1I0HA

Crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE Y174F MUTANT
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i0hA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i0hA02
4JZ2A 1BT8A 1EN4A 1JR9A 1ZLZA 1XDCA 1MNGA 1BS3A 1PM9A 1AP6A 4E4EA 4F6EA 3C3SA 1JA8A 3TJTA 2GDSA 1ZTEA 1LUWA 1ZUQA 1GN4A 1MSDA 2RCVA 1IX9A 3QVNA 4YIPA 3KKYA 1KKCA 3CEIA 4YIOA 1IDSA 2CDYA 1AP5A 1GN3A 1EN6A 3IC9A 3LSUA 1BSMA 1AVMA 1I08A 1GN6A 4C7UA 1EN5A 4FFKA 2AW9A 1XUQA 1B06A 1LUVA 2QKAA 1EM1A 1D5NA 3OT7A 1QNMA 2CE4A 2QKCA 1AR4A 2P4KA 2ADPA 1P7GA 1SZXA 3C3TA 1N0JA 3MDSA 1VEWA 1XILA 3DC5A 3K9SA 1XREA 3AK3A 3AK1A 4JZGA 3AK2A 3RN4A 1ZSPA 1Y67A 1WB7A 3BFRA 4JYYA 3DC6A 1MA1A 1PL4A 2ADQB 1N0NA 5A9GA 1VARA 4BR6A 1AR5A 3EVKA 1GN2A 1MMMA 5AG2A 1I0HA 1WB8A 4X9QA 4GUNA 1IXBA
chains in the Genus database with same CATH superfamily
3RFRA 4KHPB 4LFAO 5FPRA 4JI5B 5B1NA 2VQFB 1BS3A 4A5UB 2OWOA 2XASA 3JATA 3T2MA 3L73H 3ASNB 3W7TA 4UVBA 2F43G 4JYAB 2PF4E 1R1BA 4LF7B 3RYCA 4I50A 5IJ9B 2A06H 4B3TO 2KB1A 3LUTB 4Q6GA 3QVNA 5J2TB 3F5WC 4QE7A 4EKWA 2B1IA 2WSSG 4DR3B 1JX9A 1GKFA 4JTAB 1BE3H 3OR7C 3JD0A 1I08A 2PUSA 3WFVA 3O9OA 1XUQA 2EX3A 4DV2B 1B06A 5LP6B 2WLNA 5FPOA 2HVJC 1AI7A 3UO2A 1VQMV 2CE4A 3T1YB 2ZM6O 2BCCH 3STZC 3AG1B 4D7TA 2Y0PA 4MVMA 1R73A 3OAAG 3G80A 3AG4B 4FLZA 3ZRVA 2JVDA 4XDKA 3A0BZ 3GWKC 4CC6A 2YIDA 1KU9A 3AG2B 4MW8A 1X59A 4J42A 3BRCA 5IJ9A 5IWAO 1XILA 1FXKC 3EFFK 1XREA 2NLJC 5LGNA 2BTQB 4X66B 4F6RA 4CC5A 2Q7GA 4QPJA 3DC6A 4NXMB 2YS8A 1J95A 1NTKH 3ABKB 1SKVA 1FOUA 2F23A 5DN6G 4ZHQB 2IJHA 5AG2A 2IH3C 1K4DC 2ZXWC 1N36O 1VQ5V 3T1HB 1CEZA 2EJRA 3Q4HA 5KUMA 4O2BB 1YVWA 1M93A 5BR8O 4ZKIA 1UFIA 2ZNJA 3H1LH 1IXMA 2RJZA 4DK0A 1NKDA 2QM7A 4I9QA 2GHYA 4R7CA 2EZOA 5LXTB 1YF2A 4JTDB 1P4RA 4LWSB 2WLIB 4DV1B 1ZUQA 3IGAC 1NQTA 1SF9A 4DR4O 4J10A 1OCCC 2PY5A 1I7FA 4KUMA 4LR3A 4CH5A 4RQEA 1S72V 2JK5C 5EBMC 2YXHA 3S3XA 1GN3A 4ZHQA 3ABLB 5IE9A 3JD3A 4IHJB 4X65B 4O2BA 1BMFG 4J7JA 2P06A 1QLNA 2FMLA 1AR4A 1TGOA 3C3TA 1QHTA 3RGBA 5JWPA 2DQ0A 1EFRG 1Y76A 5LXTA 2IH1C 3D3IA 3JARB 2WLIA 4D7SA 2DE0X 1CPYA 5K1PA 1V54B 2XTAA 3CCVV 3OEHG 4EFBA 1M90W 4LFBB 1K8AW 1D5AA 2KSDA 2XAGA 1SETA 2ZE7A 2ADQB 1N0NA 1NTZH 4B3RO 2KG7A 5A9GA 4MT8A 4NTWA 1A32A 3CCMV 3D8CA 2Z0AA 2EZPA 3CC2V 5B1BB 3BY6A 4IHJA 2JGUA 2LFRA 2DN9A 2OYQA 1N8RW 3BA8A 3U0ZA 3JALB 4O4LB 4JAAA 2BOBC 1TUBB 1HNXO 3ZMUA 2EBOA 4QIWF 4YHHB 4Z2WA 1QVGU 3JARA 3ML0A 1FXVA 1G1XB 3STLC 1H2KA 3M8AA 3ZJZA 1M9NA 3OTFA 1YDXA 1H2GA 2P22C 2OTLV 1H2SB 4EEQA 3K9AA 3TXSA 1U97A 1RPOA 2JRIA 3SYAA 4X64B 2LO1A 2GTAA 4IYHA 5LMUB 4C7UA 1XMOB 1BCCH 1YSCA 5D5QA 3JALA 4PA9A 2EILC 1QNMA 3X2QC 4Z1MG 1XNRB 4R50A 3LNMB 2PI4A 1P7GA 3OGCC 3ZBHA 1DLBA 2NN4A 1HR0O 2C2AA 1MSWD 3UT5B 4FLYA 2WLLB 1M57C 4X62O 2Q6AA 1XMQO 2ZIOA 3A8TA 4LH7A 5H6RA 3RVYA 2ZE5A 5LA6B 4OGQB 3P3PA 4P30A 4H13B 1L8DA 3H9VA 4TT3G 1IBMO 4W4LA 4HZ3A 4UCOA 4DV4B 1OCOC 4WFAV 4FK5C 1JVMA 3QNEA 1JMKC 2UXDB 4DR7B 2WA3A 5LOVB 1QQCA 1KMIZ 4HBNA 5IYCO 1AJQA 4XDLA 1OCRC 5B3SB 1OHHG 2X6BA 4IIJB 2AZ2A 2WPDG 2HJFC 1THZA 3UT5A 2LFSA 3QG5A 2WLLA 1NTMH 2QDOA 3HPLC 4DV5O 2A3QA 5J2UB 3SPCA 3HKBA 1Q82W 5LA6A 3RYFA 2V7QG 5GTIZ 2AGAA 5HFLA 4LFCO 4DO2A 3ETEA 2ETNA 4NYKA 3LDEA 3OEEG 3CRRA 2Q69A 3CRAA 3QTCA 1UJWB 4DR6O 3CYOA 3D36C 5LOVA 4WF9V 3UO3A 5CN0A 2E75B 5B1AC 5JJNB 5KMGB 1QLEC 2UUBB 2GTSA 2YUAA 4X20A 4JI0O 3R66A 2VQEB 3ZS8C 3B40A 4FVMA 4MTFA 1LNQA 3E2EA 3MHSC 3CCEV 4OPHA 4YJ3B 2XAQA 5CMUA 4ZI7A 5J2UA 5DEDA 5FLXN 2DOSA 1FKAO 4JI7B 2D2CB 5B1OA 1JNBA 4FPPA 1FXKB 3VQXA 1W2BU 1GK9A 3F7YC 2ZD9A 4K0KO 3ETQA 1W59A 4GCZA 4WBNA 2ZDIC 1OJHA 3TXQA 2UUCO 1VQOV 1R6NA 4DRXA 4OPAA 4PA7A 2ITCC 5CBFA 4U7OA 1MMMA 4GKJB 2NR5A 1WPBA 1M4UA 2ZXWB 3BPZA 4LNUA 4U3FH 1QCEA 4JI3B 5KAIZ 2PZSA 5L3GA 1EBOA 4BW9A 1IBLO 1L1FA 1XDCA 3RYHB 5JVDB 1ZWIC 4O4JB 4PELA 4YJ3A 3APQA 1F23A 2E3CA 1SQQH 2WLMA 4GT1A 5KAFZ 1I5YA 4U3JB 2WLKA 4LF5O 1OCCB 1OV9A 4YIPA 4MSWC 1X4TA 5E1AC 1IJGA 3I56V 1YCIA 1Y6XA 1ENVA 4LBEC 5L3DA 5LHGA 1AP5A 1B6QA 2WLJA 2XOKG 2IJKA 1EN6A 4I0XA 1XHZA 3J80N 4NVPA 5EZYA 1MABG 3H1KH 3K5OA 1R6KA 3TETA 2HKOA 2G38A 