1I0HA

Crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
b'SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE Y174F MUTANT
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i0hA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i0hA02
3OT7A 4JYYA 1EM1A 3TJTA 3DC5A 1EN4A 1EN5A 4F6EA 2RCVA 4BR6A 1AP6A 3LSUA 1KKCA 4X9QA 3BFRA 4YIPA 1PL4A 3KKYA 3QVNA 1N0JA 1XUQA 4C7UA 1IXBA 4YIOA 1VARA 1QNMA 1N0NA 1AR4A 1MNGA 5AG2A 1BS3A 1D5NA 2P4KA 3AK3A 1ZTEA 2AW9A 1JR9A 1IX9A 1AVMA 5A9GA 1GN3A 1MSDA 1GN4A 1VEWA 2QKAA 2QKCA 2ADQB 4FFKA 1WB8A 1XDCA 1WB7A 1GN2A 1GN6A 1XREA 3EVKA 3C3TA 1BT8A 1I0HA 3DC6A 2CDYA 1I08A 1ZSPA 4JZGA 3CEIA 4GUNA 2CE4A 3AK1A 3RN4A 3C3SA 1XILA 2ADPA 1Y67A 1BSMA 1IDSA 1EN6A 1LUWA 4JZ2A 2GDSA 4E4EA 1B06A 1ZLZA 3K9SA 1JA8A 1MMMA 1MA1A 3IC9A 1PM9A 1P7GA 1SZXA 3AK2A 3MDSA 1LUVA 1AR5A 1ZUQA 1AP5A
chains in the Genus database with same CATH superfamily
5KAIZ 1V9PA 3B4SA 3RYFA 4ASUG 5BMVA 4YY3O 1EN4A 2WAMA 5ITZA 5D5QA 3JARB 5H6QA 5FPRA 4Z2WA 4XDKA 1H2KA 1VQLV 3UO2A 5LL6Y 4F6RA 3P30A 2FYUH 2UUAB 2DQ0A 4YJ2B 2BTQA 1WP8A 2EILB 1VP7A 4GYCB 2K1EA 5B1OA 3TCUA 2ITCC 3FB5C 5DECA 1P49A 3RYHB 1BCCH 4OPAA 1BHBA 1FXKC 3SYCA 4LFAO 3OGCC 2WA4A 2QA4V 2WA3A 3EXAA 1JR9A 5KHKA 4IYIA 3ZRSA 3RWRD 1P4RA 2RDCA 2Y0IA 2PY5A 4XDLA 1XBLA 2LGQA 3LNMB 4B3RO 4I55A 4DV4O 2QKAA 3OTOO 3A0HZ 2ZNIA 4DUYB 2ADQB 5LBQA 3E86A 5JJJB 3CXHF 1F4MA 4EKWA 5FNVA 2BSKA 5HFMA 4NXMB 4UB6Z 4UV8A 1Q43A 1Q6UA 4NVPA 1WJZA 2P06A 4J7JA 5B66Z 4O4LA 4JYAB 3FYIB 4R7CA 4JV5O 1F51A 1I08A 2YIAA 1FXVA 2LGWA 1NKDA 2ZM6O 4GKKO 2CUGA 2X6BA 3ASOC 3ETGA 4J42A 3H1KH 5K1PA 5EC2C 4LF7B 4NTYA 2OCHA 1GO3F 1EN6A 4B3MO 2YEVA 2DYSC 1WA8A 4TT3G 3ICXA 5KUMA 3P3PA 1JA8A 4GX5A 5DN6G 4EFEA 1QQCA 3CYOA 1SF9A 2F66C 2LW1A 2CH7A 5KMGA 2CGNA 3J7AU 2UXNA 3CC2V 3ZS8C 1H2NA 5IYZA 2IM9A 3T4ZA 3U11A 3OEEG 4LH6A 2GHYA 2H8PC 2R72A 4H0LB 3L71H 3CCQV 5H5NA 5FL7G 1Y6XA 3RGBA 4B3TB 1OCRB 1OCOB 3FB6C 1US6A 2OWOA 1N0JA 3FYEB 2V4DA 3UT5B 1L0LH 1Q86W 1VQOV 1VARA 3QO7A 1N0NA 3CJHB 3JAWA 1F23A 4LF8B 2O57A 4IGGA 2JEXA 1KECA 5J2UB 3TETA 3MD0A 3CP1A 3ASNB 3E83A 4FLZA 1AVMA 4DV6B 2OCCC 1GN4A 4X66O 3DXRA 3LDDA 1M93A 3ZMZA 2PGGA 4HBNA 2JS5A 1DLBA 4DR4O 5KHIA 2B5UA 1JFFA 2DJVA 1PV0A 5J2TA 3ZBHA 2QWNB 3P3NA 2PTMA 1IURA 3OAAG 2ZD9A 3EVKA 3B77A 1K33A 5BR8B 4X89A 3DC6A 2QM4A 3FB7C 2X0LA 1RM1B 3AG4C 4J11A 1PP9H 5GTHZ 1XILA 4IHJB 3IGAC 1HNZB 4JI8B 4QPKA 1XMOB 3AG3B 5IT9N 2ZE8A 4NXNO 4ZHQA 1SA0B 3RYCB 4JI1B 5BY1A 3ZMUA 1A32A 2PYLA 1S5LZ 2EJRA 3JD0A 1PM9A 4DV7B 1QR8A 1O9GA 2BOBC 2EIJB 1XMQB 1LUVA 2FKXA 3JSNA 4DR3B 4FM2A 1EN5A 4OPHA 4L87A 5IWAB 4KFMA 1J5EO 2HP8A 3ZHRA 4B7EA 4Z1MG 5JVDA 2Q9LA 1XNQO 1JX9A 3L70H 2WLIA 3ZRWA 3N2KA 2N05A 4TQDA 4B3SB 3KKYA 5LHGA 4O2BA 4U3FH 5LHHA 3JATA 2KSDA 2JGDA 2Q0AA 1YDXA 4PA6A 3R65A 1CXZB 3G80A 3P32A 3JCUZ 4JI4O 1VQ4V 3IAYA 4WF9V 1GAXA 2OTLV 3JASB 1KMIZ 5CA0A 1TGOA 3ZMSA 1M56B 3HKCA 1H5WA 4DR2O 2UXCB 1RFYA 2ZNJA 2DWDC 4X62O 3T1CA 4LF6O 4DV3O 1HNXB 1M57B 3N2GA 4CH4A 1YJNV 2WLHA 1G4YB 2E76B 2P67A 4DV5B 4OGQB 5BXZA 5JQGA 1TAEA 5F2VO 1RSOB 2R9IA 1OCCB 4DUZB 3SPIA 1MZFA 2IU0A 3VQWA 3SJCC 2EINC 1PKXA 3CMEV 4JYCA 1I0HA 4LBEC 2ZE7A 4HNAA 4I5SA 3CWBH 2HFEC 3H01A 4G27B 5CA3A 3E35A 4W4LA 2Z0AA 4LNUA 2R9AA 1N33B 1YCIA 1VQ9V 3FX7A 2GSMB 2EBOA 1PNLA 1Y76A 1EFRG 5KX5A 3RBZA 4QPJA 3DGEA 1JJOA 2AZ0A 2WSSG 2RQ6A 3BCCH 2OIEA 3KZIZ 2DYRB 1QR9A 1KD1W 3T1YB 4UVAA 4O4IB 3DC5A 1SESA 4DR1O 1BMFG 3RVZA 1RPOA 1AR1B 3AG2B 2R70A 3SPHA 3ABKC 4K8XA 4JI5B 5IY5C 4I7ZB 1HR0O 1K73W 3SYAA 3CCVV 3HKEA 1S3JA 2VWJA 4C7UA 2WLJA 3MAQA 5B3SB 4X88A 1I5YA 3UM7A 4DW1A 1IXBA 3WG7C 4JAAA 4RAIA 3FFQA 3THOA 5EIBC 4K3AA 5CBHA 1GH6A 5JJNB 1XL4A 1YHQV 4LFCO 2EZOA 1NI8A 1Z2GA 4RUEA 4X1IB 1AILA 5IYBO 2YUAA 3MHSC 1SETA 2W6JG 4QIWF 1QHTA 1NVPD 4MVRA 3TK1A 4J7ZA 2UXDB 4YJ3B 5LXTB 4DV1B 1K7DA 3S3WA 1M9NA 3K79A 2NR5A 4WFGA 2YIBD 5IJ9B 1NR7A 4HZ3A 4K0KB 1XL6A 1YTFD 2JDIG 4RO2A 3C3TA 1Q6HA 2QJ1A 3G71V 1YVWA 1VQ5V 2YI9A 4X1YA 4BW5A 2ZXWB 3EFFK 3W7SA 4G28B 4DR7B 5C93A 1FJGB 1Q82W 4I0XB 3CCRV 4DR6B 5E79Z 1QVFU 3W7WA 5LHIA 2QR4A 3BAAA 4TUYB 4ZOLA 