1KKCA

Crystal structure of aspergillus fumigatus mnsod
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
200
structure length
200
Chain Sequence
QQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEATDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINWAEAENRYIAGDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
pubmed rcsb
source organism Aspergillus fumigatus
molecule tags Oxidoreductase
molecule keywords Manganese Superoxide Dismutase
total genus 78
structure length 200
sequence length 200
chains with identical sequence B, X, Y
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1kkcA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1kkcA02
4FFKA 1GN4A 1EN4A 1QNMA 4E4EA 1P7GA 3IC9A 1MNGA 1I08A 1N0NA 1B06A 1N0JA 2CE4A 1Y67A 3C3TA 1JR9A 1SZXA 2AW9A 1VEWA 3AK2A 1I0HA 1D5NA 1BT8A 1MSDA 1GN2A 1VARA 4F6EA 4X9QA 3DC5A 3TJTA 1EN5A 2RCVA 3K9SA 5AG2A 3QVNA 1XDCA 3KKYA 1EN6A 1MA1A 1ZUQA 1AP6A 1BSMA 4JZGA 1AVMA 1IX9A 3AK3A 1XREA 1ZSPA 2QKAA 4JZ2A 1ZLZA 1KKCA 4YIPA 5A9GA 1IXBA 1JA8A 3LSUA 2P4KA 1AP5A 1LUWA 1WB8A 3CEIA 2ADQB 3BFRA 3MDSA 1BS3A 2CDYA 1PM9A 4BR6A 3AK1A 1GN6A 1GN3A 4C7UA 1XUQA 1ZTEA 3OT7A 1MMMA 1AR4A 2GDSA 1LUVA 1XILA 2ADPA 2QKCA 1EM1A 1IDSA 1WB7A 4GUNA 4YIOA 3EVKA 1PL4A 3C3SA 4JYYA 3RN4A 3DC6A 1AR5A
chains in the Genus database with same CATH superfamily
1B04A 5KA5A 1EFRG 4CS2A 1X4TA 2DYSC 2IU3A 4B3SB 1FYJA 2EX3A 5FNVB 4F6RB 5CA0A 4MVQA 3TXSA 1W0KG 2PTMA 3K0DA 2R9IA 3GB7C 2EJRA 1KP2A 4YHHO 1K33A 1FFXB 2CE4A 3ZHVA 4GKKB 2ZE5A 5LHIA 3O9OA 3APOA 1NZ6A 2ZIMA 4KP4A 5L3BA 1YJNV 3JSLA 4X9QA 4JI3O 3ZRWA 1V54B 2WPDG 1DF4A 2HVJC 3BVOA 5AG2A 3T1YO 1S72V 4LF8B 5KMGB 2JGDB 2WLLA 2VWJA 1BSMA 1MABG 2UXBB 1FAFA 4DV4O 5DEDA 4FLVA 1U96A 1TGOA 2R72A 5KX5B 2HEPA 1VQ9V 2Y4UA 1NH2D 4JI8O 3CSXA 5A9GA 3UT5A 4B3SO 3HKBA 1JA8A 3BABA 3JAMN 3QO7A 1S0VA 4I4TA 4WFHA 2GHYA 4TSFG 4PA9A 2UUBB 2GTAA 1T5EA 1SZTA 1S5HC 2ZD9A 3E8HA 5IWAO 1GN3A 1XUQA 2ZDIC 2RDCA 2WLMA 5GTHZ 4DR7O 3CWBH 4MVSA 4WFBV 4JI4B 3ABKB 2EIKB 3ZRXA 1YJWV 3IJ4A 1HR0B 4BIUA 2YDEA 4ZI7B 4JI7B 4OXSA 3W7SA 1NT2B 4I9WA 1YVWA 3W7WA 5LHGA 4R7CA 1YJ9V 1S76D 3SR2C 3ABKC 1Q6IA 4DV6B 4PA4A 1Z2GA 3G4SV 1GM7A 4X62B 3RYHA 1VQ7V 1K9MW 4B3MO 4X66B 4FVMA 4ZKIA 3U11A 2CGNA 1SA0A 1GN4A 2ZXWB 4ZI7A 4D7SA 2UUCO 1KECA 1QNMA 1Q5OA 2JDIG 3CMAV 1HDJA 1VQPV 2A79B 4WCEV 1XMOB 2QSAA 4FLYA 3SYQA 1I08A 5BR8O 1DGSA 4DV5O 1N0JA 5JQGB 4X65B 4MVRA 1IBMO 4ICGA 3I5DA 1KU9A 1F7YA 1SZXA 3A0RA 3EHBB 5EYPA 2UU9O 3FKSG 1SA0B 2BE3A 5BZBA 3DTUB 1NBMG 4F4LA 1H5WA 5LGTA 4FFBB 4LF7B 2L6LA 3L74H 3ABTA 1XMQB 4PDMA 4DR1O 2KB1A 1L8DA 1NS1A 4LFCB 5EYPB 2X0LA 3KZIZ 5IJ0B 3W7TA 2E74B 1OV9A 3E8GA 3NR7A 4MTGA 1FXKA 2HJDA 4TT3G 3CC4V 1VQLV 1AILA 4Z1MG 5LXTB 3UKMA 5H6QA 2BOCC 1NR7A 2ADQB 3MDSA 5B1AB 4CC5A 4H0LB 3ZEDA 2H8PC 2XT9A 1UPGA 1AI7A 4XBFA 1S3JA 1CP9A 4TV9B 5LOVA 5BY1A 4JI2B 2HHHO 4CS4A 4JI0B 2EIJC 4FZ0A 1EBOA 1QLEB 4EEQA 3E35A 5FNVA 4F6RA 4DV1B 2EIJB 4XDJA 4H13B 5C8YB 2ZT9B 4DR3B 1YI2V 1YXBA 4AI8A 1P49A 2XAQA 4GX1A 3CE2A 3ZMUA 5JWPA 1VQOV 4JI5B 1JQ0A 2YICA 1YITV 2UXDO 4LF6B 2Y0PA 2AHZA 3K5OA 3AG7A 1MNGA 1NQTA 4JTCB 1ZL8B 5DECA 4I9QA 3L9DA 2K9PA 1Q6UA 1GKFA 2QM4A 3E86A 4EFBA 2CAZC 1VEWA 2XOKG 4XDLA 2V4DA 2ATKC 1MSDA 1O9HA 4LC1A 1GN2A 4F6EA 1AR1B 4JI6B 2F23A 1FFTB 2YEVB 3K9SA 4CS3A 4B3TO 3ZJZA 5JVDA 5BXZA 4PA6A 5LA6A 3S3WA 1R6NA 1SRYA 3W7UA 3AK3A 4PI2A 3SPCA 2KQXA 2WLIA 5D5QA 2DE0X 4NXMB 3M8AA 3VQYA 4ZBMA 3K79A 4LWSB 2HJFC 2IBZH 4DR2B 3MAQA 4GX5A 2LGWA 5B1BC 3KCXA 1Y76A 3FB6C 4BR6A 1FPOA 3K03A 4O4JA 3LUTB 4JGSA 5JJJB 1KQSU 1SETA 2IH1C 5EBMC 5KX5A 2ZINA 4CH5A 2E5LO 2YC0A 5LL6Y 4NKGB 4GX0A 3IGAC 4NXNB 1KP3A 1GTOA 4DR6O 1BL8A 2Q69A 2Q0AA 4HNAB 3H1JH 2YIBA 2EIKC 2F4VO 2UXCO 4O2AA 2WLHA 1HNXO 5KHHA 3SPJA 1WAZA 4H37A 2HHHB 3CCJV 1FXVA 1AI4A 2QGNA 1R3JC 3WB0A 1N8RW 4U7NA 1K3EA 2XAGA 2Q4PA 1NVPB 4J7ZA 2QJ1A 4WBNA 4LF4O 2HFEC 1W2BU 3UM7A 1B06A 2YXLA 3CC7V 1MZEA 3RYHB 4FM1A 1FJGB 4UCSA 3OGCC 2AW9A 4NB5A 4CC6A 4X1KA 3G6EV 3CRCA 4I0XA 4NVPA 4K8ZA 2F43G 2B9ZA 2GSMB 3L72H 3LSSA 1YDXA 3A2FA 4QE7A 5FL7G 1BMFG 4GKJB 2XTAA 3JAWA 4J10A 2LFRA 4J9YB 4JV5B 1PD3A 2FKXA 2JK5C 2PGGA 