1I0HA

Crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE Y174F MUTANT
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i0hA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i0hA02
4BR6A 4E4EA 1P7GA 1IX9A 4YIOA 2GDSA 2QKAA 3K9SA 1N0NA 3AK2A 2RCVA 3AK3A 1AP6A 4YIPA 3IC9A 3MDSA 3QVNA 1ZSPA 2ADPA 1MMMA 1KKCA 4F6EA 3BFRA 1XREA 1MSDA 2QKCA 5AG2A 3AK1A 3DC5A 3CEIA 1Y67A 1PM9A 1EN6A 1XILA 1JA8A 4X9QA 3KKYA 4JZGA 4JYYA 1ZLZA 1AR4A 1VARA 3C3SA 1BSMA 3RN4A 1GN4A 2AW9A 5A9GA 1MNGA 1N0JA 1WB7A 1MA1A 1EM1A 1I0HA 1ZTEA 3EVKA 1I08A 1B06A 1XDCA 1D5NA 1IXBA 1QNMA 4FFKA 1XUQA 1WB8A 2ADQB 1SZXA 3OT7A 2P4KA 1AR5A 1EN4A 1BS3A 1VEWA 2CDYA 1AP5A 4JZ2A 2CE4A 1LUVA 1PL4A 1JR9A 3DC6A 4GUNA 1BT8A 3LSUA 1EN5A 3C3TA 1GN3A 1ZUQA 3TJTA 4C7UA 1GN2A 1IDSA 1LUWA 1AVMA 1GN6A
chains in the Genus database with same CATH superfamily
1NU1H 4I5SA 4W4LA 4GT1A 4DV6O 3SYQA 1PNKA 3RYFB 2RDCA 1GTOA 3M99B 5IWAO 2JGDB 2F4VO 1FFXB 1QQCA 2JVDA 3A2FA 3K9SA 1T5EA 2QKSA 4LNUA 2HP8A 3JD0A 1W0JG 3CRAA 4RQEA 4J9YB 1B3QA 3AK3A 3I5DA 2WWWA 2IH1C 3JAKA 4Q6GA 4WFAV 3WB1A 4DR6O 2EIMC 2ZDIC 3HKBB 2UU9B 4O4HA 1H2NA 2F1MA 4DUZO 1AI7A 4FLXA 1XOUA 3D3QA 4B3TB 1VQ7V 1H5WA 4EB6B 4ZBMA 3OFNG 4JZGA 2YEVA 2P06A 2V4DA 2YIAA 3ZN1A 2JK5C 3RN4A 2H94A 3IGAC 3RYHB 3WU2Z 5J2TA 1N0JA 5EZYA 1S77D 2E75B 4MT8A 3SPGA 3JAMN 1M5IA 3HKCA 2YIBD 5L3GA 1WA8B 3OD4A 2HHHO 1R3KC 3ZMTA 2VWKA 1F7YA 2X0LA 3FYEB 5IJ0A 1YI2V 1BZKA 3FB8C 1H2KA 3ETQA 3OT7A 3QG5A 4MVZA 4I4TA 1JFFA 1XMQO 3H9VA 4LBEC 3ABTA 3ML0A 1XMOB 2CE4A 2IJJA 3ZMSA 4UV8A 3F7YC 2GBOA 3ABKB 1SC5B 4YJ2B 3FB7C 4UV9A 2B9ZA 4FM2A 4PA3A 1DGSA 4W4KA 1M9NA 4OPAA 5IYZB 4UVBA 4X20A 3E2EA 4LC1A 1XI1A 1W2BU 1EBOA 3R65A 1AVMA 1WAZA 1BE3H 1SETA 5FLXN 4MS2A 1QR8A 1KECA 1PD3A 2QKAA 1RPRA 4LF9O 1VIBA 4BIOA 2UUCO 3B2EE 4I0XB 1W0KG 3I55V 1QVGU 2XASA 3IC9A 4XDJA 1YJWV 3DSQA 4HZ3A 5LYJB 1JJ2U 3UO3A 4ZHQA 3K5OA 4K8XA 3O65A 1OHHG 1IBLB 4WBNA 2HVJC 1XILA 4LF7O 3SYCA 1P49A 1AB3A 4JYYA 5JVDA 3T1HO 3U0ZA 4GX1A 1YZBA 4JI0O 5LMNO 2QE7G 1SQVH 1J5EO 3FAVB 3OR7C 3QO8A 1JMKC 1PL0A 4GX0A 1Q86W 2EZPA 1WB7A 4PI2A 1FPOA 2P90A 2QWOB 3SYPA 3EVKA 1K92A 2EULA 3NXSA 3ZRSA 1OCCC 4JAVA 3ASNC 3QO7A 3ZRVA 5EBWC 3F5WC 5B5EZ 4IHJB 3JATB 5IYDO 2WLLA 2YXLA 4LR3A 5FNVA 1BCCH 4QE9A 4DW0A 1WPXA 2UXXA 1AR5A 2MK3A 2JEXA 2VQFB 2LFSA 3SR2C 2CTRA 3B8MA 3BA9A 1OCZC 4UB8Z 3A0BZ 4DR5O 3ABMC 3RYFA 2Q73A 3SJAC 2DWDC 5DECA 3ABUA 1K8AW 2QTSA 1FXKC 1S76D 3MHHC 4K0KB 3W7SA 1KU9A 2CTPA 5IY5B 2RMKB 3ZHRA 2XT9A 2XAHA 1H2GA 2EBOA 4UCUA 2UUBB 2R72A 5LGTA 3JARA 4FIPC 1WJZA 1YTFD 2PY5A 1UPGA 1Q3EA 2OIGA 4TQFA 3K5MA 1E1QG 1N0NA 4DW1A 2ZM6O 4EB6A 4DV6B 1RM1B 4YIPA 4DRXB 1ZSPA 1S3JA 2KQXA 1M4UA 1V9PA 3RYHA 2QKCA 1Z2GA 1N32O 1Y67A 3FFQA 4GKJO 4DV3O 3SGIA 1NVPB 3IAYA 1WA8A 4QPKA 4DR1O 2UXNA 1GMGA 4PHZA 4TV9B 5LXTA 4X1IB 3BABA 2AHYA 5KA6A 4DR6B 1O9GA 2BCCH 2QWNB 2BSKA 1EM1A 3P3PA 3ZIAG 3K9AA 2EJ7A 