4CC6A 1YF2A 4DR5B 4AILC 1I94B 1ZWIC 2GUZB 4K35A 2ZE6A 1AR5A 2YS8A 1SZTA 3UCSC 2A79B 4I55B 3D36C 4W4KA 2IJIA 1OHHG 4R6ZA 5A2QN 4LFBO 1B3QA 3CRMA 3JYCA 4MW3A 1ZL8B 4LP8A 2BOCC 4PDMA 4B7KA 2BSKB 1PL4A 1EBOA 1SQQH 3K03A 4O4HA 3L9DA 3VBBA 1WP7A 4FM1A 4AQYB 3TXQA 3OUFA 2Q0OC 4YY3B 4OX9B 1QNMA 2IJJA 2WLLA 1K4CC 3JCZA 1AJQA 2HVKC 3CE2A 4FMTA 4LWSA 2UU9O 1D2DA 2EIKC 2ZINA 2PI5A 1MSWD 1OCZB 4MTXA 4WBNB 1MSDA 1FXKB 1FAFA 2B9ZA 3ZEDA 4LCUC 1BQZA 2CH7B 2M7WA 5KMGB 1FFTB 2EJ7A 3OD4A 3JAKA 2DN9A 3CRAA 4P30A 3ZX6A 4UCSA 3ABMB 3STZC 5CMUA 3A0RA 3OFNG 1JNBA 3IC7A 1R73A 1IBLO 3OMIB 1GM8A 4JI0O 5L3DA 3ZRXA 1FFXA 5KA5A 1FXHA 2Q68A 1FS0G 4P9OA 2ARHA 4MW8A 1QBZA 1NVPB 1UPGA 2VQEO 1GM9A 4EEQA 5GONB 2JRIA 2JIZG 1KBHA 3IC9A 4TSFG 2QTOA 4GT1A 2AHYA 4X65O 1YTFB 1K9MW 3CPWU 2GTSA 4KP4A 3T2MA 2IW5A 3F7VC 1BQ0A 1VF5B 3SYOA 4KL1A 4B3MB 5LP6C 2ITDC 3LSUA 2DWEC 3VQVA 2KB1A 1U96A 1EZJA 1IJGA 1HNWO 5EYPB 5IJ0A 3FAVA 3SYQA 2ODMA 4U3JB 4JPRA 4Q20A 1NR1A 3CCEV 2QWOB 3OR7C 4IIJB 1B6QA 1UJWB 2Y0PA 3O9OA 4PI0A 2FL4A 3L73H 4NKGB 3QF7A 1IX9A 1IBMB 1U97A 1S76D 2WLKA 1N4CA 1VQ6V 2YDEA 4DW0A 2D3OW 1XI1A 3APQA 1MOFA 1P7BA 4LF9O 1QLEC 2E3CA 4R50A 4I50B 5LP6A 3VQXA 1SQBH 4FFBB 2X6AA 3E22B 4ZKIA 1YIJV 1N34O 4CH3A 3K5MA 4X66B 5CBGA 2MK3A 2CE4A 4X64O 3C3SA 4MTFA 5B1AB 4JI7O 4DR4B 4FLWA 1Y67A 3ZN1A 1BSMA 2QWQB 2QM7A 4BIZA 3UKMA 1VQKV 5CA1A 2P4VA 3SR2C 2UUCO 1I5XA 3FKSG 5LMUO 3LSSA 4MSWC 3X2QB 2Y69C 4YHHO 3GWOA 1SC5B 3G6EV 1S0VA 3BA8A 2QM8A 2QDOA 4JI2O 4KHPB 2CTQA 2YXYA 3KCXA 2AZ2A 3CX5F 5IYDO 4BW9A 5LOVA 4H33A 2KG7B 3A2FA 2DW4A 5DM6V 1R1BA 2VQFO 2P7TC 2F1MA 3Q4HA 4EB6B 5DEDA 5EZYA 1MG1A 3KCYA 4FVMA 5HFLA 2LO1A 3SJQC 1TVKB 1SERA 4FLXA 4MVZA 5EBMC 1M1KW 4MTGA 3L72H 4JTDB 5K1XA 1F4NA 1K5SA 1S77D 4GCZA 1YITV 4JI4B 4DRXA 2YXHA 4OXSA 3OW2U 1RP3B 2CAZC 4WFHA 4J9ZB 2ZDIC 4FFKA 4JGSA 4TV8A 1RPRA 2M6YA 4DV2B 4I9WA 5E1AC 1DGSA 3J80N 1FYJA 3CS5A 2BCCH 4DO2A 1AJPA 4D7TA 4FM0A 1VF6A 1TUBB 3H9VA 5JH7B 2LP7A 3D3QA 3JSLA 1WPBA 1GRJA 2XHBA 1AI7A 1R3LC 1JJ2U 1GTOA 2IH1C 1ZLZA 1V55B 3APOA 3K9SA 1P7GA 1SZXA 4FZ1A 4JF3A 4O4JB 4CS3A 3AK2A 1IVSA 4AQYO 1N32B 3JALB 1BGYH 3C90A 4DUYO 2Q69A 4ZI7B 3K5LA 4TV9B 2PF4E 4BIUA 4BR6A 3K59A 3ZMTA 2Q8VA 4YIPA 4X20A 3ETDA 3OMNB 2HHHB 3AG7A 1QVGU 1Q3EA 2ZDIA 4JYAO 2B1IA 1XUQA 2Q7HA 2IJKA 4X1KB 1GM7A 3OE7G 5IY5B 3I56V 3JARA 5L3FA 4TOIA 1KYOF 1M5IA 1KP3A 2CTWA 5J9PC 1FPOA 4JI6B 1NU1H 1NBMG 3ABLC 1WLEA 4MVSA 2P4KA 4JI3O 3WG7B 4WFAV 4ZOLB 3L74H 4YJ2A 2E5LB 1V54C 1Q81W 2A06H 2QGNA 1ROPA 2GTAA 1N36O 1Y74B 1NTMH 3BABA 3K57A 5GTIZ 3LDEA 4LFCB 4ZIBA 4GKJB 3E8HA 2XAQA 1XREA 1X59A 3QO5A 3HKBB 2PYJA 4L8JA 3A0BZ 4JZGA 1W0JG 3KDRA 4O4HB 3LDCA 5LYJB 3JD3A 4HYOA 4LF8O 1VQ8V 2Y4TA 4H44B 1K8AW 2XNDG 3NXSA 1NJIW 1MMMA 4GX2A 4LWSB 2ZIOA 4DV6O 2PZSA 3CC7V 3SGIA 3ASNC 2E74B 4O2AB 5JCOC 2LW7A 5TISZ 1VQ7V 2RNBA 4F4LA 5B1BC 1XNRB 2EX3A 5L3BA 3UO3A 3BRCA 2LFSA 4RWUA 3CCJV 3ZHUA 4JAVA 4BWAA 2IH3C 2UXBB 3H1LH 3AG1C 1N8RW 4PA7A 4JTAB 3QG5A 3H1IH 4UFZA 1RM1C 1HNZO 4JI8O 1XMOO 1PD3A 1SRYA 3HR0A 3T1HB 1COWG 5CB4A 2F4VO 4Q6GA 1NH2D 2UXXA 3UT5A 4DV7O 4NB5A 1K5QA 4J80A 3B8NA 1XMQO 1PNMA 2DQ3A 5C8YB 4WCEV 4DR3O 5LA6B 3CJHA 5JJEB 2EIKB 4RQFA 5J2UA 2EIJC 2NLJC 5IWAO 1OZ0A 5LMNB 1YI2V 5JCOA 1S5JA 3CB2A 2UU9B 1E79G 5EK0A 3NR7A 1S5HC 3K9AA 4P9PA 4LF5O 4I4TB 1KUQA 4PA3A 3HKDB 1K92A 3JD1A 2ETNA 4CH5A 4DV0O 3RYFB 2CTPA 5BMVB 1HDJA 1H2SB 5ITZB 1D5AA 4RUFA 3N27A 2UXCO 1L8DA 1PNKA 3S3XA 4QE9A 4JI0B 1MZEA 1M56C 4F6RB 2JK5C 3AEIA 1URFA 3B40A 3ML0A 4IHJA 2BTQB 4DV5O 3F5TA 4PELA 1BHAA 4UCRA 1M57C 1SA0A 3RYCA 4DUZO 1R3KC 2E75B 2VS0A 5CN0A 3PN1A 3A8TA 3LUTB 1IBKB 2UUBB 4LF4B 1OCCC 1NT2B 2ZR2A 4XDJA 2L35A 1N33O 4UCOA 3W7XA 1XEQA 1G8MA 4WFEA 5IE9A 2A7WA 4KXRA 2AGAA 2HKOA 5FNVB 2ILMA 1Z5WA 2PUSA 1TA8A 1DK1A 4GLXA 4O4LB 1DTOA 2HEPA 4PDRA 1KB9F 3QO8A 2DE0X 5KUKA 1EZVH 4G2KA 4JASA 1QLNA 4JI5O 1WB7A 2XAGA 2YEVB 4FJCC 1WA8B 4LH7A 3AG2C 4MVOA 1WAZA 1VQNV 4UV9A 3PJSK 3FD9A 1RSOA 5KLVH 3U0ZA 1NH2B 5IYZB 5B3SC 4LF9B 4LFAB 2V1DA 3GVMA 4J7KA 3CCUV 1G1XB 4E4EA 3ZHVA 4MT8A 1YJWV 3MHHC 2N04A 1N34B 3OGIB 4B3RB 2HJFC 4DV4B 2UXDO 