3D36A 1FOUA 3HKCB 3B77A 3GWKC 5CA3A 2WA3A 3WFVA 1AROP 1TUBA 1Y6XA 2YIBD 1LNQA 3FYEB 3IFXA 2AZ0A 5LOVB 4LFBO 2YI8A 4JYAO 3CB2A 3JASA 3BFRA 1NH2B 4DR2O 2F93B 4I5SA 3ZRSA 4PDLA 5JH7A 1AJQA 3H1HH 1KB9F 4HYOA 3OTOO 1I7FA 4B3MB 2UXXA 1V54C 3ZRVA 3CXCU 2PI5A 2BSKA 1GH6A 4I50B 3TETA 2G38A 3QO5A 3RYFA 5LMUB 1OCRC 5JH7B 4TUYB 3T4ZA 1H2KA 1S5JA 3HKDB 1DK1A 1YIJV 3FD9A 3VBBA 4FFKA 5IWAB 2V7QG 3OMNB 3IC7A 3K5NA 4LFAB 4BW9A 4X64B 3K5MA 4N23A 5LGNA 5CB4A 2JGDA 3B2EE 5LA6B 1UJWB 1M56B 3ZHTA 4DR5O 2LQTA 1XL6A 3VQXA 1VARA 1GMGA 2Q8VA 4LR3A 1NVPD 5IYDO 2ZKOA 4CH4A 3Q4HB 4MW3A 3H1IH 5L3DA 3OEEG 1TAEA 1M57B 1HNWO 2Y48A 3I56V 2WLKA 1FFXA 2OCHA 4JI2O 2QWNB 4MVMA 1N32O 1KC8W 5B66Z 1WJZA 3F7YC 5KHIA 1R73A 1IXBA 3B8NA 2H3OA 5TISZ 4RUEA 4I7ZB 3OTOB 3CCMV 2EIMC 4FM0A 3AK1A 3X2QB 5B3SB 4IGGA 1JCHA 5EBWC 3ZBHA 2QR4A 4DV2O 2Q68A 5IYCO 3ZN0A 4GLXA 1AI6A 2DYSB 3LDEA 3CPWU 1MZFA 2K1EA 1OCOB 3K08A 4L87A 2WLJA 3OR6C 4BW5A 4YIOA 5BMVB 3B4SA 4HZ3A 2ZQMA 2X7RB 3N2GB 4TV8A 3APQA 4PELA 2VS0A 3E8BA 4JV5O 4RQEA 1JNBA 4KHPB 4UVBA 3RVYA 4X1YA 2Q67A 2EILB 2IJIA 4UUJC 1N0NA 2HLDG 2OIGA 1FJGO 3NXSA 4WFGA 1SQQH 1QLNA 1V55B 4FM2A 1I0HA 1G1XB 3THOA 3AG4C 1XBLA 4FLTA 2CUGA 2Y4TA 3TJTA 2XUMA 1TA8A 4J80A 1F51A 4LNUA 2RN9A 4OX9B 1EZJA 2P67A 3ETQA 4EB6B 2BCCH 4X1IA 2EJ7A 5DM6V 3ETEA 3E89A 1OCCB 1ZSPA 1VQ8V 3FB8C 3K58A 1MSWD 1GRJA 4DR6B 1OZ0A 4DV0O 3EFFK 4Q20A 1TVKA 1CPYA 3CRRA 4PI0A 2Z0AA 4JTAB 1THZA 2CDYA 1IURA 1H8EG 1K8AW 3ASNC 3RVZA 3G67A 5CBHA 1FXKB 4UV8A 3SPGA 5IYZA 5IY5C 2B1GA 3CCLV 4EFEA 2QWPB 3JD1A 1R3LC 4QIWF 3R65A 2OYQA 1KKDA 4U3JA 2ITDC 2JJ2G 4JI3B 1F4NA 3U10A 3H9VA 1D5AA 1UFIA 4K0KB 4JAUA 4B3RO 3OMAB 3ABMB 4Z1VA 2BSKB 4JI6O 1WPXA 3G71V 3N2KA 3RYIA 4QPJA 1PP9H 3FAVA 1P84F 2EZPA 3Q4HA 1N34B 4RQFA 2KG7A 2QKSA 3RWRD 4YY3B 4W4LA 1IBKB 1SQPH 1XNRO 1FXHA 3JAKB 3AG2B 1R1BA 1QHTA 3OW2U 2A7WA 1MG1A 4NYKA 4JYAB 2ZXWC 3BHPA 3CMEV 4OPAA 3RYIB 4FLWA 3UT5B 1VP7A 4X20B 4LF5O 3ASOB 3RYCA 3CCEV 2UXNA 5LP6C 1M4UA 1OCRB 4MVUA 2FTKA 3D8CA 4FLZA 3JARA 4X8AA 3LDCA 4KHPO 2VQEO 3QNEA 4WFAV 4JZ2A 4PV1B 3STZC 1MOFA 4X20A 4K3AA 4PA7A 1WB8A 4NTXA 2QE7G 1A32A 1Q86W 1BS3A 3PN1A 1URFA 1WA8B 4LF9O 4NTYA 3ZN1A 4LF5B 2FB5A 1RPRA 3TCUA 4AHCA 4UV9A 3OR7C 1K5SA 3G6BA 2XNDG 1HW7A 4JAVA 1VIBA 2QDOA 5F2VO 4J9ZB 1B6QA 3F5WC 3U0ZA 5J9PC 1QQCA 1XHXA 3RT3C 1BCCH 4K35A 1IBKO 4G2KA 1N34O 1WB7A 3BA9A 2R9AA 3P32A 2QA4V 1Y74B 3FYIB 2LW7A 5H9CA 2PUSA 1AR5A 4DRXB 2NNUA 1OCZC 2KSDA 4LF7O 4NXNO 1EN4A 2Q9LA 2X6AA 3JYCA 5B5EZ 2RMKB 2QWOB 2QM8A 4Q6GA 5L3CA 1WLEA 1ZAUA 5KA6A 1N36B 4NTWA 3K0GA 4G28B 3E83A 1JPXA 4J11A 4R8CA 4DR5B 2MW2B 4O2BB 2DMXA 4X1YB 1QVFU 2DYRB 2ZM6O 1L0LH 3OFNG 3SPIA 4H44B 4FJCC 4X64O 4LFAO 1JJOA 3J80N 2ZNIA 2JGUA 4FLUA 1IX9A 3B8MA 1XL4A 4DV0B 5C93A 4B3TB 3MHSC 4UCVA 1VMGA 1KKCA 2NR5A 3CCSV 1NI8A 2IJJA 3K59A 3JD2A 3HB3B 2P4VA 5HFMA 4I50A 5LMUO 4DR4B 4LH7A 2D3OW 2MK3A 5LP6B 1N33O 3RYFB 4TUYA 1BQZA 3ASOC 4IHJB 1SQGA 1Q8IA 3SDLA 1FXKC 2ETNA 2A9HA 4NR1A 1Q90D 3AG1B 4L8JA 2HP8A 2ZM6B 3QG5A 4DV3B 3WB2A 3N27A 5CBFA 2HR3A 2PI4A 4YJ2B 5H6RA 5CA0B 2HVKC 2Q7HA 2GUZA 1IVSA 3CD6V 1CEZA 4DV1O 1NR1A 3JAKA 5GONA 4GX2A 3ZMZA 5IYZB 3ABMC 2JIZG 3WB1A 3ZCCA 1YTFD 2PYJA 2IJKA 1DLBA 1ZX3A 1NTKH 4AILC 4MTXA 5KAIZ 2JVDA 3M7MX 2XASA 3RYCB 4HAMA 3CC2V 1G6UA 3QF7A 3ZMTA 3A0BZ 3TK1A 2IU0A 2EBOA 1GM9A 1VQNV 1JR9A 1DTOA 5EK0A 4DV2B 3CS5A 4AQYB 2CTWA 4MTOA 4LWSA 2QEXV 3KCYA 4GYCB 4LF4B 3KKYA 4JI1O 1B3QA 1WP7A 1WA8A 4LFCO 4DV7B 2CTPA 4A5UB 3FB7C 1N32B 3ZS8C 3SJBC 5IDJA 1COWG 4KFMA 5KLVH 2Q7GA 1ORQC 3LSUA 3SYOA 2F4VB 4FIPC 2UXCB 2OCCB 3T2MA 3CEIA 4JYBA 3J7AU 3F7VC 2N04A 5EC2C 1OCOC 3JD4A 1G4YB 4HBNA 1PKXA 1PNLA 2WLIB 4TV8B 2Q7EA 4DRXA 1MMMA 3OAAG 1RFYA 3SYAA 1VQ5V 1GK9A 3JD3A 3ZX6A 1JOYA 2F66C 3LNNA 3HR0A 4UVAA 3K3WA 1RM1C 2BTOA 2YSUB 5FPOA 5IY5B 3UO2A 4O4JB 4O4IB 4WFEA 1PL4A 4JYYA 5GTIZ 3AG3C 2CTQA 2Y69B 1K4CC 1M1KW 2OT5A 3FX7A 4NXMO 2YXHA 3H1LH 3UQ8A 2YXYA 3GVMA 1KUQA 2DWDC 2CH7A 5CA1A 1O9GA 5L3EA 2ZE8A 3IAYA 4FZ1A 2FL4A 2YI9A 4O2AB 2JRIA 5LMNO 3K06A 3CRQA 1KYOF 3OMIB 3K57A 5LGUA 4R6ZA 2JS5A 5EIBD 3LSQA 1TVKB 3F5TA 2RCVA 3E8FA 3QVNA 4LH6A 5LYJB 5FPRA 5LBQA 2CTRA 1XNQO 3H01A 