2DWEC 1FAFA 2Q5ZA 2LJ2A 2XOKG 4MVUA 1IXBA 3G71V 2ITCC 1G8MA 3VQXA 4Z2WA 1IBMB 5F2VO 3J7AU 5LHIA 4J11A 1KQSU 5IYZA 2AXTZ 1S5HC 3CRMA 1KP3A 2HHHB 2LW1A 1ROPA 4FFBB 4CH4A 4FK5C 3S3WA 2OTLV 2ATKC 4YHHO 4KFMA 2JS5A 4FM0A 4DV7O 1QHTA 3HKDB 5LHGA 1Y6XA 3J81N 5GTIZ 4ZKIA 3ZBHA 4WF9V 1N33B 1LUWA 1ZAUA 3CXCU 1FYJA 2P22C 4GX2A 3CP1A 2XAQA 2FYUH 3CC2V 4O4LB 4UCVA 1AILA 2O57A 4I0XA 4I50B 3ZJZA 2WLNA 1IVSA 3JYCA 1SKVA 3CMEV 3X2QC 3UT5A 3OMIB 1K5QA 2ODMA 4B3RO 4NVPA 3F7VC 1SA0B 3Q4HB 3ZHQA 1VQPV 1R6NA 1OCCB 1YF2A 3QVNA 3CCLV 2YC0A 3FAVA 1KKCA 4MVMA 3BFRA 4LF9B 3QF7A 2Y4TA 1BQZA 1HNXO 2BTOA 2P7TC 1PM9A 2VWJA 4K35A 1JA8A 3ZRWB 2UUCB 3KG2A 4K8ZA 3CRQA 4JI5B 1K7DA 1JVMA 1XQ8A 2AZ2A 4LFCO 3JATA 4I9QA 1OCZB 2WSSG 4J42A 3ABMB 1YHQV 3T4DA 4DR4O 4LF6O 1YJNV 1XDCA 3T1HB 1FXKB 4LNUB 1PNLA 1NQTA 4JI2B 1J5EB 2IW5A 5B1NA 2CGOA 3K5LA 1V54C 5CA1B 1SQXH 1N34O 4QPJA 2QA4V 4DV5O 2ZDIA 2CDYA 1R6KA 3E22B 3OM3B 1PL4A 3LNMB 4H44B 4YXWG 4O4IA 4N23A 4RWUA 1Y74B 4FLZA 3UQ8A 2N05A 4JYAO 1Q6HA 2UXCB 2BTQB 3RBZA 3VQYA 5LHHA 4DV2B 4DR7O 5DEDA 3N2KA 3ZN0A 3HKCB 1THZA 1SESA 2G38A 4R7CA 4JI4B 1VQOV 2XNDG 1P7GA 5E1AC 2B1GA 1IX9A 4DV4O 1OCRC 3H1KH 1L0LH 5FPOA 5IJ0B 2ZXWC 4NKGB 2QJ1A 4LH6A 4I7ZB 5EYPB 1YIJV 3BY6A 5KLVH 1XNRO 2ZE7A 4TWKA 2A7WA 4I4TB 1JFFB 4X62O 4JYBA 4EKWA 2RCVA 3WB0A 2Q7EA 3MDSA 1XL4A 4Z1MG 1MMMA 1OZ0A 4PA6A 4X1IA 1YITV 4PI0A 4DO2A 4JV5O 3CPWU 3JAWA 3DC5A 3ABLB 2R70A 4X20B 4G27B 5LGUA 1K97A 3GB7C 5KX5B 3ZS8C 4A5UB 4DV1B 3IC7A 3ZX6A 3AG4C 3ZMUA 1BHAA 3OE7G 2HJFC 2ZR2A 4I55A 3BCCH 3G80A 1H38A 4DV0O 2DYRB 4MW3A 5CBFA 1N32B 3OTOB 5JQGB 4GKJB 4DV3B 2ZQMA 2P5OA 1E79G 4F4LA 1QBZA 1YTFB 4J9ZB 1GRJA 5KHKA 2Q7GA 3HKDA 3X2QB 2CUGA 2OWOA 1M93A 1XBLA 4ZHQB 2DW4A 3CE2A 3CSXA 4JPRA 4B3SO 1AP5A 1NTKH 4JZ2A 1XEQA 3JD2A 3OUSA 3CD6V 4O4LA 2HEPA 4K3AA 4I50A 2ZINA 5EIBC 1L0NH 1EN5A 3FKSG 3CYOA 2Z3YA 4X64O 3SPIA 3S3XA 3R66A 1GN6A 4HNAB 2L35A 4YHHB 4DV7B 4Z1VA 4YIOA 1TUEB 3M8AA 4IYHA 1SQBH 5B1BC 3E8BA 2WLLB 5FNVB 3SPHA 1VQKV 4MSWC 3U11A 2DJVA 1GM8A 1Y4MA 3CCVV 1KD1W 4BAYA 4CH3A 5LGNA 2DQ3A 1MZFA 3WG7C 2W0XA 3ZRWA 4GZRB 4X65B 4GYCB 4GCZA 4B3RB 2CH7A 3GWKC 1MSDA 2EIJC 2UXBO 1RPOA 3RWRD 1FXKA 4D7SA 2EINC 3MD0A 1M57C 4YY3B 2BOCC 2E3CA 4LFAB 2AW9A 2P67A 1HNXB 1BQ0A 5KAIZ 4PELA 2NNUA 5CA1A 3JARB 3AG2B 1P7BA 2DN9A 2YICA 1AI6A 2QSAA 2MW2B 3KDRA 2YS8A 3TK1A 3E86A 1SRYA 3W7WA 5BXZA 1YDXA 3CCJV 3E22A 3P32A 4PJ0Z 1FS0G 2WAMA 1Y74A 3MAQA 2ZXWB 4FLVA 4LF6B 4NTWA 2BTQA 3AG7A 2P4KA 1XHZA 1NBMG 4JASA 3IFXA 5J9PC 1LUVA 4U7OA 1TUBB 1XL6A 3KCYA 4LH7A 2R9RB 1ZL8A 1XNQB 1NKDA 5LA6A 1VQNV 1NTMH 3LSUA 5LXTB 1SS3A 2A0LA 3L71H 1N34B 2IH3C 1ZWIC 3DXRA 4DV5B 3CCQV 5EYPA 2BSKB 2QR4A 2UXDO 3ZEDA 1VQ8V 3JCZA 3B77A 4BR6A 4U7NA 2WA4A 3JASA 4LF8O 4PDRA 1MOFA 3ZHVA 1IXMA 4FJCC 4JYAB 3AG4B 4DR7B 4MVOA 1CPYA 4B3MO 1JQ0A 3OUFA 4J10A 2Y4UA 4NR1A 4P9OA 2XHBA 4X89A 5KX5A 4DV4B 4PA9A 2FKXA 4KHPO 5H5NA 