1ZUQA 3OTOB 4DV1O 1EM1A 2V7QG 4MTOA 1ZX3A 4DRXB 1P84F 2Q7GA 4FLTA 2QE7G 1NS1A 1KP2A 4K0KO 3JAWB 4IL6Z 5KHJA 1GK9A 5EBLC 3DSQA 4FK5C 3ASOB 1YEWA 1DF5A 3QVNA 3VOUA 4JV5B 2Q73A 1OV9A 3E8BA 4HAMA 3M7MX 4O4IA 2ZR3A 2DYSB 4DR7O 2ZM6B 4GKKB 1FJGO 3HB3B 4B08A 2MW2B 5H9CA 1HW7A 1WNSA 4DR6O 4QGPA 4PA9A 5L3CA 3DXRB 3CCSV 1MNGA 3BA9A 1D5NA 1R6NA 1ENVA 1JFFB 4DK1A 2AW9A 5J2TB 3K0GA 2Z3YA 1I94O 2XOKG 4UVCA 2VQFB 4QE7A 2DOSA 1SS3A 1SQVH 2JEUA 4X1IA 1SQFA 1GMGA 4GX1A 1THZA 1W2BU 4ZHQB 4QJFB 4YJ3A 1YSCA 5LXTA 1AB3A 4LR3A 2K9PA 2LQTA 1H2LA 2WLMA 1YJ9V 3RN4A 3CD6V 4OX9O 5IJ9A 4WFFA 1VIBA 1AI4A 1LUWA 2OCCB 1IXMA 5LGUA 2QWRB 2KQXA 2Q67A 2HLDG 2P6JA 1O9HA 5JVDB 4YXWG 4FLVA 3B2EE 1MA1A 3ETEA 3ZJZA 1ORQC 2WLIB 2X7RB 1F7YA 3ZRWB 3N2KB 4I0XA 3KG2A 1B04A 4O2BB 4JTCB 1PL0A 3JATB 2JGDB 1Q7YW 4WFBV 1K97A 1M4UA 4TUYA 1OCZC 2RCVA 4FZ0A 4E2LA 5D5PA 1NTKH 4P2ZA 1W59A 2EIMC 2VRZA 5CA0B 3ABTA 2GUZA 3AG4B 3HKCB 5H6RA 2HG5C 3ABMC 2G38A 3ETQA 3G4SV 2RJZA 3N2GB 1MABG 1XOUA 4CBCA 1ZL8A 4PI2A 5EIBD 5JQGB 4NXNB 5EBWC 3JD4A 1PPJH 1VF6C 1E1QG 3E8FA 3K3WA 3QNEA 4IT5A 3ABLB 1R3IC 4HNAB 1NQTA 1X4TA 5IDJA 1V54B 4LNUB 3RW0A 3ZHSA 1J5EB 1XNQB 1SQXH 1WB8A 4JI3B 3ZMVA 3STLC 2L6LA 3CCMV 4WBNA 1FXKA 4MVMA 1BT8A 1Y76B 3GWKC 5EC1C 2CDYA 1YZBA 5KX5B 5IYCO 1N36B 3CXCU 2KKWA 1NZ6A 3BVOA 2ADPA 3SPCA 4JYBA 4NTWA 3CSXA 4DR2B 5H2FZ 4RQEA 4X62B 4LF6B 1IBMO 4DV3B 2JJ2G 1VQMV 5CB4B 3UQ8A 3RYIA 3H1HH 4MVUA 2UUAO 2R9RB 3ZIAG 3HKEB 2P22C 4JYYA 3TJTA 1JPXA 2EINB 5GONA 2F23A 2FTKA 3OM3B 1AP6A 3CCLV 3H1JH 2YSUB 2EILC 1UFIA 2N74A 4FLYA 1JVMA 2A0LA 2YIBA 1OJHA 4FPPA 3OTFA 1CEZA 4FIPC 5B1BB 2CGOA 3WB2A 3F7YC 2Y4UA 2HR3A 5EYPA 1CPYA 1ZTEA 1Q90D 3AK3A 3G67A 4NXMO 5B1AC 3AG1B 4U3JA 3GB7C 1BE3H 4K8ZA 1I7FA 3J81N 4NYKA 2F93B 4A5UB 4IIJA 3K0DA 3ABKB 3WU2Z 1R6KA 3I5DA 2QKCA 4X1YB 4CS4A 4CZZA 5KHHA 4DR1B 2XAJA 1SQGA 4UXNA 2D2CB 4LF7O 3X2QC 4KHPO 2CTRA 3O65A 2JGUA 3M99B 1HR0B 2YXLA 2F4VB 3TXSA 3SYPA 1ZSPA 1R3JC 5L3EA 3RYHA 2QWPB 1CP9A 1DF4A 1W0KG 4I9QA 3AK1A 2QKSA 1J95A 3K06A 5GW7A 3SPJA 4XBFA 5B1NA 4I50A 3CMAV 3DTUB 2OTJV 4PA4A 2AXTZ 4FFBA 3SJAC 3E22A 1HP8A 1L0NH 4B3TO 4LF5B 3RVYA 2JJ1G 2EZPA 3T4DA 5B5EZ 2OIGA 1VMGA 4CS2A 2Q5ZA 2YC0A 2DMXA 3W7TA 3K5NA 3OT7A 1OCRC 1OCOC 4UB8Z 4DV0B 4F6EA 1H8HG 2P90A 1H2GA 3RT3C 3ZRVA 2IJHA 3U10A 1KKCA 4N23A 4TWKA 2WLLB 3BFRA 4DV2O 5BZBA 2XT9A 2Y48A 4U7NA 4MVQA 3FB8C 3SPGA 1AR4A 3F5WC 3OEHG 1YXBA 2QSAA 5JWPA 1H38A 3JAKB 1K3EA 1LR1A 2KG7A 2QEXV 1HWYA 5BR8O 3CRRA 4D7SA 1Z5VA 1VEWA 4D6TH 4EB6A 1N32O 1V55C 1FFXB 1XQ8A 4BIOA 1TVKA 3OMAB 4LFBB 3CRCA 2EULA 4H37A 4PDVA 4PJ0Z 2HHHO 4DXWA 4JI1O 4UCTA 4PD4F 2YI8A 3E2EA 2HVJC 5KAFZ 3AG3C 4PV1B 2NNUA 3E8GA 1SQPH 3CC4V 1Y4MA 1WN7A 1IDSA 4JI6O 2XAFA 3OR6C 2AHZA 3LNNA 3JAMN 4EFBA 2VWKA 1B06A 1BZKA 2ZQMA 2E5LO 1QU7A 4B3SO 4H13B 3I55V 1TUBA 5CBFA 4NTXA 2NN4A 3FAVB 3MDSA 5IJ0B 1KC8W 5JH7A 2OYQA 2GBOA 5FPOA 2F43G 5KA6A 2GV9A 4J9YB 1S72V 4GKJO 1VF7A 1AI5A 3D3IA 3HPLC 5LGNA 1E1RG 4O4JA 2P5OA 3TGUH 1IBLB 4TQFA 2ZKOA 2LJ2A 3VQYA 1HNXO 3JALA 4ZI7A 1JMKC 3QTCA 4TV9A 2Z5UA 1KQSU 1TUEB 3WFVA 2X6CA 2XAHA 2VQEB 1BS3A 3K04A 1QCEA 2HJDA 4X1KA 1Y66A 1VQPV 1GN3A 4X65B 5LP6B 2PI4A 2YIDA 2ZE5A 2ATKC 3ZHTA 1LNQA 3BPZA 4AHCA 1XNRO 2XTAA 3ABUA 4UCUA 1GN2A 1GN6A 4MS2A 1HNWB 2F95B 3WB1A 4GX0A 4N21A 3L75H 5CA1B 5L3GA 1Y74A 3JD2A 2WWWA 3CEIA 2UXBO 4GUNA 1R6TA 2FB5A 4BAYA 3JASA 3ZCCA 3WB0A 4UUJC 4DK0A 3T1YO 1IZ3A 2BTOA 2W6IG 4UCVA 3CRQA 2W0FC 1AROP 4X8AA 3HKBA 1AJNA 1NTZH 2CK3G 2DYRC 4ABMA 3K58A 3T1HO 5LYJA 1Q5OA 3R66A 3ZN0A 1JOYA 3ZHQA 2ZCEA 5LOVB 3BEHA 5FLXN 1QLEB 3IFXA 4KUMA 4DYLA 1KU9A 2A9HA 2IBZH 1AI6A 4JAUA 2H94A 1FKAO 3Q4HB 1KKDA 5LMNO 3D8CA 4FLUA 5EZYB 2FMLA 4X9QA 4NR1A 3E89A 3K08A 3SJBC 2ZT9B 2C2AA 3IJ4A 3B09A 2LFRA 1XHXA 1K34A 1G6UA 2W0XA 3BY6A 4O2AA 1JQ0A 1Q8IA 2EIMB 4ZBMA 4YIOA 4X64B 2XUMA 5KHGA 1M90W 2WPDG 4LC1A 4JI7B 1K4DC 1JCHA 1SKVA 2Q6AA 4PHZA 2Q4PA 2B1GA 1XHZA 1FOUA 5AG2A 1ZAUA 3D36A 1WPXA 2A3QA 4GZRB 1H2MA 4J10A 2Y69B 4TV8B 2UUCB 2OT5A 4J41A 3M8AA 4UVBA 3SDLA 5A9GA 4CH6A 1GKFA 5LMUB 3B8MA 2QTSA 3RYIB 1BL8A 2RN9A 4YHHB 4QNHB 2ZIMA 3LSQA 3OUSA 1Q6IA 3EHBB 1T5EA 2ZXWC 3K5OA 4JI2B 1XDCA 2JVDA 4Z1VA 3CHXA 4DR5O 2YICA 2BE3A 4AI8A 5C8YA 1IBKO 5LA6A 2UUBO 4LF4O 4R8CA 2RMKB 2WLNA 4U7OA 1FD9A 1H8EG 2Q7EA 5LGTA 3W7UA 3G6BA 1L1FA 2JS3A 3BHPA 2GDSA 4JZ2A 4ICGA 3RFRA 4CC5A 4I4TA 3HKDA 4IYHA 4X20B 4PDLA 2IU3A 2H3OA 1AP5A 2XASA