2YS8A 1BHBA 5JJNB 4LFBB 2M6YA 1KBHA 1F23A 3WG7B 4BAYA 4O2BA 3T1YB 2VQFB 2BTQB 3CJHB 4O4LB 4ZHQB 5IYBO 2LP7A 4TQDA 4GKJO 2Y0IA 2IW5A 4C7UA 4YJ3B 5IJ0A 2Z3YA 4QPKA 3SYCA 2LO1A 3AEIA 3JCZA 3L70H 3CJHA 1BQ0A 4WFFA 1U97A 3ZHSA 5LXTA 3D3IA 2NLJC 3FAVB 1XOUA 1WP8A 3ZHUA 4DO2A 3BPZA 4CBCA 1BGYH 2DYRC 3MD0A 3EVKA 4LF9B 1VQKV 3DGEA 1W0JG 3E22B 3CCUV 1WNSA 2Q5ZA 1H8HG 4E4EA 2ARHA 2P6JA 4RAIA 5JCOA 5ITZB 3IC9A 1XMQO 4D6TH 1JMKC 1VQ4V 2VQEB 4PA3A 2WLLB 2EINB 3HKDA 4FPPA 1NTZH 3E22A 3MHHC 4RWUA 2UU9B 1BE3H 2IJHA 4QNHB 1HP8A 2OIEA 2XAJA 3DC5A 1S77D 2FMLA 1SKVA 2QWQB 4UCOA 1EZVH 1MA1A 1QVGU 1ZUQA 4I4TB 1XMOO 3UO3A 3EXAA 3H1KH 2UUCB 2W6JG 2QKAA 4YY3O 3ZHRA 1P7BA 2IM9A 4I55B 2P7TC 3BCCH 4YIPA 4X62O 3OEHG 2YEVA 3ZRWB 1XI1A 3RGBA 1Q43A 3ZIAG 2P4KA 4TWKA 3CHXA 4K8XA 4B7KA 2UUAB 3K04A 1VQ6V 1K34A 4HNAA 3JARB 1PM9A 2EINC 1F4MA 4O4IA 5K1XA 1Y74A 2DOSA 5IT9N 1R6KA 3N2GA 3RW0A 4P9OA 2DN9A 4DR7B 4FK5C 3HKBB 1YCIA 5EZYA 4PD4F 4JASA 1PPJH 4RUFA 4RO2A 3FB5C 3OUSA 4J41A 2PY5A 3BY6A 1Y66A 3SPHA 1EM1A 4DUZO 1IDSA 4CH3A 1NJIW 1H38A 3OGIB 3AG2C 2PZSA 2N74A 4JI8B 4ZOLA 1P4RA 5J2UA 5EZYB 4DR3O 3ZMSA 1H2LA 4BWAA 4DV4B 3W7XA 4B08A 1HWYA 3WU2Z 2AZ2A 1JX9A 3TXQA 1SQBH 1BHAA 1H2SB 4N21A 3BAAA 5E79Z 3HKCA 4IYHA 1YZBA 2VQFO 5J2UB 3AK2A 5CBGA 5IJ9A 1D5NA 1N4CA 4GKKO 4UCUA 1K97A 2BTQA 5CA1B 3JCUZ 1RPOA 4DUZB 4O4LA 3WG7C 1Z5WA 5B1BB 1RM1B 1AP6A 2A06H 1AVMA 5EC1C 3ETGA 5IJ9B 4LCUC 1K92A 4JF3A 1ZLZA 3JAWB 3P3NA 5L3GA 2DQ0A 3K9AA 2UUAO 4LNUB 5EIBC 2ODMA 5KHKA 2X6BA 5LYJA 3JATB 4YJ2A 1YF2A 1QBZA 2JEUA 4G27B 3DXRB 3JD0A 2GUZB 4FMTA 1GN6A 4ZIBA 2AGAA 4XDKA 3UCSC 2GDSA 3QO8A 1HNZO 1XILA 3LDDA 3ZMVA 4JTDB 3OD4A 5KAFZ 1J95A 5LP6A 4U7OA 1JFFB 1JVMA 3ETDA 2P22C 3DXRA 1YSCA 3AG1C 4DUYO 4UB8Z 4MTFA 2ITCC 3OUFA 3OTFA 2Q73A 4IYIA 4W4KA 2HG5C 3A0HZ 1NKDA 2R70A 3CRAA 1M5IA 4MVOA 3CX5F 3T1HO 4IIJB 2YUAA 5L3FA 4DV6O 2XHBA 4U3JB 4MVZA 4X88A 5HFLA 2WWWA 4YXWG 4TQFA 3STLC 2EILC 1GO3F 5KMGA 1PNKA 4MSWC 2ZR2A 3JSNA 5GONB 1HR0O 1OCCC 4JI7O 2RJZA 3P30A 1QCEA 1HNWB 4JI4O 4J7KA 2FYUH 1ENVA 1GAXA 2NN4A 3CYOA 4O4HA 3LNMB 3VQWA 4IT5A 4WF9V 1SESA 2KG7B 2UUBO 5JCOC 1IZ3A 1FD9A 1LR1A 4TOIA 4UCRA 2B5UA 2F95B 2A0LA 2QTSA 1Z5VA 4CZZA 2D2CB 3R66A 2YIAA 1H2GA 4AQYO 4OPHA 3BEHA 2XAFA 4LP8A 1NTMH 5B3SC 3JALA 2UXBO 4X89A 1R3KC 1SERA 1SC5B 1QR9A 1VF5B 1KD1W 5J2TB 3A8TA 4IL6Z 1M93A 2P06A 2RQ6A 5B1NA 5H2FZ 5BMVA 1BZKA 2O57A 3CCQV 1OCZB 1YEWA 2W6IG 3CP1A 4I55A 4PHZA 1R3IC 1AR4A 4UB6Z 4B7EA 3D3QA 4ABMA 1ZWIC 1XNQB 3HKEA 4OGQB 4YHHB 3K5LA 2DWEC 1VF6A 1M57C 3SJCC 5K1PA 3CCRV 1Y76B 1AJPA 2QKCA 4GZRB 2IH3C 2P90A 3ML0A 4GUNA 5JJEB 2LFSA 1ROPA 3KG2A 2W0XA 4DK1A 5JQGA 1AJNA 1M90W 2LJ2A 2EIMB 5E1AC 4FLXA 4X1KB 4PDVA 4ASUG 2E3CA 1N33B 1E1QG 4JI5O 2UXDB 3KDRA 3CXHF 1AI5A 4DR4O 4H33A 2ZR3A 1R6TA 3T1CA 2BOBC 2QM7A 2C2AA 3L73H 1SS3A 4X1IB 4Z2WA 1Y67A 4ZOLB 1VF6C 1TUBB 4DXWA 3CCVV 3BA8A 3O65A 2CH7B 4JPRA 2OTLV 1OHHG 1EN5A 2ZE6A 3J81N 4MS2A 4JI0O 2WAMA 5B1OA 3JASB 1TUEB 2DJVA 4J42A 4KUMA 1IBLB 3E2EA 1QR8A 1WPBA 3QTCA 1M56C 4I0XB 4QJFB 4R50A 1WN7A 2Z5UA 1OJHA 1RSOB 4PDRA 1XQ8A 3CRMA 5A2QN 1QU7A 3RBZA 4FFBA 2CK3G 2QTOA 4CH6A 1AP5A 2AHYA 1XHZA 4EB6A 5CMUA 2GV9A 2XAHA 4UCTA 1FS0G 1HNXB 3HPLC 1J5EO 2Y69C 4DR1B 2F1MA 1RSOA 1V9PA 1LUVA 1Q3EA 4QE9A 2QWRB 3T1HB 2Q0OC 2ZIOA 4ZHQA 2E5LB 1PV0A 3G80A 5FLXN 3P3PA 2OTJV 3L71H 1US6A 1K7DA 4DYLA 2L35A 5ITZA 2P5OA 4BIZA 1AB3A 2CGOA 1VQMV 5CB4B 3C3SA 2YIDA 4X65O 4YJ3A 3DC6A 3SJAC 2ZCEA 4JYCA 4UXNA 3T4DA 3ZHQA 1KMIZ 2PF4E 2HKOA 3GWOA 3L75H 2DQ3A 1P7GA 1I5YA 2VWKA 1JFFA 4MT8A 4X66O 5JVDB 1E79G 5C8YA 2ZDIA 1FKAO 1K5QA 2V1DA 3C3TA 5DN6G 1L1FA 3VQVA 1VF7A 3ABLB 1Q6HA 4IIJA 4LBEC 2GBOA 4DW1A 1PNMA 1ZL8A 1X59A 3AG3B 5KHGA 3TGUH 5H5NA 4DV3O 3AG4B 4JZGA 3ASNB 1Q7YW 3ABUA 1XREA 1I5XA 1V55C 1I94B 3VOUA 1SQXH 2E76B 1PL0A 3D36C 2GTSA 4O4HB 2KKWA 1I94O 3M99B 4J7JA 2B1IA 4LF6O 1XNRB 3OE7G 1LUWA 1SQFA 2Q6AA 1K73W 4QGPA 2R9RB 4MW8A 2DW4A 2ZNJA 5EBLC 1Q81W 3B40A 2E75B 5GW7A 2OWOA 1CXZB 1Q82W 4B3RB 4K0KO 5CN0A 1ZTEA 2OCCC 2JS3A 4LF8O 1E1RG 2ZE7A 3BRCA 5KHJA 4UFZA 3JALB 4EKWA 1XEQA 5J2TA 5B1AC 2ADPA 4WBNB 4PJ0Z 4GT1A 4JAAA 2ILMA 1H2NA 3RN4A 3SYPA 3SGIA 1L0NH 2LW1A 3I55V 3HKEB 2X6CA 1N36O 5KUMA 3PJSK 3B09A 2WSSG 4E2LA 4BIOA 4P9PA 2AXTZ 4GCZA 1H2MA 2H94A 5LMNB 2EZOA 2RNBA 2JJ1G 1Y4MA 2VRZA 5KUKA 1BT8A 2A3QA 2EULA 1G8MA 1J5EB 2JEXA 4D7TA 2PYLA 1QLEC 3RFRA 4OX9O 1YTFB 1XDCA 1JJ2U 1S5LZ 1EN6A 1W59A 5LHHA 1IBMB 3X2QC 2M7WA 1K4DC 4DV5B 2WA4A 5BR8B 4DK0A 4IHJA 5IE9A 5D5PA 1SF9A 1GM8A 1IBLO 4DUYB 1SQVH 4U3FH 4KL1A 1DF5A 3FFQA 1IXMA 1HNZB 3OT7A 1D2DA 1M9NA 4DW0A 3ABLC 2W0FC 2N05A 4P2ZA 1RP3B 3ICXA 1YHQV 1NU1H 3C90A 3SJQC 3N2KB 3JATA 4KXRA 3OM3B 2WLNA 1IJGA 4UVCA 4P30A 4DV7O 3S3XA 4TV9A 3DSQA 4JI1B 2LGQA