3VOUA 4DXWA 1LUVA 4DR1O 3QO7A 1EM1A 4J80A 1Q3EA 1QU7A 1JOYA 5JQGB 1KKDA 2P4KA 2ADPA 5EIBC 5JVDA 1GMGA 2F4VO 5KHKA 1GAXA 4JYBA 3WU2Z 3MDSA 5LMNO 5BMVA 4U3JA 4WFBV 5BZBA 4JI1O 5ITZB 4KHPO 4LH6A 3DC5A 4JI5O 4UCSA 2FTKA 4JZGA 4O2AB 1GO3F 1PP9H 3JCUZ 2QWQB 4TWKA 5EBLC 3N2GB 3JD1A 4JYAO 3K57A 2ZNIA 2DYRC 4N23A 1RSOB 2JIZG 3UKMA 3HKDA 3ASOC 2HHHB 1V55C 4MW3A 4DR3O 5JQGA 4DUZB 1H38A 1FJGB 1YZBA 1ZAUA 3DSQA 3ZHTA 4DUYO 2B9ZA 2B5UA 3G67A 4DV2O 2FKXA 1AP6A 1JA8A 5H2FZ 5KA6A 3CRCA 4UV8A 3RT3C 3SPGA 2PYLA 3K5MA 2CTWA 3E8FA 3T1YO 2GUZB 3SJBC 1XOUA 1VQ4V 2YI8A 4O2AA 3A0HZ 5B5EZ 2QEXV 4BWAA 4GKKB 1K9MW 1E1RG 2WLHA 1RSOA 2Q0OC 4FFKA 3CCQV 2CAZC 4GX0A 5B66Z 2QR4A 4NXMO 5BXZA 5EIBD 4DR2B 4O4HB 2EILB 1FFTB 3X2QB 3ZN1A 4DR5B 4MVSA 1NI8A 1VF5B 3JAKB 2CTPA 2MW2B 3T1HO 3TK1A 3BA9A 3OTOB 1Q43A 1K92A 4PJ0Z 5K1XA 4KL1A 1XL4A 1PNMA 1M57B 1SQVH 4IL6Z 2CK3G 4QGPA 4K8ZA 5IDJA 3AK3A 5L3EA 3CX5F 3ZIAG 4NXNB 1Y67A 3TCUA 4HAMA 1F4MA 2YIAA 3L75H 1N32B 5JH7B 5EC2C 3R65A 2F95B 4DV1O 4B7KA 3FD9A 1F51A 3H1IH 2KKWA 1IXBA 2Q68A 5J2TA 1KQSU 4G2KA 3E22B 2DMXA 1P7BA 3CMAV 3H01A 3JAKA 1PM9A 3LDCA 2YEVB 4FJCC 4J9ZB 4X65O 4LFAB 3SR2C 2AXTZ 2L35A 4CBCA 1ZTEA 3JAWB 3ZEDA 5LP6A 3L70H 3A0RA 4UB8Z 2CUGA 1SQGA 4F4LA 2QA4V 4PD4F 4DV6B 2UXNA 4H44B 5JH7A 4WFFA 4B3TB 2X6AA 2EJ7A 3PN1A 4FMTA 1YXBA 3E83A 2RQ6A 5GONB 4LFBO 3ABTA 3K5NA 3W7WA 1K33A 4KXRA 5B1AB 1K73W 2BTQA 1FXHA 1KD1W 4RUEA 1B04A 3K0DA 5J9PC 1J5EB 1QLEB 4DV7B 3FB7C 1YI2V 1XHXA 2Y0IA 2ZE8A 1N33B 4R8CA 3B09A 4L87A 2YICA 4ZIBA 1Z2GA 4JGSA 4MVRA 4IYIA 5DM6V 1CP9A 4YJ2B 2DWEC 1I94B 2Y48A 1BGYH 2QM8A 2ZR2A 4QPKA 1K3EA 1MZEA 4J7ZA 1VF6C 4YHHO 3RN4A 1ZSPA 3BFRA 3WG7B 5IYDO 2WAMA 5JJEB 1S5JA 1GTOA 4UCRA 4X89A 3B8MA 1K34A 2KQXA 3ZHSA 3QF7A 3EVKA 5KHGA 4LWSA 1BQZA 1WAZA 3P32A 3ABMC 2XAJA 1H2LA 1K4CC 3AEIA 4NTYA 5L3BA 3FFQA 3EXAA 1M56B 1RM1B 1ZLZA 4LF4B 2YIBA 1S3JA 3C3SA 2FL4A 3FX7A 4YJ2A 2EIKC 3LSSA 3MD0A 1VQ8V 1ROPA 3QO8A 5HFMA 2N74A 1HNWO 3L72H 5FNVB 1NBMG 4GLXA 2P7TC 4WCEV 1N34O 1G8MA 3UCSC 2ZDIA 3KKYA 4I55B 3JD2A 1SQXH 3I55V 3AG3C 2Q7HA 2QKAA 1O9GA 1HP8A 1AI6A 1NS1A 2UU9O 3EHBB 4GZRB 2BOCC 2WWWA 2QTOA 1B3QA 2VRZA 4WFGA 1ORQC 2UUAO 4AQYB 3UM7A 3QO5A 2UXDO 4DR7O 1JFFB 1Q86W 2JDIG 4LF9O 4W4KA 4NR1A 4DK1A 3UQ8A 2XT9A 4BAYA 2GBOA 2IW5A 3OUFA 5CBHA 4P9OA 1MZFA 4CH4A 3K79A 4O4LA 3AK2A 1TUBA 2VWKA 4B7EA 3P3NA 1VARA 2NNUA 1YITV 2DYRB 1PKXA 4FLVA 2ZE6A 4B3RB 1ZL8B 3J7AU 3SYCA 2HLDG 2Q5ZA 4UCUA 5H9CA 2RMKB 2XUMA 1FYJA 1SS3A 3SYPA 4XBFA 4JAUA 1NT2B 1IVSA 4UXNA 1QR9A 1AROP 3GWOA 2UXCO 2AHYA 1VP7A 3CJHB 1EN4A 1JFFA 4FZ0A 3HKCB 1WLEA 1JCHA 2UXBO 1YJNV 3SJQC 1HNZB 2PTMA 1HNXB 3D3QA 2QSAA 2W6IG 1VMGA 1PV0A 1RFYA 2ZINA 2D3OW 5C93A 1SZTA 3L71H 3CE2A 1LUWA 4EFEA 1OCZC 1KBHA 1RP3B 3FYEB 4P9PA 1FFXB 3OW2U 1URFA 2JGDB 2IJJA 3B4SA 2DWDC 2UXXA 2P90A 1ZL8A 3E8HA 4I4TB 1AVMA 2R70A 1YHQV 4PA6A 1NH2D 1SA0B 3SPJA 1L0NH 2ODMA 3K3WA 4FIPC 5LYJB 4PHZA 2BSKB 3M7MX 2XNDG 5TISZ 3OT7A 3CJHA 1DF4A 5DECA 3SDLA 3IAYA 1Y4MA 2GSMB 3K5LA 1SZXA 3OGIB 4JI2B 1FPOA 2P6JA 1PPJH 1H5WA 3OUSA 4TSFG 2AZ0A 3CS5A 1XI1A 4B3SO 1HR0B 1G4YB 4NB5A 2LP7A 1FFXA 2O57A 3F5TA 3OR6C 5CA1B 4IIJA 4X62B 1JJ2U 1R3IC 5IY5C 1NJIW 1EZVH 1Q90D 1KP2A 3FB5C 2XAFA 4GX1A 1AR5A 2ZT9B 3LSQA 1IBMB 1SA0A 4QE9A 2BE3A 5LYJA 2YSUB 5LL6Y 5L3CA 4X9QA 3CRMA 1SC5B 2RN9A 2W6JG 3JD4A 4DV3B 4JZ2A 1W0KG 1BT8A 1Q6UA 4RUFA 2Q4PA 1KC8W 4O4IB 5KHHA 1UPGA 3HB3B 4EB6B 2Z5UA 4FM1A 2ZR3A 1K5SA 1IBKB 5KMGA 2EULA 5CA1A 2W0FC 4B3MB 1WP7A 4DV0B 5IJ0B 2LGWA 4DV5B 2FB5A 4J7KA 4JI4B 1YEWA 4TUYB 3CPWU 2EIJC 2BTOA 1IDSA 1VQNV 2ITDC 4JI8B 1LR1A 2DJVA 1XNQB 1BSMA 4LFCB 2A79B 1GN6A 1SERA 4FM2A 1QBZA 1FXKA 3A2FA 4UV9A 2QWRB 1JQ0A 2H8PC 3OM3B 4PDVA 3K04A 4LP8A 4YY3B 1GM9A 3IFXA 2E5LB 4O4IA 2F93B 2IJIA 3MAQA 4LF8O 2QM4A 2OCCC 4RWUA 1SQBH 1Q6IA 5IYBO 5B1BC 4MVUA 1XEQA 3K08A 4DUZO 1NR1A 2Q9LA 3CC7V 1Q6HA 1FJGO 4UB6Z 1NU1H 1V9PA 4TUYA 3H1JH 1WB7A 1SQFA 1PL4A 3OMAB 3K58A 4IT5A 4JV5B 3M99B 3RYHA 3BABA 4K0KB 4O4JA 4JI6O 3N2KB 4UFZA 4NKGB 1CXZB 1TA8A 5EYPB 2UUCB 1AILA 1VQ9V 3ABMB 2E76B 1E1QG 3K0GA 4CS2A 1HDJA 5IT9N 2ATKC 2VQFO 