chains in the Genus database with same CATH topology
3OT7A 4JYYA 1EM1A 3TJTA 3DC5A 1EN4A 1EN5A 4F6EA 2RCVA 4BR6A 1AP6A 3LSUA 1KKCA 4X9QA 3BFRA 4YIPA 1PL4A 3KKYA 3QVNA 1N0JA 1XUQA 4C7UA 1IXBA 4YIOA 1VARA 1QNMA 1N0NA 1AR4A 1MNGA 5AG2A 1BS3A 1D5NA 2P4KA 3AK3A 1ZTEA 2AW9A 1JR9A 1IX9A 1AVMA 5A9GA 1GN3A 1MSDA 1GN4A 1VEWA 2QKAA 2QKCA 2ADQB 4FFKA 1WB8A 1XDCA 1WB7A 1GN2A 1GN6A 1XREA 3EVKA 3C3TA 1BT8A 1I0HA 3DC6A 2CDYA 1I08A 1ZSPA 4JZGA 3KDRA 3CEIA 4GUNA 2CE4A 3AK1A 3RN4A 3C3SA 1XILA 2ADPA 1Y67A 1BSMA 1IDSA 1EN6A 1LUWA 4JZ2A 2GDSA 4E4EA 1B06A 1ZLZA 3K9SA 1JA8A 1MMMA 1MA1A 3IC9A 1PM9A 1P7GA 1SZXA 3AK2A 3MDSA 1LUVA 1AR5A 1ZUQA 1AP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT7 A;  4JYY A;  1EM1 A;  3TJT A;  3DC5 A;  1EN4 A;  1EN5 A;  4F6E A;  2RCV A;  4BR6 A;  1AP6 A;  3LSU A;  1KKC A;  4X9Q A;  3BFR A;  4YIP A;  1PL4 A;  3KKY A;  3QVN A;  1N0J A;  1XUQ A;  4C7U A;  1IXB A;  4YIO A;  1VAR A;  1QNM A;  1N0N A;  1AR4 A;  1MNG A;  5AG2 A;  1BS3 A;  1D5N A;  2P4K A;  3AK3 A;  1ZTE A;  2AW9 A;  1JR9 A;  1IX9 A;  1AVM A;  5A9G A;  1GN3 A;  1MSD A;  1GN4 A;  1VEW A;  2QKA A;  2QKC A;  2ADQ B;  4FFK A;  1WB8 A;  1XDC A;  1WB7 A;  1GN2 A;  1GN6 A;  1XRE A;  3EVK A;  3C3T A;  1BT8 A;  1I0H A;  3DC6 A;  2CDY A;  1I08 A;  1ZSP A;  4JZG A;  3CEI A;  4GUN A;  2CE4 A;  3AK1 A;  3RN4 A;  3C3S A;  1XIL A;  2ADP A;  1Y67 A;  1BSM A;  1IDS A;  1EN6 A;  1LUW A;  4JZ2 A;  2GDS A;  4E4E A;  1B06 A;  1ZLZ A;  3K9S A;  1JA8 A;  1MMM A;  1MA1 A;  3IC9 A;  1PM9 A;  1P7G A;  1SZX A;  3AK2 A;  3MDS A;  1LUV A;  1AR5 A;  1ZUQ A;  1AP5 A; 
#chains in the Genus database with same CATH topology
 5KAI Z;  1V9P A;  3B4S A;  3RYF A;  4ASU G;  5BMV A;  4YY3 O;  1EN4 A;  2WAM A;  5ITZ A;  5D5Q A;  3JAR B;  5H6Q A;  5FPR A;  4Z2W A;  4XDK A;  1H2K A;  1VQL V;  3UO2 A;  5LL6 Y;  4F6R A;  3P30 A;  2FYU H;  2UUA B;  2DQ0 A;  4YJ2 B;  2BTQ A;  1WP8 A;  2EIL B;  1VP7 A;  4GYC B;  2K1E A;  5B1O A;  3TCU A;  2ITC C;  3FB5 C;  5DEC A;  1P49 A;  3RYH B;  1BCC H;  4OPA A;  1BHB A;  1FXK C;  3SYC A;  4LFA O;  3OGC C;  2WA4 A;  2QA4 V;  2WA3 A;  3EXA A;  1JR9 A;  5KHK A;  4IYI A;  3ZRS A;  3RWR D;  1P4R A;  2RDC A;  2Y0I A;  2PY5 A;  4XDL A;  1XBL A;  2LGQ A;  3LNM B;  4B3R O;  4I55 A;  4DV4 O;  2QKA A;  3OTO O;  3A0H Z;  2ZNI A;  4DUY B;  2ADQ B;  5LBQ A;  3E86 A;  5JJJ B;  3CXH F;  1F4M A;  4EKW A;  5FNV A;  2BSK A;  5HFM A;  4NXM B;  4UB6 Z;  4UV8 A;  1Q43 A;  1Q6U A;  4NVP A;  1WJZ A;  2P06 A;  4J7J A;  5B66 Z;  4O4L A;  4JYA B;  3FYI B;  4R7C A;  4JV5 O;  1F51 A;  1I08 A;  2YIA A;  1FXV A;  2LGW A;  1NKD A;  2ZM6 O;  4GKK O;  2CUG A;  2X6B A;  3ASO C;  3ETG A;  4J42 A;  3H1K H;  5K1P A;  5EC2 C;  4LF7 B;  4NTY A;  2OCH A;  1GO3 F;  1EN6 A;  4B3M O;  2YEV A;  2DYS C;  1WA8 A;  4TT3 G;  3ICX A;  5KUM A;  3P3P A;  1JA8 A;  4GX5 A;  5DN6 G;  4EFE A;  1QQC A;  3CYO A;  1SF9 A;  2F66 C;  2LW1 A;  2CH7 A;  5KMG A;  2CGN A;  3J7A U;  2UXN A;  3CC2 V;  3ZS8 C;  1H2N A;  5IYZ A;  2IM9 A;  3T4Z A;  3U11 A;  3OEE G;  4LH6 A;  2GHY A;  2H8P C;  2R72 A;  4H0L B;  3L71 H;  3CCQ V;  5H5N A;  5FL7 G;  1Y6X A;  3RGB A;  4B3T B;  1OCR B;  1OCO B;  3FB6 C;  1US6 A;  2OWO A;  1N0J A;  3FYE B;  2V4D A;  3UT5 B;  1L0L H;  1Q86 W;  1VQO V;  1VAR A;  3QO7 A;  1N0N A;  3CJH B;  3JAW A;  1F23 A;  4LF8 B;  2O57 A;  4IGG A;  2JEX A;  1KEC A;  5J2U B;  3TET A;  3MD0 A;  3CP1 A;  3ASN B;  3E83 A;  4FLZ A;  1AVM A;  4DV6 B;  2OCC C;  1GN4 A;  4X66 O;  3DXR A;  3LDD A;  1M93 A;  3ZMZ A;  2PGG A;  4HBN A;  2JS5 A;  1DLB A;  4DR4 O;  5KHI A;  2B5U A;  1JFF A;  2DJV A;  1PV0 A;  5J2T A;  3ZBH A;  2QWN B;  3P3N A;  2PTM A;  1IUR A;  3OAA G;  2ZD9 A;  3EVK A;  3B77 A;  1K33 A;  5BR8 B;  4X89 A;  3DC6 A;  2QM4 A;  3FB7 C;  