5BR8O 2ADPA 3JD1A 4IL6Z 5GONB 3AK1A 2CTWA 1OCOC 2PUSA 5JQGA 2WLKA 4JI7O 1FD9A 5FL7G 4X62B 3A8TA 2E76B 1NI8A 3LDCA 5CB4A 1KUQA 3T2MA 4ASUG 3OEEG 1IJGA 1I7FA 1QLNA 1TVKA 3W7TA 3AG3C 3L70H 1PPJH 2ILMA 3H1JH 2PZSA 3UT5B 4UCSA 1K3EA 1NH2D 2DE0X 4D6TH 1I08A 3ZRXA 1VQ6V 3AG1C 5KHIA 1QNMA 4HYOA 1SQFA 2Q8VA 2X6AA 4NXNB 3QTCA 3L74H 1E1RG 5CN0A 1B6QA 1GO3F 1K4DC 3OMNB 1VEWA 1WLEA 3B4SA 4KL1A 4O4JA 2ZE6A 4HNAA 3H1LH 1F23A 1K5SA 4OX9B 3ZCCA 1PP9H 4B7EA 3CXHF 4DR3O 3CMAV 5IDJA 3BPZA 3FD9A 1BL8A 1HNWO 1K4CC 4B3SB 3T1YB 1MG1A 1KP2A 2EIJB 1SERA 3G67A 2GSMB 1NJIW 3CCMV 3ASOC 2EINB 1BGYH 4WFFA 1LNQA 4JAUA 3VOUA 4FMTA 4Q20A 1NT2B 3HB3B 1Q6UA 1DK1A 2EIMB 2GTAA 1VQLV 4J80A 4AQYB 1H8EG 2PF4E 4O4IB 4JTDB 1Q81W 3ETGA 1R3LC 3CEIA 3GVMA 3TXSA 4TT3G 4GKKB 4CBCA 3N2KB 3CRCA 4UFZA 4ABMA 1WNSA 5C8YB 3KCXA 2WPDG 1BSMA 3OTFA 3M7MX 2LGWA 5A2QN 1KMIZ 5IWAB 2PI4A 1ZTEA 2F4VB 4U3JA 2NN4A 1EFRG 4KXRA 4FLTA 1D5NA 1COWG 3FYIB 1K73W 1R3IC 2LQTA 2B5UA 2GV9A 2KKWA 1TUBA 3EFFK 5K1XA 1OJHA 1WB8A 4MW8A 5GTHZ 5L3EA 1YSCA 4X66O 5KHHA 3JAWB 4DUZB 4TOIA 4DK1A 5LOVA 3ZMZA 3WFVA 3DC6A 2X6BA 5D5PA 1BT8A 2BE3A 3RW0A 2K1EA 1VF5B 1WPBA 1V55C 4I55B 3TJTA 5KHJA 1OCOB 5JCOC 5JJEB 3IJ4A 1PKXA 4E4EA 1J95A 1M56C 2QWPB 2ZCEA 3B40A 2KB1A 4JYCA 2DOSA 4E2LA 4WFHA 5B1AC 3AG3B 4XBFA 1NZ6A 4PDLA 1I5XA 5GONA 2B1IA 4QGPA 1XMQB 4LF8B 3D36C 5JJJB 2Z0AA 4LFBO 2HFEC 1URFA 4IYIA 1QLEC 5GW7A 3ZHSA 1DTOA 2HVKC 1FJGO 4JI8O 1GM7A 2FMLA 5IE9A 5LMUO 4B3MB 1JNBA 2YI9A 5LP6C 4DUYO 1ORQC 3K58A 2CTQA 3VBBA 2JDIG 1ZLZA 2Q0AA 3D3IA 1IBKO 3C3SA 4WCEV 3ASNB 1GN4A 2Q67A 5H6RA 3FB6C 1YCIA 4NB5A 4DXWA 4JI7B 4IIJB 5BY1A 1HW7A 4UCTA 4GX5A 2VQEO 5L3DA 3CJHA 3ZHTA 4DR2O 1TGOA 1AI4A 4LCUC 5BMVB 2IBZH 3G6BA 4GLXA 3RFRA 2D3OW 2CH7B 3HR0A 4MVRA 4X1YA 1VF6A 3PN1A 1H2SB 1VP7A 1N4CA 1HDJA 4LF7B 4F6RA 3K59A 1Q82W 4JI0B 2UU9O 5LMNB 2Q9LA 5H9CA 1R3JC 5CBGA 1WP8A 1FXHA 3BA8A 4C7UA 1M90W 1B04A 2ZE5A 1FFTB 2M6YA 1NH2B 5L3CA 4QE7A 3O9OA 1G1XB 4DR3B 2GDSA 2Y48A 2QWRB 2LGQA 2GUZA 2VRZA 4JI6O 1AR1B 5KMGA 5IJ9A 1UJWB 1FOUA 4WFBV 2EX3A 2Y0IA 1JJOA 1SQQH 3K57A 1M1KW 1KYOF 2QM4A 5EIBD 2Z5UA 4JGSA 1ZL8B 5C8YA 4JI1O 3UKMA 5LA6B 1PNMA 1XREA 4EFBA 4DR5B 1XHXA 1G4YB 2HG5C 3DXRB 5EBLC 5ITZA 1US6A 2DQ0A 4PV1B 3JASB 4D7TA 3HPLC 2XAFA 5CBHA 1LR1A 1AI5A 3LSQA 5B66Z 4PDVA 1I94O 3A0HZ 2YUAA 4ICGA 5DN6G 1UFIA 3JALA 3SYAA 4I9WA 3P30A 5FPRA 3CCRV 2ZM6B 2OT5A 1ENVA 2WLHA 3W7UA 2RJZA 4EEQA 2X7RB 4HAMA 1KC8W 2GTSA 5B1AB 3B8NA 4H13B 4LWSA 5CA3A 4B7KA 3K3WA 1Y66A 4DR1B 5CB4B 1QLEB 1S0VA 2WLMA 1IBLO 5D5QA 3C3TA 5KAFZ 4ZIBA 1TVKB 3JSLA 2CAZC 5HFLA 1N36O 4UB6Z 1NR7A 2YI8A 1KB9F 4AILC 4FLUA 5IYBO 1HWYA 5EC2C 2LFRA 2UUAO 1RSOA 1F51A 4O4JB 2OYQA 4NXMO 2HLDG 3NR7A 5H2FZ 1IURA 2M7WA 4CS4A 1EN6A 4IIJA 2VQFO 3KKYA 4JAAA 1P4RA 2CGNA 2XAJA 4P30A 1HP8A 1W59A 2F43G 2AZ0A 1FJGB 4MTXA 4BWAA 3E8HA 4JI8B 5BMVA 2KG7A 2Q6AA 4DUYB 1L1FA 1VF6C 4FVMA 1CP9A 1GK9A 