1RPRA 4HNAB 2R9IA 1FS0G 4MTOA 3LNNA 4LF7O 3THOA 2EIKB 4DR2O 1P84F 1OZ0A 3DXRB 5LHHA 3ABUA 3I5DA 1KECA 4OX9B 4DR5O 1GN4A 1IZ3A 3SPHA 4DW1A 2V1DA 2JS3A 3OTOO 3ZRXA 3FB8C 3CEIA 2CGOA 1US6A 2YXYA 5EYPA 2Z3YA 4L8JA 3AG3B 5ITZA 1K7DA 4GX2A 2EIMC 2Q73A 4I5SA 1N32O 1K97A 4I50B 1KP3A 4HNAA 1NH2B 3TGUH 5KHIA 3N2GA 4J9YB 5BY1A 2DQ3A 1N0JA 3ZMVA 3GVMA 1WNSA 3ZHVA 1WA8B 4X66O 1VEWA 4CH3A 5LMNB 3L74H 1KYOF 3U11A 4FLXA 4N21A 4JI1B 1H2MA 3ICXA 3E8BA 4FM0A 4MVOA 2WA4A 5GTHZ 3HR0A 4BIUA 1YJ9V 3W7UA 4DV6O 2GUZA 2X6CA 1P49A 4RQFA 4FZ1A 3C90A 3KCXA 4TV9B 3KG2A 5JCOC 3B8NA 3JYCA 3RWRD 4F6RB 1QR8A 4DYLA 1VQKV 1MNGA 3BHPA 3WB1A 4E4EA 1H2NA 3ZRWB 4F6EA 1YJWV 4LF6B 1OCOB 2IBZH 1WA8A 4PI2A 4DUYB 3E35A 2YC0A 3GB7C 1J5EO 4DV7O 1XL6A 5KX5B 1OCZB 1N33O 4O4HA 5CA0B 1MSDA 2A9HA 1QVFU 3Q4HB 1OCRB 3BAAA 2CDYA 2HVKC 3OE7G 5KLVH 2QGNA 3ZHRA 1I94O 2MK3A 4JF3A 3VQWA 2Q0AA 4K3AA 2K9PA 4H37A 2H3OA 1TVKB 3HKEB 2N04A 3CXCU 4TV9A 3W7SA 3SJAC 1GH6A 4BIZA 4JPRA 2Y69C 3VBBA 3O65A 4UUJC 4Z1VA 2YXLA 1GM8A 1JPXA 5LBQA 3ZRWA 1MG1A 4CS4A 1MOFA 2OCHA 4G28B 3G6BA 2LW7A 1KUQA 2PYJA 5KX5A 2JEXA 5CA0A 3BCCH 4JAVA 3ZMSA 5H5NA 3CHXA 1VF7A 4LF4O 3E22A 4TV8B 2QE7G 3K06A 3G71V 1MA1A 5EBWC 4D6TH 4UVAA 1WJZA 5IY5B 1YTFD 1AB3A 2IU3A 2YEVA 3JSNA 2ZM6B 1Y76B 1DTOA 3F7VC 1ZX3A 1TVKA 3HKEA 1GN2A 3JAWA 4AILC 3CD6V 3B2EE 2Y4TA 3FYIB 3T4DA 1AI4A 5IWAB 4IGGA 2KG7B 1U96A 4G27B 2R9RB 5JJJB 5GONA 1NR7A 1R6TA 4UVCA 2YI9A 3D36A 2ZIMA 3OMIB 3NXSA 2ZKOA 4PA4A 4YXWG 2LGQA 5GW7A 4AQYO 3CWBH 2DW4A 3SPIA 4TV8A 1IX9A 2QTSA 4QNHB 3S3WA 4CZZA 3ETDA 4TQFA 1N36B 4X64O 2EIJB 5LMUO 4J41A 1XMOO 2OT5A 4MTGA 1PL0A 5BR8B 3CRQA 3LSUA 2JJ2G 2VWJA 1VQPV 5LGUA 2LJ2A 4TOIA 4R6ZA 3N27A 2QWOB 1SESA 2QWNB 5C8YB 3CCRV 1XNRO 4OXSA 4FLWA 1K5QA 1Q8IA 4MVQA 4GX5A 2QKCA 2EINC 2HP8A 2IU0A 4UCVA 2DYSC 1TUEB 4AI8A 3FB6C 3BEHA 4DR4B 4E2LA 3CSXA 4MS2A 2OTJV 4RAIA 1S77D 2OCCB 4MTXA 3J81N 4CS3A 2R9AA 2A7WA 4PA3A 2CGNA 4B08A 1H8HG 5FL7G 4LC1A 2E74B 1WPXA 3WB2A 1HNZO 4JYYA 1DGSA 4DV4O 4X1IB 2ARHA 3JCZA 1FD9A 2HR3A 3G6EV 3OD4A 4K35A 1HWYA 4MVZA 1BHBA 1XBLA 2Y4UA 1DK1A 1VQLV 4K8XA 5C8YA 4NTXA 3CCSV 5FNVA 5A2QN 1WP8A 2LQTA 2B1GA 3PJSK 2HG5C 1E79G 3IC7A 4FFBB 4I55A 3LDDA 4PV1B 4U7NA 1JJOA 3ZX6A 3TJTA 3K03A 2GDSA 1N4CA 3ASNC 4GYCB 3KDRA 3ASOB 1R3LC 3ZHUA 2JEUA 4J11A 1V55B 4JI2O 3ZMTA 1F7YA 3APOA 4X1IA 5D5PA 3OFNG 2VS0A 1HNWB 4WFHA 5KA5A 1N34B 4Q20A 2ZCEA 3CCUV 5EC1C 2R72A 1G6UA 2X0LA 5LP6C 2UUBO 2A0LA 3AG7A 2EIMB 2W0XA 3HKBB 1YIJV 3SYQA 3RYFB 2VQEO 1PNLA 1R3KC 4KFMA 1AI5A 4FFBA 3AG1C 4H33A 2UU9B 2H94A 1Z5VA 2CTRA 4PDRA 3AG4C 2OIEA 2LW1A 3H1HH 5KUKA 2UUAB 4JI7O 5E79Z 5F2VO 3AG2C 4DV3O 4JTCB 4LF9B 1NVPD 3P30A 4PDMA 2QKSA 5CA3A 2HJDA 3L9DA 4CH6A 3ETGA 3HKCA 4X20B 2F1MA 1IBKO 4GKJO 2K1EA 3ABKC 3NR7A 3E86A 4JI3O 3T4ZA 1AJNA 4ZOLB 4B3MO 1I0HA 1EZJA 4DV0O 1TAEA 1Y66A 4ZI7B 1YTFB 4JI4O 4RO2A 3SJCC 3E8GA 1FAFA 2P5OA 5L3FA 3ZRSA 4JI8O 1BZKA 1XNQO 3KZIZ 3FAVB 4XDJA 1XMQB 3SGIA 2P4VA 3IJ4A 3DTUB 4WBNB 2JGDA 5LGTA 2UXCB 2IM9A 1GM7A 3RBZA 4FLTA 4I4TA 4DRXB 3B77A 4ASUG 2UXBB 2JS5A 4YY3O 2BSKA 4KP4A 2E5LO 2RCVA 4LNUB 3ZHQA 1DF5A 3G4SV 2Q7EA 5IYZB 5CB4B 2N05A 4I7ZB 4YIOA 5EK0A 1O9HA 3FKSG 4UCTA 2CH7B 1S76D 3ZN0A 1BHAA 2AHZA 3E89A 4ZOLA 3ABLC 1EN5A 2RDCA 4BW5A 1IURA 1R3JC 5JCOA 4JV5O 1D5NA 1XQ8A 2PI5A 3FAVA 3WG7C 2Y69B 1NZ6A 1H8EG 1Q7YW 4AHCA 3U10A 3VQYA 4FLUA 3RVZA 4H0LB 2F66C 4I0XB 2ZQMA 5EZYB 3CMEV 3K59A 1V54C 2XAHA 1S0VA 2XHBA 4P2ZA 4PI0A 4QJFB 1F4NA 3K9SA 3JASB 3JSLA 1PD3A 1Q81W 4DR6B 5IYZA 4B3SB 5CB4A 5H6QA 1Q5OA 1M56C 4BIOA 2YDEA 2CH7A 1RM1C 4BR6A 4EB6A 3MHHC 2HHHO 2QWPB 2V4DA 4OX9O 2RNBA 4JI0B 5BMVB 4X1YB 3JAMN 2HEPA 4HYOA 4GUNA 5CBGA 4X8AA 2X7RB 5IJ0A 2ILMA 1T5EA 2P67A 1M5IA 1S5LZ 1BQ0A 1BL8A 2HFEC 1Y74B 1VQ7V 1AR1B 1D2DA 1JR9A 3CC4V 3RYIB 4WFEA 4ZBMA 3CP1A 1PNKA 3WB0A 2Q67A 2JJ1G 3HKDB 3JASA 4GKKO 3ZCCA 3RW0A 2YIBD 3KCYA 1KKCA 1COWG 1L0LH 1SQPH 4X1KB 1GRJA 4X88A 3IC9A 1W0JG 1IBLB 3CCLV 4X1YA 1AJPA 4PDLA 2AW9A 3DGEA 1VF6A 4JYCA 2QJ1A 1SRYA 1VIBA 1Z5WA 2EINB 3OMNB 1Y74A 2DYSB 3RYIA 4LF5B 3N2KA 1S5HC 3W7XA 4ABMA 2GV9A 4LCUC 3VQVA 3JATB 5KHJA 4LF8B 4NXNO 1M1KW 1I5XA 3RYCB 3AK1A 3ZMZA 2M6YA 3BVOA 3SYOA 4DR1B 4LF6O 1HW7A 5LHIA 1KB9F 4X1KA 2OIGA 1NVPB 3CCJV 2PGGA 4DW0A 2L6LA 2Q8VA 2FYUH 3DXRA 3CXHF 3T1CA 3CB2A 4JI6B 2F4VB 1WN7A 4I9WA 1WB8A 1VQ6V 2M7WA 2CTQA 4ICGA 4TQDA 5B3SC 4JASA