2X0L A;  1RM1 B;  3AG4 C;  4J11 A;  1PP9 H;  5GTH Z;  1XIL A;  4IHJ B;  3IGA C;  1HNZ B;  4JI8 B;  4QPK A;  1XMO B;  3AG3 B;  5IT9 N;  2ZE8 A;  4NXN O;  4ZHQ A;  1SA0 B;  3RYC B;  4JI1 B;  5BY1 A;  3ZMU A;  1A32 A;  2PYL A;  1S5L Z;  2EJR A;  3JD0 A;  1PM9 A;  4DV7 B;  1QR8 A;  1O9G A;  2BOB C;  2EIJ B;  1XMQ B;  1LUV A;  2FKX A;  3JSN A;  4DR3 B;  4FM2 A;  1EN5 A;  4OPH A;  4L87 A;  5IWA B;  4KFM A;  1J5E O;  2HP8 A;  3ZHR A;  4B7E A;  4Z1M G;  5JVD A;  2Q9L A;  1XNQ O;  1JX9 A;  3L70 H;  2WLI A;  3ZRW A;  3N2K A;  2N05 A;  4TQD A;  4B3S B;  3KKY A;  5LHG A;  4O2B A;  4U3F H;  5LHH A;  3JAT A;  2KSD A;  2JGD A;  2Q0A A;  1YDX A;  4PA6 A;  3R65 A;  1CXZ B;  3G80 A;  3P32 A;  3JCU Z;  4JI4 O;  1VQ4 V;  3IAY A;  4WF9 V;  1GAX A;  2OTL V;  3JAS B;  1KMI Z;  5CA0 A;  1TGO A;  3ZMS A;  1M56 B;  3HKC A;  1H5W A;  4DR2 O;  2UXC B;  1RFY A;  2ZNJ A;  2DWD C;  4X62 O;  3T1C A;  4LF6 O;  4DV3 O;  1HNX B;  1M57 B;  3N2G A;  4CH4 A;  1YJN V;  2WLH A;  1G4Y B;  2E76 B;  2P67 A;  4DV5 B;  4OGQ B;  5BXZ A;  5JQG A;  1TAE A;  5F2V O;  1RSO B;  2R9I A;  1OCC B;  4DUZ B;  3SPI A;  1MZF A;  2IU0 A;  3VQW A;  3SJC C;  2EIN C;  1PKX A;  3CME V;  4JYC A;  1I0H A;  4LBE C;  2ZE7 A;  4HNA A;  4I5S A;  3CWB H;  2HFE C;  3H01 A;  4G27 B;  5CA3 A;  3E35 A;  4W4L A;  2Z0A A;  4LNU A;  2R9A A;  1N33 B;  1YCI A;  1VQ9 V;  3FX7 A;  2GSM B;  2EBO A;  1PNL A;  1Y76 A;  1EFR G;  5KX5 A;  3RBZ A;  4QPJ A;  3DGE A;  1JJO A;  2AZ0 A;  2WSS G;  2RQ6 A;  3BCC H;  2OIE A;  3KZI Z;  2DYR B;  1QR9 A;  1KD1 W;  3T1Y B;  4UVA A;  4O4I B;  3DC5 A;  1SES A;  4DR1 O;  1BMF G;  3RVZ A;  1RPO A;  1AR1 B;  3AG2 B;  2R70 A;  3SPH A;  3ABK C;  4K8X A;  4JI5 B;  5IY5 C;  4I7Z B;  1HR0 O;  1K73 W;  3SYA A;  3CCV V;  3HKE A;  1S3J A;  2VWJ A;  4C7U A;  2WLJ A;  3MAQ A;  5B3S B;  4X88 A;  1I5Y A;  3UM7 A;  4DW1 A;  1IXB A;  3WG7 C;  4JAA A;  4RAI A;  3FFQ A;  3THO A;  5EIB C;  4K3A A;  5CBH A;  1GH6 A;  5JJN B;  1XL4 A;  1YHQ V;  4LFC O;  2EZO A;  1NI8 A;  1Z2G A;  4RUE A;  4X1I B;  1AIL A;  5IYB O;  2YUA A;  3MHS C;  1SET A;  2W6J G;  4QIW F;  1QHT A;  1NVP D;  4MVR A;  3TK1 A;  4J7Z A;  2UXD B;  4YJ3 B;  5LXT B;  4DV1 B;  1K7D A;  3S3W A;  1M9N A;  3K79 A;  2NR5 A;  4WFG A;  2YIB D;  5IJ9 B;  1NR7 A;  4HZ3 A;  4K0K B;  1XL6 A;  1YTF D;  2JDI G;  4RO2 A;  3C3T A;  1Q6H A;  2QJ1 A;  3G71 V;  1YVW A;  1VQ5 V;  2YI9 A;  4X1Y A;  4BW5 A;  2ZXW B;  3EFF K;  3W7S A;  4G28 B;  4DR7 B;  5C93 A;  1FJG B;  1Q82 W;  4I0X B;  3CCR V;  4DR6 B;  5E79 Z;  1QVF U;  3W7W A;  5LHI A;  2QR4 A;  3BAA A;  4TUY B;  4ZOL A;  4CC6 A;  1YF2 A;  4DR5 B;  4AIL C;  1I94 B;  1ZWI C;  2GUZ B;  4K35 A;  2ZE6 A;  1AR5 A;  2YS8 A;  1SZT A;  3UCS C;  2A79 B;  4I55 B;  3D36 C;  4W4K A;  2IJI A;  1OHH G;  4R6Z A;  5A2Q N;  4LFB O;  1B3Q A;  3CRM A;  3JYC A;  4MW3 A;  1ZL8 B;  4LP8 A;  2BOC C;  4PDM A;  4B7K A;  2BSK B;  1PL4 A;  1EBO A;  1SQQ H;  3K03 A;  4O4H A;  3L9D A;  3VBB A;  1WP7 A;  4FM1 A;  4AQY B;  3TXQ A;  3OUF A;  2Q0O C;  4YY3 B;  4OX9 B;  1QNM A;  2IJJ A;  2WLL A;  1K4C C;  3JCZ A;  1AJQ A;  2HVK C;  3CE2 A;  4FMT A;  4LWS A;  2UU9 O;  1D2D A;  2EIK C;  2ZIN A;  2PI5 A;  1MSW D;  1OCZ B;  4MTX A;  4WBN B;  1MSD A;  1FXK B;  1FAF A;  2B9Z A;  3ZED A;  4LCU C;  1BQZ A;  2CH7 B;  2M7W A;  5KMG B;  1FFT B;  2EJ7 A;  3OD4 A;  3JAK A;  2DN9 A;  3CRA A;  4P30 A;  3ZX6 A;  4UCS A;  3ABM B;  3STZ C;  5CMU A;  3A0R A;  3OFN G;  1JNB A;  3IC7 A;  1R73 A;  1IBL O;  3OMI B;  1GM8 A;  4JI0 O;  5L3D A;  3ZRX A;  1FFX A;  5KA5 A;  1FXH A;  2Q68 A;  1FS0 G;  4P9O A;  2ARH A;  4MW8 A;  1QBZ A;  1NVP B;  1UPG A;  2VQE O;  1GM9 A;  4EEQ A;  5GON B;  2JRI A;  2JIZ G;  1KBH A;  3IC9 A;  4TSF G;  2QTO A;  4GT1 A;  2AHY A;  4X65 O;  1YTF B;  1K9M W;  3CPW U;  2GTS A;  4KP4 A;  3T2M A;  2IW5 A;  3F7V C;  1BQ0 A;  1VF5 B;  3SYO A;  4KL1 A;  4B3M B;  5LP6 C;  2ITD C;  3LSU A;  2DWE C;  3VQV A;  2KB1 A;  1U96 A;  1EZJ A;  1IJG A;  1HNW O;  5EYP B;  5IJ0 A;  3FAV A;  3SYQ A;  2ODM A;  4U3J B;  4JPR A;  4Q20 A;  1NR1 