1V54B 2EILC 1YEWA 3TETA 5EK0A 1JX9A 4UXNA 2N74A 4MTFA 2ADQB 1TAEA 2HKOA 3K79A 3CB2A 3UO2A 3CCEV 4O2BB 2VQEB 2ZNIA 1O9HA 1AJNA 4LF5O 4DR2B 3GWOA 2QWQB 2YXYA 1R73A 1KKDA 2E74B 1Y76B 4LF4O 4LFCB 1CEZA 2JJ1G 1AROP 3J80N 4PD4F 1OCRB 2RQ6A 4U3JB 2RNBA 4DR4B 4MVQA 1H2MA 1OV9A 3RYIA 1VQMV 4OGQB 2ETNA 3B09A 2IM9A 1D2DA 5B1OA 2A79B 3QNEA 1VQ9V 4AHCA 1YJ9V 4TQDA 1RP3B 4WFGA 5IY5C 1HNZO 3D8CA 3N27A 5JWPA 3CWBH 2HR3A 2XAGA 4P9PA 2ZNJA 1GKFA 5L3BA 3SJQC 4PA7A 3WB2A 1IBMO 5LOVB 3SDLA 3BEHA 1I5YA 3CCUV 3ETDA 2OCCC 4R8CA 4J7KA 4UUJC 1S72V 1RM1C 4JI6B 4ZOLB 4XDKA 3RGBA 4L87A 2QM8A 3L73H 5JCOA 4JI1B 4CC6A 2W6IG 5JH7A 1MNGA 1N33O 3CRRA 4X88A 5TISZ 3K0DA 2WA3A 5DM6V 4FPPA 2YXHA 1P84F 1XNRB 2LW7A 1GH6A 3TXQA 3D36A 2NR5A 1Q7YW 3APQA 1X59A 3JCUZ 1I94B 5J2UB 3OAAG 4ZI7B 1MZEA 1EN4A 2H8PC 4JV5B 2L6LA 2Y0PA 4TUYB 5BZBA 3SPCA 2F95B 1CXZB 5LP6A 1HR0O 4LP8A 4GUNA 1SQPH 5E79Z 2X6CA 3OEHG 2DYSC 3CX5F 3HKEA 3FB5C 4DV0B 2LO1A 4P2ZA 5B1BB 2ZKOA 2D2CB 4FZ1A 2A3QA 4JI5O 3E89A 2VS0A 1SQGA 4FLYA 3L9DA 3UCSC 2ZD9A 3CJHB 3WG7B 1R6TA 2IJKA 4N21A 1N36B 2F93B 2FTKA 2P6JA 4JI2O 1YXBA 1H2LA 2C2AA 4X1YB 3BRCA 3AK2A 1MSWD 5IYCO 2F66C 2EILB 2AHZA 4F6RB 3E8FA 2ZT9B 3LDEA 3PJSK 2OIEA 5CA0B 2UUAB 1QU7A 3VQVA 4BIUA 5KHGA 3U10A 2XTAA 2W0FC 1M57B 1H8HG 4CZZA 3N2GA 2CK3G 1GM9A 3H1IH 4CC5A 4QNHB 2PTMA 4X64B 4NXMB 3T4ZA 2JS3A 2JEUA 3BAAA 3E83A 2UXCO 2YDEA 1U96A 4DV2O 2Y69C 1RFYA 1TA8A 3I56V 5B3SC 4JI4O 1QR9A 3FX7A 2PYJA 3AEIA 4O2BA 3G6EV 1BHBA 2OTJV 2GUZB 3E35A 5KMGB 4J7ZA 5IJ9B 4H0LB 4FFKA 2JGDA 2WLJA 1FFXA 2V1DA 2W6JG 3RYCB 4KP4A 1Y76A 2Q7HA 2JGUA 2EIKC 5L3FA 2NLJC 1D5AA 4G28B 4NTYA 2UXBB 3SPJA 4O2AB 2IU0A 4BW9A 3TCUA 2Q69A 2OCHA 5ITZB 4TV8B 2IJIA 3HKBA 4XDLA 2JIZG 3P3NA 2R9AA 1DF5A 3G4SV 1K34A 3CC7V 2QEXV 1GN3A 2OCCB 5LBQA 3MHSC 4H37A 2K9PA 2QGNA 1Z5WA 4LF5B 3CC4V 1VF7A 2LP7A 4DV1O 3JALB 1AJPA 3STLC 1VQ5V 1WN7A 4IT5A 5HFMA 4X1KB 4LF4B 1Q43A 3EHBB 1F4NA 3SJBC 3OTOO 2WLIB 3W7XA 4CS2A 4RUFA 1F4MA 3L72H 2PI5A 4ZOLA 1QVFU 4LWSB 1JCHA 4UCRA 4RUEA 4DYLA 1HNZB 2P4VA 4RO2A 4J41A 4YJ2A 2UXDB 1KBHA 1DF4A 2KSDA 3H01A 3H1HH 3ABLC 5KA5A 4CS3A 4IGGA 4BW5A 3AG1B 5KUMA 4YJ3B 5A9GA 4CH5A 1MA1A 2DYSB 5J2UA 2R9IA 4ZI7A 1L8DA 2E5LO 4TUYA 1RSOB 2DYRC 2Q0OC 1NR1A 3K03A 2F23A 5CMUA 4QJFB 4OPHA 3LSSA 4MVSA 4JI3O 4KHPB 1S5JA 5BR8B 1S5LZ 4AI8A 4CH6A 4WFEA 1JPXA 1BS3A 4X65O 3APOA 1IZ3A 3ICXA 2JJ2G 3L75H 1MABG 5LYJA 2IJHA 4H33A 5K1PA 4MTOA 1DLBA 3RVZA 4EFEA 5LL6Y 3ZMVA 4HBNA 2HJDA 3LNNA 2KG7B 3ASOB 3OMAB 4RAIA 1ZX3A 1HR0B 1JOYA 3QO5A 4YY3O 1WP7A 2ITDC 3JD4A 4LFAO 1QCEA 3K04A 1K33A 4U3FH 3F5TA 3K0GA 1PV0A 5CA0A 2A06H 2Y69B 3T1CA 4QIWF 2ZE8A 5B3SB 1N8RW 4B3TO 4IHJA 3JSNA 3LDDA 4L8JA 1AP6A 4JTAB 4F6EA 4JTCB 4BIZA 5AG2A 3VQWA 2EIKB 4X9QA 1HNWB 1AJQA 1GAXA 3OW2U 1XNQO 3JAKB 3RVYA 4FM1A 3RYIB 4RQFA 1AR4A 1VARA 2ARHA 5EC1C 1G6UA 4O4HB 2QM7A 4PA4A 3RYCA 2ZIOA 3A0RA 1Q6IA 2Q4PA 3K5NA 1B06A 