  1XNR O;  3L71 H;  4ZOL A;  2OT5 A;  2CTQ A;  3DXR A;  1Z5W A;  1P4R A;  3M7M X;  4FM0 A;  2DYR C;  3P30 A;  5JH7 B;  4K8Z A;  1M93 A;  4PDV A;  2DQ0 A;  3OUS A;  1YSC A;  1YDX A;  4FLV A;  1GN4 A;  4DXW A;  4JZG A;  4H0L B;  4RUE A;  4MVO A;  2JS5 A;  4H37 A;  4X64 B;  5BY1 A;  3K0D A;  3AK3 A;  3ABK B;  1QLE C;  4FLX A;  4LF7 B;  1FXH A;  2F4V B;  1JFF B;  1OCC B;  1K5S A;  4U3F H;  4X1K B;  4X64 O;  2FL4 A;  3BFR A;  4CZZ A;  4K35 A;  4CH4 A;  5K1X A;  2DQ3 A;  1QR9 A;  4KXR A;  3K03 A;  2P22 C;  1KQS U;  4LF7 O;  2F4V O;  1R6N A;  2B1G A;  1SQP H;  3OEE G;  2AHY A;  4PHZ A;  3EFF K;  1V55 B;  4QIW F;  1K4C C;  4QPK A;  2ITC C;  2LGW A;  1M56 B;  3E8B A;  3JD1 A;  2JDI G;  3T1Y B;  4WF9 V;  4R6Z A;  1W59 A;  4X1Y A;  2OIE A;  1YIT V;  2GUZ B;  2NR5 A;  1Q6H A;  2KQX A;  3KCX A;  4I0X A;  4MVM A;  2Y0P A;  3T1Y O;  1NH2 D;  3HB3 B;  3SYP A;  3TXQ A;  1FXV A;  5LYJ B;  1K97 A;  2L6L A;  2Y4U A;  1W0K G;  4WBN A;  3RFR A;  2P7T C;  1TVK B;  1WB7 A;  2QA4 V;  2PF4 E;  5LBQ A;  3CJH B;  4DR1 B;  1E1R G;  5LMU B;  2PTM A;  4O4J A;  4U3J B;  5AG2 A;  2R9R B;  1PM9 A;  3PJS K;  4QPJ A;  4JYB A;  4MTX A;  2CAZ C;  2KG7 A;  4DR1 O;  5LMU O;  4CS3 A;  4DYL A;  1BQ0 A;  4YJ2 A;  2LFR A;  3IGA C;  4X20 A;  5EIB C;  4O2B A;  2UXB B;  4ZOL B;  2XTA A;  3ZBH A;  4LFA B;  2FYU H;  2P6J A;  1IDS A;  1K73 W;  2LQT A;  3ZRS A;  1MNG A;  4IHJ B;  5JJN B;  1COW G;  2UXB O;  4LFA O;  4BW5 A;  1FXK B;  1SET A;  3B4S A;  1NR1 A;  2EIJ C;  3T1C A;  3E8H A;  3ZMZ A;  2QWR B;  3APQ A;  1AJN A;  3JD4 A;  3AK1 A;  4NXM B;  2OCC C;  5LHI A;  1D5A A;  1M9N A;  4K8X A;  4NKG B;  4DO2 A;  3CRM A;  4BIO A;  4NXN B;  3U11 A;  3FAV A;  2CGO A;  4NXM O;  2WLI A;  3LDC A;  1YI2 V;  4DV1 B;  3ZIA G;  1S5H C;  1RSO B;  3CCQ V;  4NXN O;  1K8A W;  1VQK V;  4GCZ A;  1KYO F;  3CC2 V;  5EBW C;  4J7K A;  2QE7 G;  4DV1 O;  2BSK A;  4J9Y B;  3OTO O;  4K0K B;  4X9Q A;  2EUL A;  5KHI A;  2RJZ A;  1MSD A;  4DR6 O;  3A0B Z;  2CH7 A;  1XMO B;  2RCV A;  2ZCE A;  4LH6 A;  2ZR3 A;  3MDS A;  3K5N A;  3HR0 A;  1Y67 A;  3L70 H;  3D8C A;  4K0K O;  4K3A A;  1VF7 A;  3SJC C;  2HJD A;  1BHA A;  2ADP A;  1XMO O;  3CRC A;  2EZO A;  4I0X B;  5B3S B;  4CC5 A;  2MW2 B;  4UVB A;  3CS5 A;  4D6T H;  1R3L C;  5IY5 B;  1MAB G;  1AIL A;  5JWP A;  1Z2G A;  5IT9 N;  2OYQ A;  1HW7 A;  2F23 A;  3UM7 A;  5FLX N;  1H5W A;  4YXW G;  3VQX A;  5D5P A;  3W7T A;  5KUM A; 
#chains in the Genus database with same CATH homology
 1BSM A;  4JYY A;  1AR5 A;  1BT8 A;  1EN4 A;  1ZUQ A;  3KKY A;  1IDS A;  1ZSP A;  3C3T A;  4FFK A;  2P4K A;  3BFR A;  1GN2 A;  1XIL A;  2ADQ B;  1N0N A;  1MNG A;  3OT7 A;  1VEW A;  1GN3 A;  3LSU A;  1EM1 A;  3RN4 A;  2GDS A;  1MA1 A;  1N0J A;  1AP5 A;  1MMM A;  3DC5 A;  1ZLZ A;  3C3S A;  3AK1 A;  1ZTE A;  2CDY A;  4C7U A;  1XRE A;  1LUV A;  1IX9 A;  1I0H A;  3QVN A;  1P7G A;  1PL4 A;  1WB8 A;  2CE4 A;  1D5N A;  1KKC A;  1IXB A;  4YIP A;  4GUN A;  4BR6 A;  2QKC A;  5A9G A;  3KDR A;  3K9S A;  4F6E A;  3CEI A;  3TJT A;  1VAR A;  1AP6 A;  1XUQ A;  1AVM A;  2QKA A;  1XDC A;  4X9Q A;  1MSD A;  1I08 A;  1WB7 A;  2RCV A;  1JR9 A;  1EN6 A;  1QNM A;  3MDS A;  4JZ2 A;  1SZX A;  1Y67 A;  5AG2 A;  3AK2 A;  1GN6 A;  3EVK A;  1BS3 A;  2ADP A;  1PM9 A;  1AR4 A;  4E4E A;  1LUW A;  1GN4 A;  3IC9 A;  4JZG A;  1EN5 A;  2AW9 A;  4YIO A;  3AK3 A;  3DC6 A;  1JA8 A;  1B06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...