A;  3CCE V;  2QWO B;  3OR7 C;  4IIJ B;  1B6Q A;  1UJW B;  2Y0P A;  3O9O A;  4PI0 A;  2FL4 A;  3L73 H;  4NKG B;  3QF7 A;  1IX9 A;  1IBM B;  1U97 A;  1S76 D;  2WLK A;  1N4C A;  1VQ6 V;  2YDE A;  4DW0 A;  2D3O W;  1XI1 A;  3APQ A;  1MOF A;  1P7B A;  4LF9 O;  1QLE C;  2E3C A;  4R50 A;  4I50 B;  5LP6 A;  3VQX A;  1SQB H;  4FFB B;  2X6A A;  3E22 B;  4ZKI A;  1YIJ V;  1N34 O;  4CH3 A;  3K5M A;  4X66 B;  5CBG A;  2MK3 A;  2CE4 A;  4X64 O;  3C3S A;  4MTF A;  5B1A B;  4JI7 O;  4DR4 B;  4FLW A;  1Y67 A;  3ZN1 A;  1BSM A;  2QWQ B;  2QM7 A;  4BIZ A;  3UKM A;  1VQK V;  5CA1 A;  2P4V A;  3SR2 C;  2UUC O;  1I5X A;  3FKS G;  5LMU O;  3LSS A;  4MSW C;  3X2Q B;  2Y69 C;  4YHH O;  3GWO A;  1SC5 B;  3G6E V;  1S0V A;  3BA8 A;  2QM8 A;  2QDO A;  4JI2 O;  4KHP B;  2CTQ A;  2YXY A;  3KCX A;  2AZ2 A;  3CX5 F;  5IYD O;  4BW9 A;  5LOV A;  4H33 A;  2KG7 B;  3A2F A;  2DW4 A;  5DM6 V;  1R1B A;  2VQF O;  2P7T C;  2F1M A;  3Q4H A;  4EB6 B;  5DED A;  5EZY A;  1MG1 A;  3KCY A;  4FVM A;  5HFL A;  2LO1 A;  3SJQ C;  1TVK B;  1SER A;  4FLX A;  4MVZ A;  5EBM C;  1M1K W;  4MTG A;  3L72 H;  4JTD B;  5K1X A;  1F4N A;  1K5S A;  1S77 D;  4GCZ A;  1YIT V;  4JI4 B;  4DRX A;  2YXH A;  4OXS A;  3OW2 U;  1RP3 B;  2CAZ C;  4WFH A;  4J9Z B;  2ZDI C;  4FFK A;  4JGS A;  4TV8 A;  1RPR A;  2M6Y A;  4DV2 B;  4I9W A;  5E1A C;  1DGS A;  3J80 N;  1FYJ A;  3CS5 A;  2BCC H;  4DO2 A;  1AJP A;  4D7T A;  4FM0 A;  1VF6 A;  1TUB B;  3H9V A;  5JH7 B;  2LP7 A;  3D3Q A;  3JSL A;  1WPB A;  1GRJ A;  2XHB A;  1AI7 A;  1R3L C;  1JJ2 U;  1GTO A;  2IH1 C;  1ZLZ A;  1V55 B;  3APO A;  3K9S A;  1P7G A;  1SZX A;  4FZ1 A;  4JF3 A;  4O4J B;  4CS3 A;  3AK2 A;  1IVS A;  4AQY O;  1N32 B;  3JAL B;  1BGY H;  3C90 A;  4DUY O;  2Q69 A;  4ZI7 B;  3K5L A;  4TV9 B;  2PF4 E;  4BIU A;  4BR6 A;  3K59 A;  3ZMT A;  2Q8V A;  4YIP A;  4X20 A;  3ETD A;  3OMN B;  2HHH B;  3AG7 A;  1QVG U;  1Q3E A;  2ZDI A;  4JYA O;  2B1I A;  1XUQ A;  2Q7H A;  2IJK A;  4X1K B;  1GM7 A;  3OE7 G;  5IY5 B;  3I56 V;  3JAR A;  5L3F A;  4TOI A;  1KYO F;  1M5I A;  1KP3 A;  2CTW A;  5J9P C;  1FPO A;  4JI6 B;  1NU1 H;  1NBM G;  3ABL C;  1WLE A;  4MVS A;  2P4K A;  4JI3 O;  3WG7 B;  4WFA V;  4ZOL B;  3L74 H;  4YJ2 A;  2E5L B;  1V54 C;  1Q81 W;  2A06 H;  2QGN A;  1ROP A;  2GTA A;  1N36 O;  1Y74 B;  1NTM H;  3BAB A;  3K57 A;  5GTI Z;  3LDE A;  4LFC B;  4ZIB A;  4GKJ B;  3E8H A;  2XAQ A;  1XRE A;  1X59 A;  3QO5 A;  3HKB B;  2PYJ A;  4L8J A;  3A0B Z;  4JZG A;  1W0J G;  3KDR A;  4O4H B;  3LDC A;  5LYJ B;  3JD3 A;  4HYO A;  4LF8 O;  1VQ8 V;  2Y4T A;  4H44 B;  1K8A W;  2XND G;  3NXS A;  1NJI W;  1MMM A;  4GX2 A;  4LWS B;  2ZIO A;  4DV6 O;  2PZS A;  3CC7 V;  3SGI A;  3ASN C;  2E74 B;  4O2A B;  5JCO C;  2LW7 A;  5TIS Z;  1VQ7 V;  2RNB A;  4F4L A;  5B1B C;  1XNR B;  2EX3 A;  5L3B A;  3UO3 A;  3BRC A;  2LFS A;  4RWU A;  3CCJ V;  3ZHU A;  4JAV A;  4BWA A;  2IH3 C;  2UXB B;  3H1L H;  3AG1 C;  1N8R W;  4PA7 A;  4JTA B;  3QG5 A;  3H1I H;  4UFZ A;  1RM1 C;  1HNZ O;  4JI8 O;  1XMO O;  1PD3 A;  1SRY A;  3HR0 A;  3T1H B;  1COW G;  5CB4 A;  2F4V O;  4Q6G A;  1NH2 D;  2UXX A;  3UT5 A;  4DV7 O;  4NB5 A;  1K5Q A;  4J80 A;  3B8N A;  1XMQ O;  1PNM A;  2DQ3 A;  5C8Y B;  4WCE V;  4DR3 O;  5LA6 B;  3CJH A;  5JJE B;  2EIK B;  4RQF A;  5J2U A;  2EIJ C;  2NLJ C;  5IWA O;  1OZ0 A;  5LMN B;  1YI2 V;  5JCO A;  1S5J A;  3CB2 A;  2UU9 B;  1E79 G;  5EK0 A;  3NR7 A;  1S5H C;  3K9A A;  4P9P A;  4LF5 O;  4I4T B;  1KUQ A;  4PA3 A;  3HKD B;  1K92 A;  3JD1 A;  2ETN A;  4CH5 A;  4DV0 O;  3RYF B;  2CTP A;  5BMV B;  1HDJ A;  1H2S B;  5ITZ B;  1D5A A;  4RUF A;  3N27 A;  2UXC O;  1L8D A;  1PNK A;  3S3X A;  4QE9 A;  4JI0 B;  1MZE A;  1M56 C;  4F6R B;  2JK5 C;  3AEI A;  1URF A;  3B40 A;  3ML0 A;  4IHJ A;  2BTQ B;  4DV5 O;  3F5T A;  4PEL A;  1BHA A;  4UCR A;  1M57 C;  1SA0 A;  3RYC A;  4DUZ O;  1R3K C;  2E75 B;  2VS0 A;  5CN0 A;  3PN1 A;  3A8T A;  3LUT B;  1IBK B;  2UUB B;  4LF4 B;  1OCC C;  1NT2 B;  2ZR2 A;  4XDJ A;  2L35 A;  1N33 O;  4UCO A;  3W7X A;  1XEQ A;  1G8M A;  4WFE A;  5IE9 A;  2A7W