chains in the Genus database with same CATH topology
4FFKA 1GN4A 1EN4A 1QNMA 4E4EA 3KDRA 1P7GA 3IC9A 1MNGA 1I08A 1N0NA 1B06A 1N0JA 2CE4A 1Y67A 3C3TA 1JR9A 1SZXA 2AW9A 1VEWA 3AK2A 1I0HA 1D5NA 1BT8A 1MSDA 1GN2A 1VARA 4F6EA 4X9QA 3DC5A 3TJTA 1EN5A 2RCVA 3K9SA 5AG2A 3QVNA 1XDCA 3KKYA 1EN6A 1MA1A 1ZUQA 1AP6A 1BSMA 4JZGA 1AVMA 1IX9A 3AK3A 1XREA 1ZSPA 2QKAA 4JZ2A 1ZLZA 1KKCA 4YIPA 5A9GA 1IXBA 1JA8A 3LSUA 2P4KA 1AP5A 1LUWA 1WB8A 3CEIA 2ADQB 3BFRA 3MDSA 1BS3A 2CDYA 1PM9A 4BR6A 3AK1A 1GN6A 1GN3A 4C7UA 1XUQA 1ZTEA 3OT7A 1MMMA 1AR4A 2GDSA 1LUVA 1XILA 2ADPA 2QKCA 1EM1A 1IDSA 1WB7A 4GUNA 4YIOA 3EVKA 1PL4A 3C3SA 4JYYA 3RN4A 3DC6A 1AR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FFK A;  1GN4 A;  1EN4 A;  1QNM A;  4E4E A;  1P7G A;  3IC9 A;  1MNG A;  1I08 A;  1N0N A;  1B06 A;  1N0J A;  2CE4 A;  1Y67 A;  3C3T A;  1JR9 A;  1SZX A;  2AW9 A;  1VEW A;  3AK2 A;  1I0H A;  1D5N A;  1BT8 A;  1MSD A;  1GN2 A;  1VAR A;  4F6E A;  4X9Q A;  3DC5 A;  3TJT A;  1EN5 A;  2RCV A;  3K9S A;  5AG2 A;  3QVN A;  1XDC A;  3KKY A;  1EN6 A;  1MA1 A;  1ZUQ A;  1AP6 A;  1BSM A;  4JZG A;  1AVM A;  1IX9 A;  3AK3 A;  1XRE A;  1ZSP A;  2QKA A;  4JZ2 A;  1ZLZ A;  1KKC A;  4YIP A;  5A9G A;  1IXB A;  1JA8 A;  3LSU A;  2P4K A;  1AP5 A;  1LUW A;  1WB8 A;  3CEI A;  2ADQ B;  3BFR A;  3MDS A;  1BS3 A;  2CDY A;  1PM9 A;  4BR6 A;  3AK1 A;  1GN6 A;  1GN3 A;  4C7U A;  1XUQ A;  1ZTE A;  3OT7 A;  1MMM A;  1AR4 A;  2GDS A;  1LUV A;  1XIL A;  2ADP A;  2QKC A;  1EM1 A;  1IDS A;  1WB7 A;  4GUN A;  4YIO A;  3EVK A;  1PL4 A;  3C3S A;  4JYY A;  3RN4 A;  3DC6 A;  1AR5 A; 
#chains in the Genus database with same CATH topology
 1B04 A;  5KA5 A;  1EFR G;  4CS2 A;  1X4T A;  2DYS C;  2IU3 A;  4B3S B;  1FYJ A;  2EX3 A;  5FNV B;  4F6R B;  5CA0 A;  4MVQ A;  3TXS A;  1W0K G;  2PTM A;  3K0D A;  2R9I A;  3GB7 C;  2EJR A;  1KP2 A;  4YHH O;  1K33 A;  1FFX B;  2CE4 A;  3ZHV A;  4GKK B;  2ZE5 A;  5LHI A;  3O9O A;  3APO A;  1NZ6 A;  2ZIM A;  4KP4 A;  5L3B A;  1YJN V;  3JSL A;  4X9Q A;  4JI3 O;  3ZRW A;  1V54 B;  2WPD G;  1DF4 A;  2HVJ C;  3BVO A;  5AG2 A;  3T1Y O;  1S72 V;  4LF8 B;  5KMG B;  2JGD B;  2WLL A;  2VWJ A;  1BSM A;  1MAB G;  2UXB B;  1FAF A;  4DV4 O;  5DED A;  4FLV A;  1U96 A;  1TGO A;  2R72 A;  5KX5 B;  2HEP A;  1VQ9 V;  2Y4U A;  1NH2 D;  4JI8 O;  3CSX A;  5A9G A;  3UT5 A;  4B3S O;  3HKB A;  1JA8 A;  3BAB A;  3JAM N;  3QO7 A;  1S0V A;  4I4T A;  4WFH A;  2GHY A;  4TSF G;  4PA9 A;  2UUB B;  2GTA A;  1T5E A;  1SZT A;  1S5H C;  2ZD9 A;  3E8H A;  5IWA O;  1GN3 A;  1XUQ A;  2ZDI C;  2RDC A;  2WLM A;  5GTH Z;  4DR7 O;  3CWB H;  4MVS A;  4WFB V;  4JI4 B;  3ABK B;  2EIK B;  3ZRX A;  1YJW V;  3IJ4 A;  1HR0 B;  4BIU A;  2YDE A;  4ZI7 B;  4JI7 B;  4OXS A;  3W7S A;  1NT2 B;  4I9W A;  1YVW A;  3W7W A;  5LHG A;  4R7C A;  1YJ9 V;  1S76 D;  3SR2 C;  3ABK C;  1Q6I A;  4DV6 B;  4PA4 A;  1Z2G A;  3G4S V;  1GM7 A;  4X62 B;  3RYH A;  1VQ7 V;  1K9M W;  4B3M O;  4X66 B;  4FVM A;  4ZKI A;  3U11 A;  2CGN A;  1SA0 A;  1GN4 A;  2ZXW B;  4ZI7 A;  4D7S A;  2UUC O;  1KEC A;  1QNM A;  1Q5O A;  2JDI G;  3CMA V;  1HDJ A;  1VQP V;  2A79 B;  4WCE V;  1XMO B;  2QSA A;  4FLY A;  3SYQ A;  1I08 A;  5BR8 O;  1DGS A;  4DV5 O;  1N0J A;  5JQG B;  4X65 B;  4MVR A;  1IBM O;  4ICG A;  3I5D A;  1KU9 A;  1F7Y A;  1SZX A;  3A0R A;  3EHB B;  5EYP A;  2UU9 O;  3FKS G;  1SA0 B;  2BE3 A;  5BZB A;  3DTU B;  1NBM G;  4F4L A;  1H5W A;  5LGT A;  4FFB B;  4LF7 B;  2L6L A;  3L74 H;  3ABT A;  1XMQ B;  4PDM A;  4DR1 O;  2KB1 A;  1L8D A;  1NS1 A;  4LFC B;  5EYP