2YEVB 2YIDA 3LUTB 1X4TA 3BHPA 4DK0A 1XMOO 2H3OA 1EZVH 3AG2C 2ZIMA 4O2AA 1XUQA 5J2TB 3C90A 1Q8IA 4TV8A 4MTGA 5EZYB 4UVCA 4PDMA 2EZOA 1VQ4V 2BOBC 3DGEA 3OGIB 1A32A 4FZ0A 3DTUB 4R50A 4UVAA 1EZJA 1V55B 4DRXA 1NTZH 4X1KA 2RN9A 1K9MW 4KUMA 4NYKA 3UM7A 1M56B 1ZUQA 2WLIA 4R6ZA 5JH7B 1SF9A 1Q5OA 1GN2A 5C93A 2PGGA 5EBMC 3ETEA 4TV9A 2GHYA 3CCSV 1BMFG 4FLWA 3K06A 3CS5A 3THOA 4UCOA 2V7QG 2IU3A 2AGAA 3OGCC 3K08A 4TSFG 4X66B 1Z5VA 2FL4A 3ABKC 2DMXA 1VMGA 1YVWA 5LP6B 3E8GA 4B08A 4NXNO 4NTXA 3TGUH 4YJ3A 3CHXA 4FFBA 2A9HA 2QTOA 3RT3C 3HKEB 3ZHUA 3JD3A 5IT9N 2PYLA 4OX9O 3KZIZ 5JJNB 3SYOA 1R1BA 2EJRA 2N04A 2Q68A 1I0HA 4WBNB 3T1YO 2JRIA 2ZR3A 5JVDB 2XUMA 3BVOA 4JF3A 2YIBA 3STZC 3OR6C 1Q90D 4LFBB 1SZTA 4J7JA 1NS1A 4X8AA 1SZXA 1SA0A 4G2KA 3Q4HA 4OXSA 5LMUB 2E5LB 4K0KO 2YSUB 1FXVA 3N2GB 4AQYO 1JR9A 4JI3B 2UUBO 5H6QA 1NVPD 5KUKA 3SJCC 1IBKB 1FKAO 2QDOA 1U97A 4GKKO 2FB5A 1IDSA 3EXAA
chains in the Genus database with same CATH topology
4BR6A 4E4EA 1P7GA 1IX9A 4YIOA 2GDSA 2QKAA 3K9SA 1N0NA 3AK2A 2RCVA 3AK3A 1AP6A 4YIPA 3IC9A 3MDSA 3QVNA 1ZSPA 2ADPA 1MMMA 1KKCA 4F6EA 3BFRA 1XREA 1MSDA 2QKCA 5AG2A 3AK1A 3DC5A 3CEIA 1Y67A 1PM9A 1EN6A 1XILA 1JA8A 4X9QA 3KKYA 4JZGA 4JYYA 1ZLZA 1AR4A 1VARA 3C3SA 1BSMA 3RN4A 1GN4A 2AW9A 5A9GA 1MNGA 1N0JA 1WB7A 1MA1A 1EM1A 1I0HA 1ZTEA 3EVKA 1I08A 1B06A 1XDCA 3KDRA 1D5NA 1IXBA 1QNMA 4FFKA 1XUQA 1WB8A 2ADQB 1SZXA 3OT7A 2P4KA 1AR5A 1EN4A 1BS3A 1VEWA 2CDYA 1AP5A 4JZ2A 2CE4A 1LUVA 1PL4A 1JR9A 3DC6A 4GUNA 1BT8A 3LSUA 1EN5A 3C3TA 1GN3A 1ZUQA 3TJTA 4C7UA 1GN2A 1IDSA 1LUWA 1AVMA 1GN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BR6 A;  4E4E A;  1P7G A;  1IX9 A;  4YIO A;  2GDS A;  2QKA A;  3K9S A;  1N0N A;  3AK2 A;  2RCV A;  3AK3 A;  1AP6 A;  4YIP A;  3IC9 A;  3MDS A;  3QVN A;  1ZSP A;  2ADP A;  1MMM A;  1KKC A;  4F6E A;  3BFR A;  1XRE A;  1MSD A;  2QKC A;  5AG2 A;  3AK1 A;  3DC5 A;  3CEI A;  1Y67 A;  1PM9 A;  1EN6 A;  1XIL A;  1JA8 A;  4X9Q A;  3KKY A;  4JZG A;  4JYY A;  1ZLZ A;  1AR4 A;  1VAR A;  3C3S A;  1BSM A;  3RN4 A;  1GN4 A;  2AW9 A;  5A9G A;  1MNG A;  1N0J A;  1WB7 A;  1MA1 A;  1EM1 A;  1I0H A;  1ZTE A;  3EVK A;  1I08 A;  1B06 A;  1XDC A;  1D5N A;  1IXB A;  1QNM A;  4FFK A;  1XUQ A;  1WB8 A;  2ADQ B;  1SZX A;  3OT7 A;  2P4K A;  1AR5 A;  1EN4 A;  1BS3 A;  1VEW A;  2CDY A;  1AP5 A;  4JZ2 A;  2CE4 A;  1LUV A;  1PL4 A;  1JR9 A;  3DC6 A;  4GUN A;  1BT8 A;  3LSU A;  1EN5 A;  3C3T A;  1GN3 A;  1ZUQ A;  3TJT A;  4C7U A;  1GN2 A;  1IDS A;  1LUW A;  1AVM A;  1GN6 A; 
#chains in the Genus database with same CATH topology
 1NU1 H;  4I5S A;  4W4L A;  4GT1 A;  4DV6 O;  3SYQ A;  1PNK A;  3RYF B;  2RDC A;  1GTO A;  3M99 B;  5IWA O;  2JGD B;  2F4V O;  1FFX B;  1QQC A;  2JVD A;  3A2F A;  3K9S A;  1T5E A;  2QKS A;  4LNU A;  2HP8 A;  3JD0 A;  1W0J G;  3CRA A;  4RQE A;  4J9Y B;  1B3Q A;  3AK3 A;  3I5D A;  2WWW A;  2IH1 C;  3JAK A;  4Q6G A;  4WFA V;  3WB1 A;  4DR6 O;  2EIM C;  2ZDI C;  3HKB B;  2UU9 B;  4O4H A;  1H2N A;  2F1M A;  4DUZ O;  1AI7 A;  4FLX A;  1XOU A;  3D3Q A;  4B3T B;  1VQ7 V;  1H5W A;  4EB6 B;  4ZBM A;  3OFN G;  4JZG A;  2YEV A;  2P06 A;  2V4D A;  2YIA A;  3ZN1 A;  2JK5 C;  3RN4 A;  2H94 A;  3IGA C;  3RYH B;  3WU2 Z;  5J2T A;  1N0J A;  5EZY A;  1S77 D;  2E75 B;  4MT8 A;  3SPG A;  3JAM N;  1M5I A;  3HKC A;  2YIB D;  5L3G A;  1WA8 B;  3OD4 A;  2HHH O;  1R3K C;  3ZMT A;  2VWK A;  1F7Y A;  2X0L A;  3FYE B;  5IJ0 A;  1YI2 V;  1BZK A;  3FB8 C;  1H2K A;  3ETQ A;  3OT7 A;  3QG5 A;  4MVZ A;  4I4T A;  1JFF A;  1XMQ O;  3H9V A;  4LBE C;  3ABT A;  3ML0 A;  1XMO B;  2CE4 A;  2IJJ A;  3ZMS A;  4UV8 A;  3F7Y C;  2GBO A;  3ABK B;  1SC5 B;  4YJ2 B;  3FB7 C;  4UV9 A;  2B9Z A;  4FM2 A;  4PA3 A;  1DGS A;  4W4K A;  1M9N A;  4OPA A;  5IYZ B;  4UVB A;  4X20 A;  3E2E A;  4LC1 A;  1XI1 A;  1W2B U;  1EBO A;  3R65 A;  1AVM A;  1WAZ A;  1BE3 H;  1SET A;  5FLX N;  4MS2 A;  1QR8 A;  1KEC A;  1PD3 A;  2QKA A;  1RPR A;  4LF9 O;  1VIB A;  4BIO A;  2UUC O;  3B2E E;  4I0X B;  1W0K G;  3I55 V;  1QVG U;  2XAS A;  3IC9 A;  4XDJ A;  1YJW V;  3DSQ A;  4HZ3 A;  5LYJ B;  1JJ2 U;  3UO3 A;  4ZHQ A;  3K5O A;  4K8X A;  3O65 A;  1OHH G;  1IBL B;  4WBN A;  2HVJ C;  1XIL A;  4LF7 O;  3SYC A;  1P49 A;  1AB3 A;  4JYY A;  5JVD A;  3T1H O;  3U0Z A;  4GX1 A;  1YZB A;  4JI0 O;  5LMN O;  2QE7 G;  1SQV H;  1J5E O;  3FAV B;  3OR7 C;  3QO8 A;  1JMK C;  1PL0 A;  4GX0 A;  1Q86 W;  2EZP A;  1WB7 A;  4PI2 A;  1FPO A;  2P90 A;  2QWO B;  3SYP A;  3EVK A;  1K92 A;  2EUL A;  3NXS A;  3ZRS A;  1OCC C;  4JAV A;  3ASN C;  3QO7 A;  3ZRV A;  5EBW C;  3F5W C;  5B5E Z;  4IHJ B;  3JAT B;  5IYD O;  2WLL A;  2YXL A;  4LR3 A;  5FNV A;  1BCC H;  4QE9 A;  4DW0 A;  1WPX A;  2UXX A;  1AR5 A;  2MK3 A;  2JEX A;  2VQF B;  2LFS A;  3SR2 C;  2CTR A;  3B8M A;  3BA9 A;  1OCZ C;  4UB8 Z;  3A0B Z;  4DR5 O;  3ABM C;  3RYF A;  2Q73 A;  3SJA C;  2DWD C;  5DEC A;  3ABU A;  1K8A W;  2QTS A;  1FXK C;  1S76 D;  3MHH C;  4K0K B;  3W7S A;  1KU9 A;  2CTP A;  5IY5 B;  2RMK B;  3ZHR A;  2XT9 A;  2XAH A;  1H2G A;  2EBO A;  4UCU A;  2UUB B;  2R72 A;  5LGT A;  3JAR A;  4FIP C;  1WJZ A;  1YTF D;  2PY5 A;  1UPG A;  1Q3E A;  2OIG A;  4TQF A;  3K5M A;  1E1Q G;  1N0N A;  4DW1 A;  2ZM6 O;  4EB6 A;  4DV6 B;  1RM1 B;  4YIP A;  4DRX B;  1ZSP A;  1S3J A;  2KQX A;  1M4U A;  1V9P A;  3RYH A;  2QKC A;  1Z2G A;  1N32 O;  1Y67 A;  3FFQ A;  4GKJ O;  4DV3 O;  3SGI A;  1NVP B;  3IAY A;  1WA8 A;  4QPK A;  4DR1 O;  2UXN A;  1GMG A;  4PHZ A;  4TV9 B;  5LXT A;  4X1I B;  3BAB A;  2AHY A;  5KA6 A;  4DR6 B;  1O9G A;  2BCC H;  2QWN B;  2BSK A;  1EM1 A;  3P3P A;  3ZIA G;  3K9A A;  2EJ7 A;  2DWE C;  1FAF A;  2Q5Z A;  2LJ2 A;  2XOK G;  4MVU A;  1IXB A;  3G71 V;  2ITC C;  1G8M A;  3VQX A;  4Z2W A;  1IBM B;  5F2V O;  3J7A U;  5LHI A;  4J11 A;  