A;  4KXR A;  2AGA A;  2HKO A;  5FNV B;  2ILM A;  1Z5W A;  2PUS A;  1TA8 A;  1DK1 A;  4GLX A;  4O4L B;  1DTO A;  2HEP A;  4PDR A;  1KB9 F;  3QO8 A;  2DE0 X;  5KUK A;  1EZV H;  4G2K A;  4JAS A;  1QLN A;  4JI5 O;  1WB7 A;  2XAG A;  2YEV B;  4FJC C;  1WA8 B;  4LH7 A;  3AG2 C;  4MVO A;  1WAZ A;  1VQN V;  4UV9 A;  3PJS K;  3FD9 A;  1RSO A;  5KLV H;  3U0Z A;  1NH2 B;  5IYZ B;  5B3S C;  4LF9 B;  4LFA B;  2V1D A;  3GVM A;  4J7K A;  3CCU V;  1G1X B;  4E4E A;  3ZHV A;  4MT8 A;  1YJW V;  3MHH C;  2N04 A;  1N34 B;  3OGI B;  4B3R B;  2HJF C;  4DV4 B;  2UXD O;  1ZUQ A;  3OTO B;  4DV1 O;  1EM1 A;  2V7Q G;  4MTO A;  1ZX3 A;  4DRX B;  1P84 F;  2Q7G A;  4FLT A;  2QE7 G;  1NS1 A;  1KP2 A;  4K0K O;  3JAW B;  4IL6 Z;  5KHJ A;  1GK9 A;  5EBL C;  3DSQ A;  4FK5 C;  3ASO B;  1YEW A;  1DF5 A;  3QVN A;  3VOU A;  4JV5 B;  2Q73 A;  1OV9 A;  3E8B A;  4HAM A;  3M7M X;  4O4I A;  2ZR3 A;  2DYS B;  4DR7 O;  2ZM6 B;  4GKK B;  1FJG O;  3HB3 B;  4B08 A;  2MW2 B;  5H9C A;  1HW7 A;  1WNS A;  4DR6 O;  4QGP A;  4PA9 A;  5L3C A;  3DXR B;  3CCS V;  1MNG A;  3BA9 A;  1D5N A;  1R6N A;  1ENV A;  1JFF B;  4DK1 A;  2AW9 A;  5J2T B;  3K0G A;  2Z3Y A;  1I94 O;  2XOK G;  4UVC A;  2VQF B;  4QE7 A;  2DOS A;  1SS3 A;  1SQV H;  2JEU A;  4X1I A;  1SQF A;  1GMG A;  4GX1 A;  1THZ A;  1W2B U;  4ZHQ B;  4QJF B;  4YJ3 A;  1YSC A;  5LXT A;  1AB3 A;  4LR3 A;  2K9P A;  2LQT A;  1H2L A;  2WLM A;  1YJ9 V;  3RN4 A;  3CD6 V;  4OX9 O;  5IJ9 A;  4WFF A;  1VIB A;  1AI4 A;  1LUW A;  2OCC B;  1IXM A;  5LGU A;  2QWR B;  2KQX A;  2Q67 A;  2HLD G;  2P6J A;  1O9H A;  5JVD B;  4YXW G;  4FLV A;  3B2E E;  1MA1 A;  3ETE A;  3ZJZ A;  1ORQ C;  2WLI B;  2X7R B;  1F7Y A;  3ZRW B;  3N2K B;  4I0X A;  3KG2 A;  1B04 A;  4O2B B;  4JTC B;  1PL0 A;  3JAT B;  2JGD B;  1Q7Y W;  4WFB V;  1K97 A;  1M4U A;  4TUY A;  1OCZ C;  2RCV A;  4FZ0 A;  4E2L A;  5D5P A;  1NTK H;  4P2Z A;  1W59 A;  2EIM C;  2VRZ A;  5CA0 B;  3ABT A;  2GUZ A;  3AG4 B;  3HKC B;  5H6R A;  2HG5 C;  3ABM C;  2G38 A;  3ETQ A;  3G4S V;  2RJZ A;  3N2G B;  1MAB G;  1XOU A;  4CBC A;  1ZL8 A;  4PI2 A;  5EIB D;  5JQG B;  4NXN B;  5EBW C;  3JD4 A;  1PPJ H;  1VF6 C;  1E1Q G;  3E8F A;  3K3W A;  3QNE A;  4IT5 A;  3ABL B;  1R3I C;  4HNA B;  1NQT A;  1X4T A;  5IDJ A;  1V54 B;  4LNU B;  3RW0 A;  3ZHS A;  1J5E B;  1XNQ B;  1SQX H;  1WB8 A;  4JI3 B;  3ZMV A;  3STL C;  2L6L A;  3CCM V;  4WBN A;  1FXK A;  4MVM A;  1BT8 A;  1Y76 B;  3GWK C;  5EC1 C;  2CDY A;  1YZB A;  5KX5 B;  5IYC O;  1N36 B;  3CXC U;  2KKW A;  1NZ6 A;  3BVO A;  2ADP A;  3SPC A;  4JYB A;  4NTW A;  3CSX A;  4DR2 B;  5H2F Z;  4RQE A;  4X62 B;  4LF6 B;  1IBM O;  4DV3 B;  2JJ2 G;  1VQM V;  5CB4 B;  3UQ8 A;  3RYI A;  3H1H H;  4MVU A;  2UUA O;  2R9R B;  3ZIA G;  3HKE B;  2P22 C;  4JYY A;  3TJT A;  1JPX A;  2EIN B;  5GON A;  2F23 A;  2FTK A;  3OM3 B;  1AP6 A;  3CCL V;  3H1J H;  2YSU B;  2EIL C;  1UFI A;  2N74 A;  4FLY A;  1JVM A;  2A0L A;  2YIB A;  1OJH A;  4FPP A;  3OTF A;  1CEZ A;  4FIP C;  5B1B B;  2CGO A;  3WB2 A;  3F7Y C;  2Y4U A;  2HR3 A;  5EYP A;  1CPY A;  1ZTE A;  1Q90 D;  3AK3 A;  3G67 A;  4NXM O;  5B1A C;  3AG1 B;  4U3J A;  3GB7 C;  1BE3 H;  4K8Z A;  1I7F A;  3J81 N;  4NYK A;  2F93 B;  4A5U B;  4IIJ A;  3K0D A;  3ABK B;  3WU2 Z;  1R6K A;  3I5D A;  2QKC A;  4X1Y B;  4CS4 A;  4CZZ A;  5KHH A;  4DR1 B;  2XAJ A;  1SQG A;  4UXN A;  2D2C B;  4LF7 O;  3X2Q C;  4KHP O;  2CTR A;  3O65 A;  2JGU A;  3M99 B;  1HR0 B;  2YXL A;  2F4V B;  3TXS A;  3SYP A;  1ZSP A;  1R3J C;  5L3E A;  3RYH A;  2QWP B;  1CP9 A;  1DF4 A;  1W0K G;  4I9Q A;  3AK1 A;  2QKS A;  1J95 A;  3K06 A;  5GW7 A;  3SPJ A;  4XBF A;  5B1N A;  4I50 A;  3CMA V;  3DTU B;  2OTJ V;  4PA4 A;  2AXT Z;  4FFB A;  3SJA C;  3E22 A;  1HP8 A;  1L0N H;  4B3T O;  4LF5 B;  3RVY A;  2JJ1 G;  2EZP A;  3T4D A;  5B5E Z;  2OIG A;  1VMG A;  4CS2 A;  2Q5Z A;  2YC0 A;  2DMX A;  3W7T A;  3K5N A;  3OT7 A;  1OCR C;  1OCO C;  4UB8 Z;  4DV0 B;  4F6E A;  1H8H G;  2P90 A;  1H2G A;  3RT3 C;  3ZRV A;  2IJH A;  3U10 A;  1KKC A;  4N23 A;  4TWK A;  2WLL B;  3BFR A;  4DV2 O;  