chains in the Genus database with same CATH topology
4JZ2A 1BT8A 1EN4A 1JR9A 1ZLZA 1XDCA 1MNGA 1BS3A 1PM9A 1AP6A 4E4EA 4F6EA 3C3SA 1JA8A 3TJTA 2GDSA 1ZTEA 3KDRA 1LUWA 1ZUQA 1GN4A 1MSDA 2RCVA 1IX9A 3QVNA 4YIPA 3KKYA 1KKCA 3CEIA 4YIOA 1IDSA 2CDYA 1AP5A 1GN3A 1EN6A 3IC9A 3LSUA 1BSMA 1AVMA 1I08A 1GN6A 4C7UA 1EN5A 4FFKA 2AW9A 1XUQA 1B06A 1LUVA 2QKAA 1EM1A 1D5NA 3OT7A 1QNMA 2CE4A 2QKCA 1AR4A 2P4KA 2ADPA 1P7GA 1SZXA 3C3TA 1N0JA 3MDSA 1VEWA 1XILA 3DC5A 3K9SA 1XREA 3AK3A 3AK1A 4JZGA 3AK2A 3RN4A 1ZSPA 1Y67A 1WB7A 3BFRA 4JYYA 3DC6A 1MA1A 1PL4A 2ADQB 1N0NA 5A9GA 1VARA 4BR6A 1AR5A 3EVKA 1GN2A 1MMMA 5AG2A 1I0HA 1WB8A 4X9QA 4GUNA 1IXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ2 A;  1BT8 A;  1EN4 A;  1JR9 A;  1ZLZ A;  1XDC A;  1MNG A;  1BS3 A;  1PM9 A;  1AP6 A;  4E4E A;  4F6E A;  3C3S A;  1JA8 A;  3TJT A;  2GDS A;  1ZTE A;  1LUW A;  1ZUQ A;  1GN4 A;  1MSD A;  2RCV A;  1IX9 A;  3QVN A;  4YIP A;  3KKY A;  1KKC A;  3CEI A;  4YIO A;  1IDS A;  2CDY A;  1AP5 A;  1GN3 A;  1EN6 A;  3IC9 A;  3LSU A;  1BSM A;  1AVM A;  1I08 A;  1GN6 A;  4C7U A;  1EN5 A;  4FFK A;  2AW9 A;  1XUQ A;  1B06 A;  1LUV A;  2QKA A;  1EM1 A;  1D5N A;  3OT7 A;  1QNM A;  2CE4 A;  2QKC A;  1AR4 A;  2P4K A;  2ADP A;  1P7G A;  1SZX A;  3C3T A;  1N0J A;  3MDS A;  1VEW A;  1XIL A;  3DC5 A;  3K9S A;  1XRE A;  3AK3 A;  3AK1 A;  4JZG A;  3AK2 A;  3RN4 A;  1ZSP A;  1Y67 A;  1WB7 A;  3BFR A;  4JYY A;  3DC6 A;  1MA1 A;  1PL4 A;  2ADQ B;  1N0N A;  5A9G A;  1VAR A;  4BR6 A;  1AR5 A;  3EVK A;  1GN2 A;  1MMM A;  5AG2 A;  1I0H A;  1WB8 A;  4X9Q A;  4GUN A;  1IXB A; 
#chains in the Genus database with same CATH topology
 3RFR A;  4KHP B;  4LFA O;  5FPR A;  4JI5 B;  5B1N A;  2VQF B;  1BS3 A;  4A5U B;  2OWO A;  2XAS A;  3JAT A;  3T2M A;  3L73 H;  3ASN B;  3W7T A;  4UVB A;  2F43 G;  4JYA B;  2PF4 E;  1R1B A;  4LF7 B;  3RYC A;  4I50 A;  5IJ9 B;  2A06 H;  4B3T O;  2KB1 A;  3LUT B;  4Q6G A;  3QVN A;  5J2T B;  3F5W C;  4QE7 A;  4EKW A;  2B1I A;  2WSS G;  4DR3 B;  1JX9 A;  1GKF A;  4JTA B;  1BE3 H;  3OR7 C;  3JD0 A;  1I08 A;  2PUS A;  3WFV A;  3O9O A;  1XUQ A;  2EX3 A;  4DV2 B;  1B06 A;  5LP6 B;  2WLN A;  5FPO A;  2HVJ C;  1AI7 A;  3UO2 A;  1VQM V;  2CE4 A;  3T1Y B;  2ZM6 O;  2BCC H;  3STZ C;  3AG1 B;  4D7T A;  2Y0P A;  4MVM A;  1R73 A;  3OAA G;  3G80 A;  3AG4 B;  4FLZ A;  3ZRV A;  2JVD A;  4XDK A;  3A0B Z;  3GWK C;  4CC6 A;  2YID A;  1KU9 A;  3AG2 B;  4MW8 A;  1X59 A;  4J42 A;  3BRC A;  5IJ9 A;  5IWA O;  1XIL A;  1FXK C;  3EFF K;  1XRE A;  2NLJ C;  5LGN A;  2BTQ B;  4X66 B;  4F6R A;  4CC5 A;  2Q7G A;  4QPJ A;  3DC6 A;  4NXM B;  2YS8 A;  1J95 A;  1NTK H;  3ABK B;  1SKV A;  1FOU A;  2F23 A;  5DN6 G;  4ZHQ B;  2IJH A;  5AG2 A;  2IH3 C;  1K4D C;  2ZXW C;  1N36 O;  1VQ5 V;  3T1H B;  1CEZ A;  2EJR A;  3Q4H A;  5KUM A;  4O2B B;  1YVW A;  1M93 A;  5BR8 O;  4ZKI A;  1UFI A;  2ZNJ A;  3H1L H;  1IXM A;  2RJZ A;  4DK0 A;  1NKD A;  2QM7 A;  4I9Q A;  2GHY A;  4R7C A;  2EZO A;  5LXT B;  1YF2 A;  4JTD B;  1P4R A;  4LWS B;  2WLI B;  4DV1 B;  1ZUQ A;  3IGA C;  1NQT A;  1SF9 A;  4DR4 O;  4J10 A;  1OCC C;  2PY5 A;  1I7F A;  4KUM A;  4LR3 A;  4CH5 A;  4RQE A;  1S72 V;  2JK5 C;  5EBM C;  2YXH A;  3S3X A;  1GN3 A;  4ZHQ A;  3ABL B;  5IE9 A;  3JD3 A;  4IHJ B;  4X65 B;  4O2B A;  1BMF G;  4J7J A;  2P06 A;  1QLN A;  2FML A;  1AR4 A;  1TGO A;  3C3T A;  1QHT A;  3RGB A;  5JWP A;  2DQ0 A;  1EFR G;  1Y76 A;  5LXT A;  2IH1 C;  3D3I A;  3JAR B;  2WLI A;  4D7S A;  2DE0 X;  1CPY A;  5K1P A;  1V54 B;  2XTA A;  3CCV V;  3OEH G;  4EFB A;  1M90 W;  4LFB B;  1K8A W;  1D5A A;  2KSD A;  2XAG A;  1SET A;  2ZE7 A;  2ADQ B;  1N0N A;  1NTZ H;  4B3R O;  2KG7 A;  5A9G A;  4MT8 A;  4NTW A;  1A32 A;  3CCM V;  3D8C A;  2Z0A A;  2EZP A;  3CC2 V;  5B1B B;  3BY6 A;  4IHJ A;  2JGU A;  2LFR