1KQS U;  5IYZ A;  2AXT Z;  1S5H C;  3CRM A;  1KP3 A;  2HHH B;  2LW1 A;  1ROP A;  4FFB B;  4CH4 A;  4FK5 C;  3S3W A;  2OTL V;  2ATK C;  4YHH O;  4KFM A;  2JS5 A;  4FM0 A;  4DV7 O;  1QHT A;  3HKD B;  5LHG A;  1Y6X A;  3J81 N;  5GTI Z;  4ZKI A;  3ZBH A;  4WF9 V;  1N33 B;  1LUW A;  1ZAU A;  3CXC U;  1FYJ A;  2P22 C;  4GX2 A;  3CP1 A;  2XAQ A;  2FYU H;  3CC2 V;  4O4L B;  4UCV A;  1AIL A;  2O57 A;  4I0X A;  4I50 B;  3ZJZ A;  2WLN A;  1IVS A;  3JYC A;  1SKV A;  3CME V;  3X2Q C;  3UT5 A;  3OMI B;  1K5Q A;  2ODM A;  4B3R O;  4NVP A;  3F7V C;  1SA0 B;  3Q4H B;  3ZHQ A;  1VQP V;  1R6N A;  1OCC B;  1YF2 A;  3QVN A;  3CCL V;  2YC0 A;  3FAV A;  1KKC A;  4MVM A;  3BFR A;  4LF9 B;  3QF7 A;  2Y4T A;  1BQZ A;  1HNX O;  2BTO A;  2P7T C;  1PM9 A;  2VWJ A;  4K35 A;  1JA8 A;  3ZRW B;  2UUC B;  3KG2 A;  4K8Z A;  3CRQ A;  4JI5 B;  1K7D A;  1JVM A;  1XQ8 A;  2AZ2 A;  4LFC O;  3JAT A;  4I9Q A;  1OCZ B;  2WSS G;  4J42 A;  3ABM B;  1YHQ V;  3T4D A;  4DR4 O;  4LF6 O;  1YJN V;  1XDC A;  3T1H B;  1FXK B;  4LNU B;  1PNL A;  1NQT A;  4JI2 B;  1J5E B;  2IW5 A;  5B1N A;  2CGO A;  3K5L A;  1V54 C;  5CA1 B;  1SQX H;  1N34 O;  4QPJ A;  2QA4 V;  4DV5 O;  2ZDI A;  2CDY A;  1R6K A;  3E22 B;  3OM3 B;  1PL4 A;  3LNM B;  4H44 B;  4YXW G;  4O4I A;  4N23 A;  4RWU A;  1Y74 B;  4FLZ A;  3UQ8 A;  2N05 A;  4JYA O;  1Q6H A;  2UXC B;  2BTQ B;  3RBZ A;  3VQY A;  5LHH A;  4DV2 B;  4DR7 O;  5DED A;  3N2K A;  3ZN0 A;  3HKC B;  1THZ A;  1SES A;  2G38 A;  4R7C A;  4JI4 B;  1VQO V;  2XND G;  1P7G A;  5E1A C;  2B1G A;  1IX9 A;  4DV4 O;  1OCR C;  3H1K H;  1L0L H;  5FPO A;  5IJ0 B;  2ZXW C;  4NKG B;  2QJ1 A;  4LH6 A;  4I7Z B;  5EYP B;  1YIJ V;  3BY6 A;  5KLV H;  1XNR O;  2ZE7 A;  4TWK A;  2A7W A;  4I4T B;  1JFF B;  4X62 O;  4JYB A;  4EKW A;  2RCV A;  3WB0 A;  2Q7E A;  3MDS A;  1XL4 A;  4Z1M G;  1MMM A;  1OZ0 A;  4PA6 A;  4X1I A;  1YIT V;  4PI0 A;  4DO2 A;  4JV5 O;  3CPW U;  3JAW A;  3DC5 A;  3ABL B;  2R70 A;  4X20 B;  4G27 B;  5LGU A;  1K97 A;  3GB7 C;  5KX5 B;  3ZS8 C;  4A5U B;  4DV1 B;  3IC7 A;  3ZX6 A;  3AG4 C;  3ZMU A;  1BHA A;  3OE7 G;  2HJF C;  2ZR2 A;  4I55 A;  3BCC H;  3G80 A;  1H38 A;  4DV0 O;  2DYR B;  4MW3 A;  5CBF A;  1N32 B;  3OTO B;  5JQG B;  4GKJ B;  4DV3 B;  2ZQM A;  2P5O A;  1E79 G;  4F4L A;  1QBZ A;  1YTF B;  4J9Z B;  1GRJ A;  5KHK A;  2Q7G A;  3HKD A;  3X2Q B;  2CUG A;  2OWO A;  1M93 A;  1XBL A;  4ZHQ B;  2DW4 A;  3CE2 A;  3CSX A;  4JPR A;  4B3S O;  1AP5 A;  1NTK H;  4JZ2 A;  1XEQ A;  3JD2 A;  3OUS A;  3CD6 V;  4O4L A;  2HEP A;  4K3A A;  4I50 A;  2ZIN A;  5EIB C;  1L0N H;  1EN5 A;  3FKS G;  3CYO A;  2Z3Y A;  4X64 O;  3SPI A;  3S3X A;  3R66 A;  1GN6 A;  4HNA B;  2L35 A;  4YHH B;  4DV7 B;  4Z1V A;  4YIO A;  1TUE B;  3M8A A;  4IYH A;  1SQB H;  5B1B C;  3E8B A;  2WLL B;  5FNV B;  3SPH A;  1VQK V;  4MSW C;  3U11 A;  2DJV A;  1GM8 A;  1Y4M A;  3CCV V;  