5BZB A;  2XT9 A;  2Y48 A;  4U7N A;  4MVQ A;  3FB8 C;  3SPG A;  1AR4 A;  3F5W C;  3OEH G;  1YXB A;  2QSA A;  5JWP A;  1H38 A;  3JAK B;  1K3E A;  1LR1 A;  2KG7 A;  2QEX V;  1HWY A;  5BR8 O;  3CRR A;  4D7S A;  1Z5V A;  1VEW A;  4D6T H;  4EB6 A;  1N32 O;  1V55 C;  1FFX B;  1XQ8 A;  4BIO A;  1TVK A;  3OMA B;  4LFB B;  3CRC A;  2EUL A;  4H37 A;  4PDV A;  4PJ0 Z;  2HHH O;  4DXW A;  4JI1 O;  4UCT A;  4PD4 F;  2YI8 A;  3E2E A;  2HVJ C;  5KAF Z;  3AG3 C;  4PV1 B;  2NNU A;  3E8G A;  1SQP H;  3CC4 V;  1Y4M A;  1WN7 A;  1IDS A;  4JI6 O;  2XAF A;  3OR6 C;  2AHZ A;  3LNN A;  3JAM N;  4EFB A;  2VWK A;  1B06 A;  1BZK A;  2ZQM A;  2E5L O;  1QU7 A;  4B3S O;  4H13 B;  3I55 V;  1TUB A;  5CBF A;  4NTX A;  2NN4 A;  3FAV B;  3MDS A;  5IJ0 B;  1KC8 W;  5JH7 A;  2OYQ A;  2GBO A;  5FPO A;  2F43 G;  5KA6 A;  2GV9 A;  4J9Y B;  1S72 V;  4GKJ O;  1VF7 A;  1AI5 A;  3D3I A;  3HPL C;  5LGN A;  1E1R G;  4O4J A;  2P5O A;  3TGU H;  1IBL B;  4TQF A;  2ZKO A;  2LJ2 A;  3VQY A;  1HNX O;  3JAL A;  4ZI7 A;  1JMK C;  3QTC A;  4TV9 A;  2Z5U A;  1KQS U;  1TUE B;  3WFV A;  2X6C A;  2XAH A;  2VQE B;  1BS3 A;  3K04 A;  1QCE A;  2HJD A;  4X1K A;  1Y66 A;  1VQP V;  1GN3 A;  4X65 B;  5LP6 B;  2PI4 A;  2YID A;  2ZE5 A;  2ATK C;  3ZHT A;  1LNQ A;  3BPZ A;  4AHC A;  1XNR O;  2XTA A;  3ABU A;  4UCU A;  1GN2 A;  1GN6 A;  4MS2 A;  1HNW B;  2F95 B;  3WB1 A;  4GX0 A;  4N21 A;  3L75 H;  5CA1 B;  5L3G A;  1Y74 A;  3JD2 A;  2WWW A;  3CEI A;  2UXB O;  4GUN A;  1R6T A;  2FB5 A;  4BAY A;  3JAS A;  3ZCC A;  3WB0 A;  4UUJ C;  4DK0 A;  3T1Y O;  1IZ3 A;  2BTO A;  2W6I G;  4UCV A;  3CRQ A;  2W0F C;  1ARO P;  4X8A A;  3HKB A;  1AJN A;  1NTZ H;  2CK3 G;  2DYR C;  4ABM A;  3K58 A;  3T1H O;  5LYJ A;  1Q5O A;  3R66 A;  3ZN0 A;  1JOY A;  3ZHQ A;  2ZCE A;  5LOV B;  3BEH A;  5FLX N;  1QLE B;  3IFX A;  4KUM A;  4DYL A;  1KU9 A;  2A9H A;  2IBZ H;  1AI6 A;  4JAU A;  2H94 A;  1FKA O;  3Q4H B;  1KKD A;  5LMN O;  3D8C A;  4FLU A;  5EZY B;  2FML A;  4X9Q A;  4NR1 A;  3E89 A;  3K08 A;  3SJB C;  2ZT9 B;  2C2A A;  3IJ4 A;  3B09 A;  2LFR A;  1XHX A;  1K34 A;  1G6U A;  2W0X A;  3BY6 A;  4O2A A;  1JQ0 A;  1Q8I A;  2EIM B;  4ZBM A;  4YIO A;  4X64 B;  2XUM A;  5KHG A;  1M90 W;  2WPD G;  4LC1 A;  4JI7 B;  1K4D C;  1JCH A;  1SKV A;  2Q6A A;  4PHZ A;  2Q4P A;  2B1G A;  1XHZ A;  1FOU A;  5AG2 A;  1ZAU A;  3D36 A;  1WPX A;  2A3Q A;  4GZR B;  1H2M A;  4J10 A;  2Y69 B;  4TV8 B;  2UUC B;  2OT5 A;  4J41 A;  3M8A A;  4UVB A;  3SDL A;  5A9G A;  4CH6 A;  1GKF A;  5LMU B;  3B8M A;  2QTS A;  3RYI B;  1BL8 A;  2RN9 A;  4YHH B;  4QNH B;  2ZIM A;  3LSQ A;  3OUS A;  1Q6I A;  3EHB B;  1T5E A;  2ZXW C;  3K5O A;  4JI2 B;  1XDC A;  2JVD A;  4Z1V A;  3CHX A;  4DR5 O;  2YIC A;  2BE3 A;  4AI8 A;  5C8Y A;  1IBK O;  5LA6 A;  2UUB O;  4LF4 O;  4R8C A;  2RMK B;  2WLN A;  4U7O A;  1FD9 A;  1H8E G;  2Q7E A;  5LGT A;  3W7U A;  3G6B A;  1L1F A;  2JS3 A;  3BHP A;  2GDS A;  4JZ2 A;  4ICG A;  3RFR A;  4CC5 A;  4I4T A;  3HKD A;  4IYH A;  4X20 B;  4PDL A;  2IU3 A;  2H3O A;  1AP5 A;  2XAS A; 
#chains in the Genus database with same CATH homology
 3OT7 A;  4JYY A;  1EM1 A;  3TJT A;  3DC5 A;  1EN4 A;  1EN5 A;  4F6E A;  2RCV A;  4BR6 A;  1AP6 A;  3LSU A;  1KKC A;  4X9Q A;  3BFR A;  4YIP A;  1PL4 A;  3KKY A;  3QVN A;  1N0J A;  1XUQ A;  4C7U A;  1IXB A;  4YIO A;  1VAR A;  1QNM A;  1N0N A;  1AR4 A;  1MNG A;  5AG2 A;  1BS3 A;  1D5N A;  2P4K A;  3AK3 A;  1ZTE A;  2AW9 A;  1JR9 A;  1IX9 A;  1AVM A;  5A9G A;  1GN3 A;  1MSD A;  1GN4 A;  1VEW A;  2QKA A;  2QKC A;  2ADQ B;  4FFK A;  1WB8 A;  1XDC A;  1WB7 A;  1GN2 A;  1GN6 A;  1XRE A;  3EVK A;  3C3T A;  1BT8 A;  1I0H A;  3DC6 A;  2CDY A;  1I08 A;  1ZSP A;  4JZG A;  3KDR A;  3CEI A;  4GUN A;  2CE4 A;  3AK1 A;  3RN4 A;  3C3S A;  1XIL A;  2ADP A;  1Y67 A;  1BSM A;  1IDS A;  1EN6 A;  1LUW A;  4JZ2 A;  2GDS A;  4E4E A;  1B06 A;  1ZLZ A;  3K9S A;  1JA8 A;  1MMM A;  1MA1 A;  3IC9 A;  1PM9 A;  1P7G A;  1SZX A;  3AK2 A;  3MDS A;  1LUV A;  1AR5 A;  1ZUQ A;  1AP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...