A;  2DN9 A;  2OYQ A;  1N8R W;  3BA8 A;  3U0Z A;  3JAL B;  4O4L B;  4JAA A;  2BOB C;  1TUB B;  1HNX O;  3ZMU A;  2EBO A;  4QIW F;  4YHH B;  4Z2W A;  1QVG U;  3JAR A;  3ML0 A;  1FXV A;  1G1X B;  3STL C;  1H2K A;  3M8A A;  3ZJZ A;  1M9N A;  3OTF A;  1YDX A;  1H2G A;  2P22 C;  2OTL V;  1H2S B;  4EEQ A;  3K9A A;  3TXS A;  1U97 A;  1RPO A;  2JRI A;  3SYA A;  4X64 B;  2LO1 A;  2GTA A;  4IYH A;  5LMU B;  4C7U A;  1XMO B;  1BCC H;  1YSC A;  5D5Q A;  3JAL A;  4PA9 A;  2EIL C;  1QNM A;  3X2Q C;  4Z1M G;  1XNR B;  4R50 A;  3LNM B;  2PI4 A;  1P7G A;  3OGC C;  3ZBH A;  1DLB A;  2NN4 A;  1HR0 O;  2C2A A;  1MSW D;  3UT5 B;  4FLY A;  2WLL B;  1M57 C;  4X62 O;  2Q6A A;  1XMQ O;  2ZIO A;  3A8T A;  4LH7 A;  5H6R A;  3RVY A;  2ZE5 A;  5LA6 B;  4OGQ B;  3P3P A;  4P30 A;  4H13 B;  1L8D A;  3H9V A;  4TT3 G;  1IBM O;  4W4L A;  4HZ3 A;  4UCO A;  4DV4 B;  1OCO C;  4WFA V;  4FK5 C;  1JVM A;  3QNE A;  1JMK C;  2UXD B;  4DR7 B;  2WA3 A;  5LOV B;  1QQC A;  1KMI Z;  4HBN A;  5IYC O;  1AJQ A;  4XDL A;  1OCR C;  5B3S B;  1OHH G;  2X6B A;  4IIJ B;  2AZ2 A;  2WPD G;  2HJF C;  1THZ A;  3UT5 A;  2LFS A;  3QG5 A;  2WLL A;  1NTM H;  2QDO A;  3HPL C;  4DV5 O;  2A3Q A;  5J2U B;  3SPC A;  3HKB A;  1Q82 W;  5LA6 A;  3RYF A;  2V7Q G;  5GTI Z;  2AGA A;  5HFL A;  4LFC O;  4DO2 A;  3ETE A;  2ETN A;  4NYK A;  3LDE A;  3OEE G;  3CRR A;  2Q69 A;  3CRA A;  3QTC A;  1UJW B;  4DR6 O;  3CYO A;  3D36 C;  5LOV A;  4WF9 V;  3UO3 A;  5CN0 A;  2E75 B;  5B1A C;  5JJN B;  5KMG B;  1QLE C;  2UUB B;  2GTS A;  2YUA A;  4X20 A;  4JI0 O;  3R66 A;  2VQE B;  3ZS8 C;  3B40 A;  4FVM A;  4MTF A;  1LNQ A;  3E2E A;  3MHS C;  3CCE V;  4OPH A;  4YJ3 B;  2XAQ A;  5CMU A;  4ZI7 A;  5J2U A;  5DED A;  5FLX N;  2DOS A;  1FKA O;  4JI7 B;  2D2C B;  5B1O A;  1JNB A;  4FPP A;  1FXK B;  3VQX A;  1W2B U;  1GK9 A;  3F7Y C;  2ZD9 A;  4K0K O;  3ETQ A;  1W59 A;  4GCZ A;  4WBN A;  2ZDI C;  1OJH A;  3TXQ A;  2UUC O;  1VQO V;  1R6N A;  4DRX A;  4OPA A;  4PA7 A;  2ITC C;  5CBF A;  4U7O A;  1MMM A;  4GKJ B;  2NR5 A;  1WPB A;  1M4U A;  2ZXW B;  3BPZ A;  4LNU A;  4U3F H;  1QCE A;  4JI3 B;  5KAI Z;  2PZS A;  5L3G A;  1EBO A;  4BW9 A;  1IBL O;  1L1F A;  1XDC A;  3RYH B;  5JVD B;  1ZWI C;  4O4J B;  4PEL A;  4YJ3 A;  3APQ A;  1F23 A;  2E3C A;  1SQQ H;  2WLM A;  4GT1 A;  5KAF Z;  1I5Y A;  4U3J B;  2WLK A;  4LF5 O;  1OCC B;  1OV9 A;  4YIP A;  4MSW C;  1X4T A;  5E1A C;  1IJG A;  3I56 V;  1YCI A;  1Y6X A;  1ENV A;  4LBE C;  5L3D A;  5LHG A;  1AP5 A;  1B6Q A;  2WLJ A;  2XOK G;  2IJK A;  1EN6 A;  4I0X A;  1XHZ A;  3J80 N;  4NVP A;  5EZY A;  1MAB G;  3H1K H;  3K5O A;  1R6K A;  3TET A;  2HKO A;  2G38 A;  3VOU A;  4DXW A;  1LUV A;  4DR1 O;  3QO7 A;  1EM1 A;  4J80 A;  1Q3E A;  1QU7 A;  1JOY A;  5JQG B;  1KKD A;  2P4K A;  2ADP A;  5EIB C;  5JVD A;  1GMG A;  2F4V O;  5KHK A;  1GAX A;  4JYB A;  3WU2 Z;  3MDS A;  5LMN O;  5BMV A;  4U3J A;  4WFB V;  5BZB A;  4JI1 O;  5ITZ B;  4KHP O;  4LH6 A;  3DC5 A;  4JI5 O;  4UCS A;  2FTK A;  4JZG A;  4O2A B;  1GO3 F;  1PP9 H;  3JCU Z;  2QWQ B;  4TWK A;  5EBL C;  3N2G B;  3JD1 A;  4JYA O;  3K57 A;  2ZNI A;  2DYR C;  4N23 A;  1RSO B;  2JIZ G;  3UKM A;  3HKD A;  3ASO C;  2HHH B;  1V55 C;  4MW3 A;  4DR3 O;  5JQG A;  4DUZ B;  1H38 A;  1FJG B;  1YZB A;  1ZAU A;  3DSQ A;  3ZHT A;  4DUY O;  2B9Z A;  2B5U A;  3G67 A;  4DV2 O;  2FKX A;  1AP6 A;  1JA8 A;  5H2F Z;  5KA6 A;  3CRC A;  4UV8 A;  3RT3 C;  3SPG A;  2PYL A;  3K5M A;  2CTW A;  3E8F A;  3T1Y O;  2GUZ B;  3SJB C;  1XOU A;  1VQ4 V;  2YI8 A;  4O2A A;  3A0H Z;  5B5E Z;  2QEX V;  4BWA A;  4GKK B;  1K9M W;  1E1R G;  2WLH A;  1RSO A;  2Q0O C;  4FFK A;  3CCQ V;  2CAZ C;  4GX0 A;  5B66 Z;  2QR4 A;  4NXM O;  5BXZ A;  5EIB D;  4DR2 B;  4O4H B;  2EIL B;  1FFT B;  3X2Q B;  3ZN1 A;  4DR5 B;  4MVS A;  1NI8 A;  1VF5 B;  3JAK B;  2CTP A;  2MW2 B;  3T1H O;  3TK1 A;  3BA9 A;  3OTO B;  1Q43 A;  1K92 A;  4PJ0 Z;  5K1X A;  4KL1 A;  1XL4 A;  1PNM A;  1M57 B;  1SQV H;  4IL6 Z;  2CK3 G;  4QGP A;  4K8Z A;  5IDJ A;  3AK3 A;  5L3E A;  3CX5 F;  3ZIA G;  4NXN B;  