B;  2X0L A;  3KZI Z;  5IJ0 B;  3W7T A;  2E74 B;  1OV9 A;  3E8G A;  3NR7 A;  4MTG A;  1FXK A;  2HJD A;  4TT3 G;  3CC4 V;  1VQL V;  1AIL A;  4Z1M G;  5LXT B;  3UKM A;  5H6Q A;  2BOC C;  1NR7 A;  2ADQ B;  3MDS A;  5B1A B;  4CC5 A;  4H0L B;  3ZED A;  2H8P C;  2XT9 A;  1UPG A;  1AI7 A;  4XBF A;  1S3J A;  1CP9 A;  4TV9 B;  5LOV A;  5BY1 A;  4JI2 B;  2HHH O;  4CS4 A;  4JI0 B;  2EIJ C;  4FZ0 A;  1EBO A;  1QLE B;  4EEQ A;  3E35 A;  5FNV A;  4F6R A;  4DV1 B;  2EIJ B;  4XDJ A;  4H13 B;  5C8Y B;  2ZT9 B;  4DR3 B;  1YI2 V;  1YXB A;  4AI8 A;  1P49 A;  2XAQ A;  4GX1 A;  3CE2 A;  3ZMU A;  5JWP A;  1VQO V;  4JI5 B;  1JQ0 A;  2YIC A;  1YIT V;  2UXD O;  4LF6 B;  2Y0P A;  2AHZ A;  3K5O A;  3AG7 A;  1MNG A;  1NQT A;  4JTC B;  1ZL8 B;  5DEC A;  4I9Q A;  3L9D A;  2K9P A;  1Q6U A;  1GKF A;  2QM4 A;  3E86 A;  4EFB A;  2CAZ C;  1VEW A;  2XOK G;  4XDL A;  2V4D A;  2ATK C;  1MSD A;  1O9H A;  4LC1 A;  1GN2 A;  4F6E A;  1AR1 B;  4JI6 B;  2F23 A;  1FFT B;  2YEV B;  3K9S A;  4CS3 A;  4B3T O;  3ZJZ A;  5JVD A;  5BXZ A;  4PA6 A;  5LA6 A;  3S3W A;  1R6N A;  1SRY A;  3W7U A;  3AK3 A;  4PI2 A;  3SPC A;  2KQX A;  2WLI A;  5D5Q A;  2DE0 X;  4NXM B;  3M8A A;  3VQY A;  4ZBM A;  3K79 A;  4LWS B;  2HJF C;  2IBZ H;  4DR2 B;  3MAQ A;  4GX5 A;  2LGW A;  5B1B C;  3KCX A;  1Y76 A;  3FB6 C;  4BR6 A;  1FPO A;  3K03 A;  4O4J A;  3LUT B;  4JGS A;  5JJJ B;  1KQS U;  1SET A;  2IH1 C;  5EBM C;  5KX5 A;  2ZIN A;  4CH5 A;  2E5L O;  2YC0 A;  5LL6 Y;  4NKG B;  4GX0 A;  3IGA C;  4NXN B;  1KP3 A;  1GTO A;  4DR6 O;  1BL8 A;  2Q69 A;  2Q0A A;  4HNA B;  3H1J H;  2YIB A;  2EIK C;  2F4V O;  2UXC O;  4O2A A;  2WLH A;  1HNX O;  5KHH A;  3SPJ A;  1WAZ A;  4H37 A;  2HHH B;  3CCJ V;  1FXV A;  1AI4 A;  2QGN A;  1R3J C;  3WB0 A;  1N8R W;  4U7N A;  1K3E A;  2XAG A;  2Q4P A;  1NVP B;  4J7Z A;  2QJ1 A;  4WBN A;  4LF4 O;  2HFE C;  1W2B U;  3UM7 A;  1B06 A;  2YXL A;  3CC7 V;  1MZE A;  3RYH B;  4FM1 A;  1FJG B;  4UCS A;  3OGC C;  2AW9 A;  4NB5 A;  4CC6 A;  4X1K A;  3G6E V;  3CRC A;  4I0X A;  4NVP A;  4K8Z A;  2F43 G;  2B9Z A;  2GSM B;  3L72 H;  3LSS A;  1YDX A;  3A2F A;  4QE7 A;  5FL7 G;  1BMF G;  4GKJ B;  2XTA A;  3JAW A;  4J10 A;  2LFR A;  4J9Y B;  4JV5 B;  1PD3 A;  2FKX A;  2JK5 C;  2PGG A;  3D36 A;  1FOU A;  3HKC B;  3B77 A;  3GWK C;  5CA3 A;  2WA3 A;  3WFV A;  1ARO P;  1TUB A;  1Y6X A;  2YIB D;  1LNQ A;  3FYE B;  3IFX A;  2AZ0 A;  5LOV B;  4LFB O;  2YI8 A;  4JYA O;  3CB2 A;  3JAS A;  3BFR A;  1NH2 B;  4DR2 O;  2F93 B;  4I5S A;  3ZRS A;  4PDL A;  5JH7 A;  1AJQ A;  3H1H H;  1KB9 F;  4HYO A;  3OTO O;  1I7F A;  4B3M B;  2UXX A;  1V54 C;  3ZRV A;  3CXC U;  2PI5 A;  2BSK A;  1GH6 A;  4I50 B;  3TET A;  2G38 A;  3QO5 A;  3RYF A;  5LMU B;  1OCR C;  5JH7 B;  4TUY B;  3T4Z A;  1H2K A;  1S5J A;  3HKD B;  1DK1 A;  1YIJ V;  3FD9 A;  3VBB A;  4FFK A;  5IWA B;  2V7Q G;  3OMN B;  3IC7 A;  3K5N A;  4LFA B;  4BW9 A;  4X64 B;  3K5M A;  4N23 A;  5LGN A;  5CB4 A;  2JGD A;  3B2E E;  5LA6 B;  1UJW B;  1M56 B;  3ZHT A;  4DR5 O;  2LQT A;  1XL6 A;  3VQX A;  1VAR A;  1GMG A;  2Q8V A;  4LR3 A;  1NVP D;  5IYD O;  2ZKO A;  4CH4 A;  3Q4H B;  4MW3 A;  3H1I H;  5L3D A;  3OEE G;  1TAE A;  1M57 B;  1HNW O;  2Y48 A;  3I56 V;  2WLK A;  1FFX A;  2OCH A;  4JI2 O;  2QWN B;  4MVM A;  1N32 O;  1KC8 W;  5B66 Z;  1WJZ A;  3F7Y C;  5KHI A;  1R73 A;  1IXB A;  3B8N A;  2H3O A;  5TIS Z;  4RUE A;  4I7Z B;  3OTO B;  3CCM V;  2EIM C;  4FM0 A;  3AK1 A;  3X2Q B;  5B3S B;  4IGG A;  1JCH A;  5EBW C;  3ZBH A;  2QR4 A;  4DV2 O;  2Q68 A;  5IYC O;  3ZN0 A;  4GLX A;  1AI6 A;  2DYS B;  3LDE A;  3CPW U;  1MZF A;  2K1E A;  1OCO B;  3K08 A;  4L87 A;  2WLJ A;  3OR6 C;  4BW5 A;  4YIO A;  5BMV B;  3B4S A;  4HZ3 A;  2ZQM A;  2X7R B;  3N2G B;  4TV8 A;  3APQ A;  4PEL A;  2VS0 A;  3E8B A;  4JV5 O;  4RQE A;  1JNB A;  4KHP B;  4UVB A;  3RVY A;  4X1Y A;  2Q67 A;  2EIL B;  2IJI A;  4UUJ C;  1N0N A;  2HLD G;  2OIG A;  1FJG O;  3NXS A;  4WFG A;  1SQQ H;  1QLN A;  1V55 B;  4FM2 A;  1I0H A;  1G1X B;  3THO A;  3AG4 C;  1XBL A;  4FLT A;  2CUG A;  2Y4T A;  3TJT A;  2XUM A;  1TA8 A;  4J80 A;  1F51 A;  4LNU A;  2RN9 A;  