1Y67 A;  3TCU A;  4HAM A;  1F4M A;  2YIA A;  3L75 H;  1N32 B;  5JH7 B;  5EC2 C;  3R65 A;  2F95 B;  4DV1 O;  4B7K A;  3FD9 A;  1F51 A;  3H1I H;  2KKW A;  1IXB A;  2Q68 A;  5J2T A;  1KQS U;  4G2K A;  3E22 B;  2DMX A;  1P7B A;  3CMA V;  3H01 A;  3JAK A;  1PM9 A;  3LDC A;  2YEV B;  4FJC C;  4J9Z B;  4X65 O;  4LFA B;  3SR2 C;  2AXT Z;  2L35 A;  4CBC A;  1ZTE A;  3JAW B;  3ZED A;  5LP6 A;  3L70 H;  3A0R A;  4UB8 Z;  2CUG A;  1SQG A;  4F4L A;  2QA4 V;  4PD4 F;  4DV6 B;  2UXN A;  4H44 B;  5JH7 A;  4WFF A;  4B3T B;  2X6A A;  2EJ7 A;  3PN1 A;  4FMT A;  1YXB A;  3E83 A;  2RQ6 A;  5GON B;  4LFB O;  3ABT A;  3K5N A;  3W7W A;  1K33 A;  4KXR A;  5B1A B;  1K73 W;  2BTQ A;  1FXH A;  1KD1 W;  4RUE A;  1B04 A;  3K0D A;  5J9P C;  1J5E B;  1QLE B;  4DV7 B;  3FB7 C;  1YI2 V;  1XHX A;  2Y0I A;  2ZE8 A;  1N33 B;  4R8C A;  3B09 A;  4L87 A;  2YIC A;  4ZIB A;  1Z2G A;  4JGS A;  4MVR A;  4IYI A;  5DM6 V;  1CP9 A;  4YJ2 B;  2DWE C;  1I94 B;  2Y48 A;  1BGY H;  2QM8 A;  2ZR2 A;  4QPK A;  1K3E A;  1MZE A;  4J7Z A;  1VF6 C;  4YHH O;  3RN4 A;  1ZSP A;  3BFR A;  3WG7 B;  5IYD O;  2WAM A;  5JJE B;  1S5J A;  1GTO A;  4UCR A;  4X89 A;  3B8M A;  1K34 A;  2KQX A;  3ZHS A;  3QF7 A;  3EVK A;  5KHG A;  4LWS A;  1BQZ A;  1WAZ A;  3P32 A;  3ABM C;  2XAJ A;  1H2L A;  1K4C C;  3AEI A;  4NTY A;  5L3B A;  3FFQ A;  3EXA A;  1M56 B;  1RM1 B;  1ZLZ A;  4LF4 B;  2YIB A;  1S3J A;  3C3S A;  2FL4 A;  3FX7 A;  4YJ2 A;  2EIK C;  3LSS A;  3MD0 A;  1VQ8 V;  1ROP A;  3QO8 A;  5HFM A;  2N74 A;  1HNW O;  3L72 H;  5FNV B;  1NBM G;  4GLX A;  2P7T C;  4WCE V;  1N34 O;  1G8M A;  3UCS C;  2ZDI A;  3KKY A;  4I55 B;  3JD2 A;  1SQX H;  3I55 V;  3AG3 C;  2Q7H A;  2QKA A;  1O9G A;  1HP8 A;  1AI6 A;  1NS1 A;  2UU9 O;  3EHB B;  4GZR B;  2BOC C;  2WWW A;  2QTO A;  1B3Q A;  2VRZ A;  4WFG A;  1ORQ C;  2UUA O;  4AQY B;  3UM7 A;  3QO5 A;  2UXD O;  4DR7 O;  1JFF B;  1Q86 W;  2JDI G;  4LF9 O;  4W4K A;  4NR1 A;  4DK1 A;  3UQ8 A;  2XT9 A;  4BAY A;  2GBO A;  2IW5 A;  3OUF A;  5CBH A;  4P9O A;  1MZF A;  4CH4 A;  3K79 A;  4O4L A;  3AK2 A;  1TUB A;  2VWK A;  4B7E A;  3P3N A;  1VAR A;  2NNU A;  1YIT V;  2DYR B;  1PKX A;  4FLV A;  2ZE6 A;  4B3R B;  1ZL8 B;  3J7A U;  3SYC A;  2HLD G;  2Q5Z A;  4UCU A;  5H9C A;  2RMK B;  2XUM A;  1FYJ A;  1SS3 A;  3SYP A;  4XBF A;  4JAU A;  1NT2 B;  1IVS A;  4UXN A;  1QR9 A;  1ARO P;  3GWO A;  2UXC O;  2AHY A;  1VP7 A;  3CJH B;  1EN4 A;  1JFF A;  4FZ0 A;  3HKC B;  1WLE A;  1JCH A;  2UXB O;  1YJN V;  3SJQ C;  1HNZ B;  2PTM A;  1HNX B;  3D3Q A;  2QSA A;  2W6I G;  1VMG A;  1PV0 A;  1RFY A;  2ZIN A;  2D3O W;  5C93 A;  1SZT A;  3L71 H;  3CE2 A;  1LUW A;  4EFE A;  1OCZ C;  1KBH A;  1RP3 B;  3FYE B;  4P9P A;  1FFX B;  3OW2 U;  1URF A;  2JGD B;  2IJJ A;  3B4S A;  2DWD C;  2UXX A;  2P90 A;  1ZL8 A;  3E8H A;  4I4T B;  1AVM A;  2R70 A;  1YHQ V;  4PA6 A;  1NH2 D;  1SA0 B;  3SPJ A;  1L0N H;  2ODM A;  3K3W A;  4FIP C;  5LYJ B;  4PHZ A;  2BSK B;  3M7M X;  2XND G;  5TIS Z;  3OT7 A;  3CJH A;  1DF4 A;  5DEC A;  3SDL A;  3IAY A;  1Y4M A;  2GSM B;  3K5L A;  1SZX A;  3OGI B;  4JI2 B;  1FPO A;  2P6J A;  1PPJ H;  1H5W A;  3OUS A;  4TSF G;  2AZ0 A;  3CS5 A;  1XI1 A;  4B3S O;  1HR0 B;  1G4Y B;  4NB5 A;  2LP7 A;  1FFX A;  2O57 A;  3F5T A;  3OR6 C;  5CA1 B;  4IIJ A;  4X62 B;  1JJ2 U;  1R3I C;  5IY5 C;  1NJI W;  1EZV H;  1Q90 D;  1KP2 A;  3FB5 C;  2XAF A;  4GX1 A;  1AR5 A;  2ZT9 B;  3LSQ A;  1IBM B;  1SA0 A;  4QE9 A;  2BE3 A;  5LYJ A;  2YSU B;  5LL6 Y;  5L3C A;  4X9Q A;  3CRM A;  1SC5 B;  2RN9 A;  2W6J G;  3JD4 A;  4DV3 B;  4JZ2 A;  1W0K G;  1BT8 A;  1Q6U A;  4RUF A;  2Q4P A;  1KC8 W;  4O4I B;  5KHH A;  1UPG A;  3HB3 B;  4EB6 B;  2Z5U A;  4FM1 A;  2ZR3 A;  1K5S A;  1IBK B;  5KMG A;  2EUL A;  5CA1 A;  2W0F C;  4B3M B;  1WP7 A;  4DV0 B;  5IJ0 B;  2LGW A;  4DV5 B;  2FB5 A;  4J7K A;  4JI4 B;  1YEW A;  4TUY B;  3CPW U;  2EIJ C;  2BTO A;  1IDS A;  1VQN V;  2ITD C;  4JI8 B;  1LR1 A;  2DJV A;  1XNQ B;  1BSM A;  4LFC B;  2A79 B;  1GN6 A;  1SER A;  4FM2 A;  1QBZ A;  1FXK A;  3A2F A;  4UV9 A;  2QWR B;  