4OX9 B;  1EZJ A;  2P67 A;  3ETQ A;  4EB6 B;  2BCC H;  4X1I A;  2EJ7 A;  5DM6 V;  3ETE A;  3E89 A;  1OCC B;  1ZSP A;  1VQ8 V;  3FB8 C;  3K58 A;  1MSW D;  1GRJ A;  4DR6 B;  1OZ0 A;  4DV0 O;  3EFF K;  4Q20 A;  1TVK A;  1CPY A;  3CRR A;  4PI0 A;  2Z0A A;  4JTA B;  1THZ A;  2CDY A;  1IUR A;  1H8E G;  1K8A W;  3ASN C;  3RVZ A;  3G67 A;  5CBH A;  1FXK B;  4UV8 A;  3SPG A;  5IYZ A;  5IY5 C;  2B1G A;  3CCL V;  4EFE A;  2QWP B;  3JD1 A;  1R3L C;  4QIW F;  3R65 A;  2OYQ A;  1KKD A;  4U3J A;  2ITD C;  2JJ2 G;  4JI3 B;  1F4N A;  3U10 A;  3H9V A;  1D5A A;  1UFI A;  4K0K B;  4JAU A;  4B3R O;  3OMA B;  3ABM B;  4Z1V A;  2BSK B;  4JI6 O;  1WPX A;  3G71 V;  3N2K A;  3RYI A;  4QPJ A;  1PP9 H;  3FAV A;  1P84 F;  2EZP A;  3Q4H A;  1N34 B;  4RQF A;  2KG7 A;  2QKS A;  3RWR D;  4YY3 B;  4W4L A;  1IBK B;  1SQP H;  1XNR O;  1FXH A;  3JAK B;  3AG2 B;  1R1B A;  1QHT A;  3OW2 U;  2A7W A;  1MG1 A;  4NYK A;  4JYA B;  2ZXW C;  3BHP A;  3CME V;  4OPA A;  3RYI B;  4FLW A;  3UT5 B;  1VP7 A;  4X20 B;  4LF5 O;  3ASO B;  3RYC A;  3CCE V;  2UXN A;  5LP6 C;  1M4U A;  1OCR B;  4MVU A;  2FTK A;  3D8C A;  4FLZ A;  3JAR A;  4X8A A;  3LDC A;  4KHP O;  2VQE O;  3QNE A;  4WFA V;  4JZ2 A;  4PV1 B;  3STZ C;  1MOF A;  4X20 A;  4K3A A;  4PA7 A;  1WB8 A;  4NTX A;  2QE7 G;  1A32 A;  1Q86 W;  1BS3 A;  3PN1 A;  1URF A;  1WA8 B;  4LF9 O;  4NTY A;  3ZN1 A;  4LF5 B;  2FB5 A;  1RPR A;  3TCU A;  4AHC A;  4UV9 A;  3OR7 C;  1K5S A;  3G6B A;  2XND G;  1HW7 A;  4JAV A;  1VIB A;  2QDO A;  5F2V O;  4J9Z B;  1B6Q A;  3F5W C;  3U0Z A;  5J9P C;  1QQC A;  1XHX A;  3RT3 C;  1BCC H;  4K35 A;  1IBK O;  4G2K A;  1N34 O;  1WB7 A;  3BA9 A;  2R9A A;  3P32 A;  2QA4 V;  1Y74 B;  3FYI B;  2LW7 A;  5H9C A;  2PUS A;  1AR5 A;  4DRX B;  2NNU A;  1OCZ C;  2KSD A;  4LF7 O;  4NXN O;  1EN4 A;  2Q9L A;  2X6A A;  3JYC A;  5B5E Z;  2RMK B;  2QWO B;  2QM8 A;  4Q6G A;  5L3C A;  1WLE A;  1ZAU A;  5KA6 A;  1N36 B;  4NTW A;  3K0G A;  4G28 B;  3E83 A;  1JPX A;  4J11 A;  4R8C A;  4DR5 B;  2MW2 B;  4O2B B;  2DMX A;  4X1Y B;  1QVF U;  2DYR B;  2ZM6 O;  1L0L H;  3OFN G;  3SPI A;  4H44 B;  4FJC C;  4X64 O;  4LFA O;  1JJO A;  3J80 N;  2ZNI A;  2JGU A;  4FLU A;  1IX9 A;  3B8M A;  1XL4 A;  4DV0 B;  5C93 A;  4B3T B;  3MHS C;  4UCV A;  1VMG A;  1KKC A;  2NR5 A;  3CCS V;  1NI8 A;  2IJJ A;  3K59 A;  3JD2 A;  3HB3 B;  2P4V A;  5HFM A;  4I50 A;  5LMU O;  4DR4 B;  4LH7 A;  2D3O W;  2MK3 A;  5LP6 B;  1N33 O;  3RYF B;  4TUY A;  1BQZ A;  3ASO C;  4IHJ B;  1SQG A;  1Q8I A;  3SDL A;  1FXK C;  2ETN A;  2A9H A;  4NR1 A;  1Q90 D;  3AG1 B;  4L8J A;  2HP8 A;  2ZM6 B;  3QG5 A;  4DV3 B;  3WB2 A;  3N27 A;  5CBF A;  2HR3 A;  2PI4 A;  4YJ2 B;  5H6R A;  5CA0 B;  2HVK C;  2Q7H A;  2GUZ A;  1IVS A;  3CD6 V;  1CEZ A;  4DV1 O;  1NR1 A;  3JAK A;  5GON A;  4GX2 A;  3ZMZ A;  5IYZ B;  3ABM C;  2JIZ G;  3WB1 A;  3ZCC A;  1YTF D;  2PYJ A;  2IJK A;  1DLB A;  1ZX3 A;  1NTK H;  4AIL C;  4MTX A;  5KAI Z;  2JVD A;  3M7M X;  2XAS A;  3RYC B;  4HAM A;  3CC2 V;  1G6U A;  3QF7 A;  3ZMT A;  3A0B Z;  3TK1 A;  2IU0 A;  2EBO A;  1GM9 A;  1VQN V;  1JR9 A;  1DTO A;  5EK0 A;  4DV2 B;  3CS5 A;  4AQY B;  2CTW A;  4MTO A;  4LWS A;  2QEX V;  3KCY A;  4GYC B;  4LF4 B;  3KKY A;  4JI1 O;  1B3Q A;  1WP7 A;  1WA8 A;  4LFC O;  4DV7 B;  2CTP A;  4A5U B;  3FB7 C;  1N32 B;  3ZS8 C;  3SJB C;  5IDJ A;  1COW G;  4KFM A;  5KLV H;  2Q7G A;  1ORQ C;  3LSU A;  3SYO A;  2F4V B;  4FIP C;  2UXC B;  2OCC B;  3T2M A;  3CEI A;  4JYB A;  3J7A U;  3F7V C;  2N04 A;  5EC2 C;  1OCO C;  3JD4 A;  1G4Y B;  4HBN A;  1PKX A;  1PNL A;  2WLI B;  4TV8 B;  2Q7E A;  4DRX A;  1MMM A;  3OAA G;  1RFY A;  3SYA A;  1VQ5 V;  1GK9 A;  3JD3 A;  3ZX6 A;  1JOY A;  2F66 C;  3LNN A;  3HR0 A;  4UVA A;  3K3W A;  1RM1 C;  2BTO A;  2YSU B;  5FPO A;  5IY5 B;  3UO2 A;  4O4J B;  4O4I B;  4WFE A;  1PL4 A;  4JYY A;  5GTI Z;  3AG3 C;  2CTQ A;  2Y69 B;  1K4C C;  1M1K W;  2OT5 A;  3FX7 A;  4NXM O;  2YXH A;  3H1L H;  3UQ8 A;  2YXY A;  3GVM A;  1KUQ A;  2DWD C;  2CH7 A;  5CA1 A;  1O9G A;  5L3E A;  2ZE8 A;  3IAY A;  4FZ1 A;  2FL4 A;  2YI9 A;  4O2A B;  2JRI A;  5LMN O;  3K06 A;  3CRQ A;  1KYO F;  3OMI B;  3K57 A;  5LGU A;  4R6Z A;  2JS5 A;  5EIB D;  3LSQ A;  1TVK B;  3F5T A;  2RCV A;  3E8F A;  3QVN A;  4LH6 A;  5LYJ B;  5FPR A;  5LBQ A;  2CTR A;  1XNQ O;  3H01 A;  2YS8 A;  1BHB A;  5JJN B;  4LFB B;  2M6Y A;  1KBH A;  1F23 A;  3WG7 B;  4BAY A;  4O2B A;  3T1Y B;  2VQF B;  2BTQ B;  3CJH B;  4O4L B;  4ZHQ B;  5IYB O;  2LP7 A;  4TQD A;  4GKJ O;  2Y0I A;  2IW5 A;  4C7U A;  4YJ3 B;  5IJ0 A;  2Z3Y A;  4QPK A;  3SYC A;  2LO1 A;  3AEI A;  3JCZ A;  3L70 H;  3CJH A;  1BQ0 A;  4WFF A;  1U97 A;  3ZHS A;  5LXT A;  3D3I A;  2NLJ C;  3FAV B;  1XOU A;  1WP8 A;  3ZHU A;  4DO2 A;  3BPZ A;  4CBC A;  1BGY H;  2DYR C;  3MD0 A;  3EVK A;  4LF9 B;  1VQK V;  3DGE A;  1W0J G;  3E22 B;  3CCU V;  1WNS A;  2Q5Z A;  1H8H G;  4E4E A;  2ARH A;  2P6J A;  4RAI A;  5JCO A;  5ITZ B;  3IC9 A;  1XMQ O;  4D6T H;  1JMK C;  1VQ4 V;  2VQE B;  4PA3 A;  2WLL B;  2EIN B;  3HKD A;  4FPP A;  1NTZ H;  3E22 A;  3MHH C;  4RWU A;  2UU9 B;  1BE3 H;  2IJH A;  4QNH B;  1HP8 A;  2OIE A;  2XAJ A;  3DC5 A;  1S77 D;  2FML A;  1SKV A;  2QWQ B;  4UCO A;  1EZV H;  1MA1 A;  1QVG U;  1ZUQ A;  4I4T B;  1XMO O;  3UO3 A;  3EXA A;  3H1K H;  2UUC B;  2W6J G;  2QKA A;  4YY3 O;  3ZHR A;  1P7B A;  2IM9 A;  4I55 B;  2P7T C;  3BCC H;  4YIP A;  4X62 O;  3OEH G;  2YEV A;  3ZRW B;  1XI1 A;  3RGB A;  1Q43 A;  3ZIA G;  2P4K A;  4TWK A;  3CHX A;  4K8X A;  4B7K A;  2UUA B;  3K04 A;  1VQ6 V;  1K34 A;  4HNA A;  3JAR B;  1PM9 A;  2EIN C;  1F4M A;  4O4I A;  5K1X A;  1Y74 A;  2DOS A;  5IT9 N;  1R6K A;  3N2G A;  3RW0 A;  4P9O A;  2DN9 A;  4DR7 B;  4FK5 C;  3HKB B;  1YCI A;  5EZY A;  4PD4 F;  4JAS A;  1PPJ H;  4RUF A;  4RO2 A;  3FB5 C;  3OUS A;  4J41 A;  2PY5 A;  3BY6 A;  1Y66 A;  3SPH A;  1EM1 A;  4DUZ O;  1IDS A;  4CH3 A;  1NJI W;  1H38 A;  3OGI B;  3AG2 C;  2PZS A;  2N74 A;  4JI8 B;  4ZOL A;  1P4R A;  5J2U A;  5EZY B;  4DR3 O;  3ZMS A;  1H2L A;  4BWA A;  4DV4 B;  3W7X A;  4B08 A;  1HWY A;  3WU2 Z;  2AZ2 A;  1JX9 A;  3TXQ A;  1SQB H;  1BHA A;  1H2S B;  4N21 A;  3BAA A;  5E79 Z;  3HKC A;  4IYH A;  1YZB A;  2VQF O;  5J2U B;  3AK2 A;  5CBG A;  5IJ9 A;  1D5N A;  1N4C A;  4GKK O;  4UCU A;  1K97 A;  2BTQ A;  5CA1 B;  3JCU Z;  1RPO A;  4DUZ B;  4O4L A;  3WG7 C;  1Z5W A;  5B1B B;  1RM1 B;  1AP6 A;  2A06 H;  1AVM A;  5EC1 C;  3ETG A;  5IJ9 B;  4LCU C;  1K92 A;  4JF3 A;  1ZLZ A;  3JAW B;  3P3N A;  5L3G A;  2DQ0 A;  3K9A A;  2UUA O;  4LNU B;  5EIB C;  2ODM A;  5KHK A;  2X6B A;  5LYJ A;  3JAT B;  4YJ2 A;  1YF2 A;  1QBZ A;  2JEU A;  4G27 B;  3DXR B;  3JD0 A;  2GUZ B;  4FMT A;  1GN6 A;  4ZIB A;  2AGA A;  4XDK A;  3UCS C;  2GDS A;  3QO8 A;  1HNZ O;  1XIL A;  3LDD A;  3ZMV A;  4JTD B;  3OD4 A;  5KAF Z;  1J95 A;  5LP6 A;  4U7O A;  1JFF B;  1JVM A;  3ETD A;  2P22 C;  3DXR A;  1YSC A;  3AG1 C;  4DUY O;  4UB8 Z;  4MTF A;  2ITC C;  3OUF A;  3OTF A;  2Q73 A;  4IYI A;  4W4K A;  2HG5 C;  3A0H Z;  1NKD A;  2R70 A;  3CRA A;  1M5I A;  4MVO A;  3CX5 F;  3T1H O;  4IIJ B;  2YUA A;  5L3F A;  4DV6 O;  2XHB A;  4U3J B;  4MVZ A;  4X88 A;  5HFL A;  2WWW A;  4YXW G;  4TQF A;  3STL C;  2EIL C;  1GO3 F;  5KMG A;  1PNK A;  4MSW C;  2ZR2 A;  3JSN A;  5GON B;  1HR0 O;  1OCC C;  4JI7 O;  2RJZ A;  3P30 A;  1QCE A;  1HNW B;  4JI4 O;  4J7K A;  2FYU H;  1ENV A;  1GAX A;  2NN4 A;  3CYO A;  4O4H A;  3LNM B;  3VQW A;  4IT5 A;  4WF9 V;  1SES A;  2KG7 B;  2UUB O;  5JCO C;  1IZ3 A;  1FD9 A;  1LR1 A;  4TOI A;  4UCR A;  2B5U A;  2F95 B;  2A0L A;  2QTS A;  1Z5V A;  4CZZ A;  2D2C B;  3R66 A;  2YIA A;  1H2G A;  4AQY O;  4OPH A;  3BEH A;  2XAF A;  4LP8 A;  1NTM H;  5B3S C;  3JAL A;  2UXB O;  4X89 A;  1R3K C;  1SER A;  1SC5 B;  1QR9 A;  1VF5 B;  1KD1 W;  5J2T B;  3A8T A;  4IL6 Z;  1M93 A;  2P06 A;  2RQ6 A;  5B1N A;  5H2F Z;  5BMV A;  1BZK A;  2O57 A;  3CCQ V;  1OCZ B;  1YEW A;  2W6I G;  3CP1 A;  4I55 A;  4PHZ A;  1R3I C;  1AR4 A;  4UB6 Z;  4B7E A;  3D3Q A;  4ABM A;  1ZWI C;  1XNQ B;  3HKE A;  4OGQ B;  4YHH B;  3K5L A;  2DWE C;  1VF6 A;  1M57 C;  3SJC C;  5K1P A;  3CCR V;  1Y76 B;  1AJP A;  2QKC A;  4GZR B;  2IH3 C;  2P90 A;  3ML0 A;  4GUN A;  5JJE B;  2LFS A;  1ROP A;  3KG2 A;  2W0X A;  4DK1 A;  5JQG A;  1AJN A;  1M90 W;  2LJ2 A;  2EIM B;  5E1A C;  4FLX A;  4X1K B;  4PDV A;  4ASU G;  2E3C A;  1N33 B;  1E1Q G;  4JI5 O;  2UXD B;  3KDR A;  3CXH F;  1AI5 A;  4DR4 O;  4H33 A;  2ZR3 A;  1R6T A;  3T1C A;  2BOB C;  2QM7 A;  2C2A A;  3L73 H;  1SS3 A;  4X1I B;  4Z2W A;  1Y67 A;  4ZOL B;  1VF6 C;  1TUB B;  4DXW A;  3CCV V;  3BA8 A;  3O65 A;  2CH7 B;  4JPR A;  2OTL V;  1OHH G;  1EN5 A;  2ZE6 A;  3J81 N;  4MS2 A;  4JI0 O;  2WAM A;  5B1O A;  3JAS B;  1TUE B;  2DJV A;  4J42 A;  4KUM A;  1IBL B;  3E2E A;  1QR8 A;  1WPB A;  3QTC A;  1M56 C;  4I0X B;  4QJF B;  4R50 A;  1WN7 A;  2Z5U A;  1OJH A;  1RSO B;  4PDR A;  1XQ8 A;  3CRM A;  5A2Q N;  1QU7 A;  3RBZ A;  4FFB A;  2CK3 G;  2QTO A;  4CH6 A;  1AP5 A;  2AHY A;  1XHZ A;  4EB6 A;  5CMU A;  2GV9 A;  2XAH A;  4UCT A;  1FS0 G;  1HNX B;  3HPL C;  1J5E O;  2Y69 C;  4DR1 B;  2F1M A;  1RSO A;  1V9P A;  1LUV A;  1Q3E A;  4QE9 A;  2QWR B;  3T1H B;  2Q0O C;  2ZIO A;  4ZHQ A;  2E5L B;  1PV0 A;  3G80 A;  5FLX N;  3P3P A;  2OTJ V;  3L71 H;  1US6 A;  1K7D A;  4DYL A;  2L35 A;  5ITZ A;  2P5O A;  4BIZ A;  1AB3 A;  2CGO A;  1VQM V;  5CB4 B;  3C3S A;  2YID A;  4X65 O;  4YJ3 A;  3DC6 A;  3SJA C;  2ZCE A;  4JYC A;  4UXN A;  3T4D A;  3ZHQ A;  1KMI Z;  2PF4 E;  2HKO A;  3GWO A;  3L75 H;  2DQ3 A;  1P7G A;  1I5Y A;  2VWK A;  1JFF A;  4MT8 A;  4X66 O;  5JVD B;  1E79 G;  5C8Y A;  2ZDI A;  1FKA O;  1K5Q A;  2V1D A;  3C3T A;  5DN6 G;  1L1F A;  3VQV A;  1VF7 A;  3ABL B;  1Q6H A;  4IIJ A;  4LBE C;  2GBO A;  4DW1 A;  1PNM A;  1ZL8 A;  1X59 A;  3AG3 B;  5KHG A;  3TGU H;  5H5N A;  4DV3 O;  3AG4 B;  4JZG A;  3ASN B;  1Q7Y W;  3ABU A;  1XRE A;  1I5X A;  1V55 C;  1I94 B;  3VOU A;  1SQX H;  2E76 B;  1PL0 A;  3D36 C;  2GTS A;  4O4H B;  2KKW A;  1I94 O;  3M99 B;  4J7J A;  2B1I A;  4LF6 O;  1XNR B;  3OE7 G;  1LUW A;  1SQF A;  2Q6A A;  1K73 W;  4QGP A;  2R9R B;  4MW8 A;  2DW4 A;  2ZNJ A;  5EBL C;  1Q81 W;  3B40 A;  2E75 B;  5GW7 A;  2OWO A;  1CXZ B;  1Q82 W;  4B3R B;  4K0K O;  5CN0 A;  1ZTE A;  2OCC C;  2JS3 A;  4LF8 O;  1E1R G;  2ZE7 A;  3BRC A;  5KHJ A;  4UFZ A;  3JAL B;  4EKW A;  1XEQ A;  5J2T A;  5B1A C;  2ADP A;  4WBN B;  4PJ0 Z;  4GT1 A;  4JAA A;  2ILM A;  1H2N A;  3RN4 A;  3SYP A;  3SGI A;  1L0N H;  2LW1 A;  3I55 V;  3HKE B;  2X6C A;  1N36 O;  5KUM A;  3PJS K;  3B09 A;  2WSS G;  4E2L A;  4BIO A;  4P9P A;  2AXT Z;  4GCZ A;  1H2M A;  2H94 A;  5LMN B;  2EZO A;  2RNB A;  2JJ1 G;  1Y4M A;  2VRZ A;  5KUK A;  1BT8 A;  2A3Q A;  2EUL A;  1G8M A;  1J5E B;  2JEX A;  4D7T A;  2PYL A;  1QLE C;  3RFR A;  4OX9 O;  1YTF B;  1XDC A;  1JJ2 U;  1S5L Z;  1EN6 A;  1W59 A;  5LHH A;  1IBM B;  3X2Q C;  2M7W A;  1K4D C;  4DV5 B;  2WA4 A;  5BR8 B;  4DK0 A;  4IHJ A;  5IE9 A;  5D5P A;  1SF9 A;  1GM8 A;  1IBL O;  4DUY B;  1SQV H;  4U3F H;  4KL1 A;  1DF5 A;  3FFQ A;  1IXM A;  1HNZ B;  3OT7 A;  1D2D A;  1M9N A;  4DW0 A;  3ABL C;  2W0F C;  2N05 A;  4P2Z A;  1RP3 B;  3ICX A;  1YHQ V;  1NU1 H;  3C90 A;  3SJQ C;  3N2K B;  3JAT A;  4KXR A;  3OM3 B;  2WLN A;  1IJG A;  4UVC A;  4P30 A;  4DV7 O;  3S3X A;  4TV9 A;  3DSQ A;  4JI1 B;  2LGQ A; 
#chains in the Genus database with same CATH homology
 4FFK A;  1GN4 A;  1EN4 A;  1QNM A;  4E4E A;  3KDR A;  1P7G A;  3IC9 A;  1MNG A;  1I08 A;  1N0N A;  1B06 A;  1N0J A;  2CE4 A;  1Y67 A;  3C3T A;  1JR9 A;  1SZX A;  2AW9 A;  1VEW A;  3AK2 A;  1I0H A;  1D5N A;  1BT8 A;  1MSD A;  1GN2 A;  1VAR A;  4F6E A;  4X9Q A;  3DC5 A;  3TJT A;  1EN5 A;  2RCV A;  3K9S A;  5AG2 A;  3QVN A;  1XDC A;  3KKY A;  1EN6 A;  1MA1 A;  1ZUQ A;  1AP6 A;  1BSM A;  4JZG A;  1AVM A;  1IX9 A;  3AK3 A;  1XRE A;  1ZSP A;  2QKA A;  4JZ2 A;  1ZLZ A;  1KKC A;  4YIP A;  5A9G A;  1IXB A;  1JA8 A;  3LSU A;  2P4K A;  1AP5 A;  1LUW A;  1WB8 A;  3CEI A;  2ADQ B;  3BFR A;  3MDS A;  1BS3 A;  2CDY A;  1PM9 A;  4BR6 A;  3AK1 A;  1GN6 A;  1GN3 A;  4C7U A;  1XUQ A;  1ZTE A;  3OT7 A;  1MMM A;  1AR4 A;  2GDS A;  1LUV A;  1XIL A;  2ADP A;  2QKC A;  1EM1 A;  1IDS A;  1WB7 A;  4GUN A;  4YIO A;  3EVK A;  1PL4 A;  3C3S A;  4JYY A;  3RN4 A;  3DC6 A;  1AR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...