1JQ0 A;  2H8P C;  3OM3 B;  4PDV A;  3K04 A;  4LP8 A;  4YY3 B;  1GM9 A;  3IFX A;  2E5L B;  4O4I A;  2F93 B;  2IJI A;  3MAQ A;  4LF8 O;  2QM4 A;  2OCC C;  4RWU A;  1SQB H;  1Q6I A;  5IYB O;  5B1B C;  4MVU A;  1XEQ A;  3K08 A;  4DUZ O;  1NR1 A;  2Q9L A;  3CC7 V;  1Q6H A;  1FJG O;  4UB6 Z;  1NU1 H;  1V9P A;  4TUY A;  3H1J H;  1WB7 A;  1SQF A;  1PL4 A;  3OMA B;  3K58 A;  4IT5 A;  4JV5 B;  3M99 B;  3RYH A;  3BAB A;  4K0K B;  4O4J A;  4JI6 O;  3N2K B;  4UFZ A;  4NKG B;  1CXZ B;  1TA8 A;  5EYP B;  2UUC B;  1AIL A;  1VQ9 V;  3ABM B;  2E76 B;  1E1Q G;  3K0G A;  4CS2 A;  1HDJ A;  5IT9 N;  2ATK C;  2VQF O;  1RPR A;  4HNA B;  2R9I A;  1FS0 G;  4MTO A;  3LNN A;  4LF7 O;  3THO A;  2EIK B;  4DR2 O;  1P84 F;  1OZ0 A;  3DXR B;  5LHH A;  3ABU A;  3I5D A;  1KEC A;  4OX9 B;  4DR5 O;  1GN4 A;  1IZ3 A;  3SPH A;  4DW1 A;  2V1D A;  2JS3 A;  3OTO O;  3ZRX A;  3FB8 C;  3CEI A;  2CGO A;  1US6 A;  2YXY A;  5EYP A;  2Z3Y A;  4L8J A;  3AG3 B;  5ITZ A;  1K7D A;  4GX2 A;  2EIM C;  2Q73 A;  4I5S A;  1N32 O;  1K97 A;  4I50 B;  1KP3 A;  4HNA A;  1NH2 B;  3TGU H;  5KHI A;  3N2G A;  4J9Y B;  5BY1 A;  2DQ3 A;  1N0J A;  3ZMV A;  3GVM A;  1WNS A;  3ZHV A;  1WA8 B;  4X66 O;  1VEW A;  4CH3 A;  5LMN B;  3L74 H;  1KYO F;  3U11 A;  4FLX A;  4N21 A;  4JI1 B;  1H2M A;  3ICX A;  3E8B A;  4FM0 A;  4MVO A;  2WA4 A;  5GTH Z;  3HR0 A;  4BIU A;  1YJ9 V;  3W7U A;  4DV6 O;  2GUZ A;  2X6C A;  1P49 A;  4RQF A;  4FZ1 A;  3C90 A;  3KCX A;  4TV9 B;  3KG2 A;  5JCO C;  3B8N A;  3JYC A;  3RWR D;  4F6R B;  1QR8 A;  4DYL A;  1VQK V;  1MNG A;  3BHP A;  3WB1 A;  4E4E A;  1H2N A;  3ZRW B;  4F6E A;  1YJW V;  4LF6 B;  1OCO B;  2IBZ H;  1WA8 A;  4PI2 A;  4DUY B;  3E35 A;  2YC0 A;  3GB7 C;  1J5E O;  4DV7 O;  1XL6 A;  5KX5 B;  1OCZ B;  1N33 O;  4O4H A;  5CA0 B;  1MSD A;  2A9H A;  1QVF U;  3Q4H B;  1OCR B;  3BAA A;  2CDY A;  2HVK C;  3OE7 G;  5KLV H;  2QGN A;  3ZHR A;  1I94 O;  2MK3 A;  4JF3 A;  3VQW A;  2Q0A A;  4K3A A;  2K9P A;  4H37 A;  2H3O A;  1TVK B;  3HKE B;  2N04 A;  3CXC U;  4TV9 A;  3W7S A;  3SJA C;  1GH6 A;  4BIZ A;  4JPR A;  2Y69 C;  3VBB A;  3O65 A;  4UUJ C;  4Z1V A;  2YXL A;  1GM8 A;  1JPX A;  5LBQ A;  3ZRW A;  1MG1 A;  4CS4 A;  1MOF A;  2OCH A;  4G28 B;  3G6B A;  2LW7 A;  1KUQ A;  2PYJ A;  5KX5 A;  2JEX A;  5CA0 A;  3BCC H;  4JAV A;  3ZMS A;  5H5N A;  3CHX A;  1VF7 A;  4LF4 O;  3E22 A;  4TV8 B;  2QE7 G;  3K06 A;  3G71 V;  1MA1 A;  5EBW C;  4D6T H;  4UVA A;  1WJZ A;  5IY5 B;  1YTF D;  1AB3 A;  2IU3 A;  2YEV A;  3JSN A;  2ZM6 B;  1Y76 B;  1DTO A;  3F7V C;  1ZX3 A;  1TVK A;  3HKE A;  1GN2 A;  3JAW A;  4AIL C;  3CD6 V;  3B2E E;  2Y4T A;  3FYI B;  3T4D A;  1AI4 A;  5IWA B;  4IGG A;  2KG7 B;  1U96 A;  4G27 B;  2R9R B;  5JJJ B;  5GON A;  1NR7 A;  1R6T A;  4UVC A;  2YI9 A;  3D36 A;  2ZIM A;  3OMI B;  3NXS A;  2ZKO A;  4PA4 A;  4YXW G;  2LGQ A;  5GW7 A;  4AQY O;  3CWB H;  2DW4 A;  3SPI A;  4TV8 A;  1IX9 A;  2QTS A;  4QNH B;  3S3W A;  4CZZ A;  3ETD A;  4TQF A;  1N36 B;  4X64 O;  2EIJ B;  5LMU O;  4J41 A;  1XMO O;  2OT5 A;  4MTG A;  1PL0 A;  5BR8 B;  3CRQ A;  3LSU A;  2JJ2 G;  2VWJ A;  1VQP V;  5LGU A;  2LJ2 A;  4TOI A;  4R6Z A;  3N27 A;  2QWO B;  1SES A;  2QWN B;  5C8Y B;  3CCR V;  1XNR O;  4OXS A;  4FLW A;  1K5Q A;  1Q8I A;  4MVQ A;  4GX5 A;  2QKC A;  2EIN C;  2HP8 A;  2IU0 A;  4UCV A;  2DYS C;  1TUE B;  4AI8 A;  3FB6 C;  3BEH A;  4DR4 B;  4E2L A;  3CSX A;  4MS2 A;  2OTJ V;  4RAI A;  1S77 D;  2OCC B;  4MTX A;  3J81 N;  4CS3 A;  2R9A A;  2A7W A;  4PA3 A;  2CGN A;  4B08 A;  1H8H G;  5FL7 G;  4LC1 A;  2E74 B;  1WPX A;  3WB2 A;  1HNZ O;  4JYY A;  1DGS A;  4DV4 O;  4X1I B;  2ARH A;  3JCZ A;  1FD9 A;  2HR3 A;  3G6E V;  3OD4 A;  4K35 A;  1HWY A;  4MVZ A;  1BHB A;  1XBL A;  2Y4U A;  1DK1 A;  1VQL V;  4K8X A;  5C8Y A;  4NTX A;  3CCS V;  5FNV A;  5A2Q N;  1WP8 A;  2LQT A;  2B1G A;  3PJS K;  2HG5 C;  1E79 G;  3IC7 A;  4FFB B;  4I55 A;  3LDD A;  4PV1 B;  4U7N A;  1JJO A;  3ZX6 A;  3TJT A;  3K03 A;  2GDS A;  1N4C A;  3ASN C;  4GYC B;  3KDR A;  3ASO B;  1R3L C;  3ZHU A;  2JEU A;  4J11 A;  1V55 B;  4JI2 O;  3ZMT A;  1F7Y A;  3APO A;  4X1I A;  5D5P A;  3OFN G;  2VS0 A;  1HNW B;  4WFH A;  5KA5 A;  1N34 B;  4Q20 A;  2ZCE A;  3CCU V;  5EC1 C;  2R72 A;  1G6U A;  2X0L A;  5LP6 C;  2UUB O;  2A0L A;  3AG7 A;  2EIM B;  2W0X A;  3HKB B;  1YIJ V;  3SYQ A;  3RYF B;  2VQE O;  1PNL A;  1R3K C;  4KFM A;  1AI5 A;  4FFB A;  3AG1 C;  4H33 A;  2UU9 B;  2H94 A;  1Z5V A;  2CTR A;  4PDR A;  3AG4 C;  2OIE A;  2LW1 A;  3H1H H;  5KUK A;  2UUA B;  4JI7 O;  5E79 Z;  5F2V O;  3AG2 C;  4DV3 O;  4JTC B;  4LF9 B;  1NVP D;  3P30 A;  4PDM A;  2QKS A;  5CA3 A;  2HJD A;  3L9D A;  4CH6 A;  3ETG A;  3HKC A;  4X20 B;  2F1M A;  1IBK O;  4GKJ O;  2K1E A;  3ABK C;  3NR7 A;  3E86 A;  4JI3 O;  3T4Z A;  1AJN A;  4ZOL B;  4B3M O;  1I0H A;  1EZJ A;  4DV0 O;  1TAE A;  1Y66 A;  4ZI7 B;  1YTF B;  4JI4 O;  4RO2 A;  3SJC C;  3E8G A;  1FAF A;  2P5O A;  5L3F A;  3ZRS A;  4JI8 O;  1BZK A;  1XNQ O;  3KZI Z;  3FAV B;  4XDJ A;  1XMQ B;  3SGI A;  2P4V A;  3IJ4 A;  3DTU B;  4WBN B;  2JGD A;  5LGT A;  2UXC B;  2IM9 A;  1GM7 A;  3RBZ A;  4FLT A;  4I4T A;  4DRX B;  3B77 A;  4ASU G;  2UXB B;  2JS5 A;  4YY3 O;  2BSK A;  4KP4 A;  2E5L O;  2RCV A;  4LNU B;  3ZHQ A;  1DF5 A;  3G4S V;  2Q7E A;  5IYZ B;  5CB4 B;  2N05 A;  4I7Z B;  4YIO A;  5EK0 A;  1O9H A;  3FKS G;  4UCT A;  2CH7 B;  1S76 D;  3ZN0 A;  1BHA A;  2AHZ A;  3E89 A;  4ZOL A;  3ABL C;  1EN5 A;  2RDC A;  4BW5 A;  1IUR A;  1R3J C;  5JCO A;  4JV5 O;  1D5N A;  1XQ8 A;  2PI5 A;  3FAV A;  3WG7 C;  2Y69 B;  1NZ6 A;  1H8E G;  1Q7Y W;  4AHC A;  3U10 A;  3VQY A;  4FLU A;  3RVZ A;  4H0L B;  2F66 C;  4I0X B;  2ZQM A;  5EZY B;  3CME V;  3K59 A;  1V54 C;  2XAH A;  1S0V A;  2XHB A;  4P2Z A;  4PI0 A;  4QJF B;  1F4N A;  3K9S A;  3JAS B;  3JSL A;  1PD3 A;  1Q81 W;  4DR6 B;  5IYZ A;  4B3S B;  5CB4 A;  5H6Q A;  1Q5O A;  1M56 C;  4BIO A;  2YDE A;  2CH7 A;  1RM1 C;  4BR6 A;  4EB6 A;  3MHH C;  2HHH O;  2QWP B;  2V4D A;  4OX9 O;  2RNB A;  4JI0 B;  5BMV B;  4X1Y B;  3JAM N;  2HEP A;  4HYO A;  4GUN A;  5CBG A;  4X8A A;  2X7R B;  5IJ0 A;  2ILM A;  1T5E A;  2P67 A;  1M5I A;  1S5L Z;  1BQ0 A;  1BL8 A;  2HFE C;  1Y74 B;  1VQ7 V;  1AR1 B;  1D2D A;  1JR9 A;  3CC4 V;  3RYI B;  4WFE A;  4ZBM A;  3CP1 A;  1PNK A;  3WB0 A;  2Q67 A;  2JJ1 G;  3HKD B;  3JAS A;  4GKK O;  3ZCC A;  3RW0 A;  2YIB D;  3KCY A;  1KKC A;  1COW G;  1L0L H;  1SQP H;  4X1K B;  1GRJ A;  4X88 A;  3IC9 A;  1W0J G;  1IBL B;  3CCL V;  4X1Y A;  1AJP A;  4PDL A;  2AW9 A;  3DGE A;  1VF6 A;  4JYC A;  2QJ1 A;  1SRY A;  1VIB A;  1Z5W A;  2EIN B;  3OMN B;  1Y74 A;  2DYS B;  3RYI A;  4LF5 B;  3N2K A;  1S5H C;  3W7X A;  4ABM A;  2GV9 A;  4LCU C;  3VQV A;  3JAT B;  5KHJ A;  4LF8 B;  4NXN O;  1M1K W;  1I5X A;  3RYC B;  3AK1 A;  3ZMZ A;  2M6Y A;  3BVO A;  3SYO A;  4DR1 B;  4LF6 O;  1HW7 A;  5LHI A;  1KB9 F;  4X1K A;  2OIG A;  1NVP B;  3CCJ V;  2PGG A;  4DW0 A;  2L6L A;  2Q8V A;  2FYU H;  3DXR A;  3CXH F;  3T1C A;  3CB2 A;  4JI6 B;  2F4V B;  1WN7 A;  4I9W A;  1WB8 A;  1VQ6 V;  2M7W A;  2CTQ A;  4ICG A;  4TQD A;  5B3S C;  4JAS A; 
#chains in the Genus database with same CATH homology
 4JZ2 A;  1BT8 A;  1EN4 A;  1JR9 A;  1ZLZ A;  1XDC A;  1MNG A;  1BS3 A;  1PM9 A;  1AP6 A;  4E4E A;  4F6E A;  3C3S A;  1JA8 A;  3TJT A;  2GDS A;  1ZTE A;  3KDR A;  1LUW A;  1ZUQ A;  1GN4 A;  1MSD A;  2RCV A;  1IX9 A;  3QVN A;  4YIP A;  3KKY A;  1KKC A;  3CEI A;  4YIO A;  1IDS A;  2CDY A;  1AP5 A;  1GN3 A;  1EN6 A;  3IC9 A;  3LSU A;  1BSM A;  1AVM A;  1I08 A;  1GN6 A;  4C7U A;  1EN5 A;  4FFK A;  2AW9 A;  1XUQ A;  1B06 A;  1LUV A;  2QKA A;  1EM1 A;  1D5N A;  3OT7 A;  1QNM A;  2CE4 A;  2QKC A;  1AR4 A;  2P4K A;  2ADP A;  1P7G A;  1SZX A;  3C3T A;  1N0J A;  3MDS A;  1VEW A;  1XIL A;  3DC5 A;  3K9S A;  1XRE A;  3AK3 A;  3AK1 A;  4JZG A;  3AK2 A;  3RN4 A;  1ZSP A;  1Y67 A;  1WB7 A;  3BFR A;  4JYY A;  3DC6 A;  1MA1 A;  1PL4 A;  2ADQ B;  1N0N A;  5A9G A;  1VAR A;  4BR6 A;  1AR5 A;  3EVK A;  1GN2 A;  1MMM A;  5AG2 A;  1I0H A;  1WB8 A;  4X9Q A;  4GUN A;  1IXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...