1KD1 W;  4BAY A;  4CH3 A;  5LGN A;  2DQ3 A;  1MZF A;  3WG7 C;  2W0X A;  3ZRW A;  4GZR B;  4X65 B;  4GYC B;  4GCZ A;  4B3R B;  2CH7 A;  3GWK C;  1MSD A;  2EIJ C;  2UXB O;  1RPO A;  3RWR D;  1FXK A;  4D7S A;  2EIN C;  3MD0 A;  1M57 C;  4YY3 B;  2BOC C;  2E3C A;  4LFA B;  2AW9 A;  2P67 A;  1HNX B;  1BQ0 A;  5KAI Z;  4PEL A;  2NNU A;  5CA1 A;  3JAR B;  3AG2 B;  1P7B A;  2DN9 A;  2YIC A;  1AI6 A;  2QSA A;  2MW2 B;  3KDR A;  2YS8 A;  3TK1 A;  3E86 A;  1SRY A;  3W7W A;  5BXZ A;  1YDX A;  3CCJ V;  3E22 A;  3P32 A;  4PJ0 Z;  1FS0 G;  2WAM A;  1Y74 A;  3MAQ A;  2ZXW B;  4FLV A;  4LF6 B;  4NTW A;  2BTQ A;  3AG7 A;  2P4K A;  1XHZ A;  1NBM G;  4JAS A;  3IFX A;  5J9P C;  1LUV A;  4U7O A;  1TUB B;  1XL6 A;  3KCY A;  4LH7 A;  2R9R B;  1ZL8 A;  1XNQ B;  1NKD A;  5LA6 A;  1VQN V;  1NTM H;  3LSU A;  5LXT B;  1SS3 A;  2A0L A;  3L71 H;  1N34 B;  2IH3 C;  1ZWI C;  3DXR A;  4DV5 B;  3CCQ V;  5EYP A;  2BSK B;  2QR4 A;  2UXD O;  3ZED A;  1VQ8 V;  3JCZ A;  3B77 A;  4BR6 A;  4U7N A;  2WA4 A;  3JAS A;  4LF8 O;  4PDR A;  1MOF A;  3ZHV A;  1IXM A;  4FJC C;  4JYA B;  3AG4 B;  4DR7 B;  4MVO A;  1CPY A;  4B3M O;  1JQ0 A;  3OUF A;  4J10 A;  2Y4U A;  4NR1 A;  4P9O A;  2XHB A;  4X89 A;  5KX5 A;  4DV4 B;  4PA9 A;  2FKX A;  4KHP O;  5H5N A;  5BR8 O;  2ADP A;  3JD1 A;  4IL6 Z;  5GON B;  3AK1 A;  2CTW A;  1OCO C;  2PUS A;  5JQG A;  2WLK A;  4JI7 O;  1FD9 A;  5FL7 G;  4X62 B;  3A8T A;  2E76 B;  1NI8 A;  3LDC A;  5CB4 A;  1KUQ A;  3T2M A;  4ASU G;  3OEE G;  1IJG A;  1I7F A;  1QLN A;  1TVK A;  3W7T A;  3AG3 C;  3L70 H;  1PPJ H;  2ILM A;  3H1J H;  2PZS A;  3UT5 B;  4UCS A;  1K3E A;  1NH2 D;  2DE0 X;  4D6T H;  1I08 A;  3ZRX A;  1VQ6 V;  3AG1 C;  5KHI A;  1QNM A;  4HYO A;  1SQF A;  2Q8V A;  2X6A A;  4NXN B;  3QTC A;  3L74 H;  1E1R G;  5CN0 A;  1B6Q A;  1GO3 F;  1K4D C;  3OMN B;  1VEW A;  1WLE A;  3B4S A;  4KL1 A;  4O4J A;  2ZE6 A;  4HNA A;  3H1L H;  1F23 A;  1K5S A;  4OX9 B;  3ZCC A;  1PP9 H;  4B7E A;  3CXH F;  4DR3 O;  3CMA V;  5IDJ A;  3BPZ A;  3FD9 A;  1BL8 A;  1HNW O;  1K4C C;  4B3S B;  3T1Y B;  1MG1 A;  1KP2 A;  2EIJ B;  1SER A;  3G67 A;  2GSM B;  1NJI W;  3CCM V;  3ASO C;  2EIN B;  1BGY H;  4WFF A;  1LNQ A;  4JAU A;  3VOU A;  4FMT A;  4Q20 A;  1NT2 B;  3HB3 B;  1Q6U A;  1DK1 A;  2EIM B;  2GTA A;  1VQL V;  4J80 A;  4AQY B;  1H8E G;  2PF4 E;  4O4I B;  4JTD B;  1Q81 W;  3ETG A;  1R3L C;  3CEI A;  3GVM A;  3TXS A;  4TT3 G;  4GKK B;  4CBC A;  3N2K B;  3CRC A;  4UFZ A;  4ABM A;  1WNS A;  5C8Y B;  3KCX A;  2WPD G;  1BSM A;  3OTF A;  3M7M X;  2LGW A;  5A2Q N;  1KMI Z;  5IWA B;  2PI4 A;  1ZTE A;  2F4V B;  4U3J A;  2NN4 A;  1EFR G;  4KXR A;  4FLT A;  1D5N A;  1COW G;  3FYI B;  1K73 W;  1R3I C;  2LQT A;  2B5U A;  2GV9 A;  2KKW A;  1TUB A;  3EFF K;  5K1X A;  1OJH A;  1WB8 A;  4MW8 A;  5GTH Z;  5L3E A;  1YSC A;  4X66 O;  5KHH A;  3JAW B;  4DUZ B;  4TOI A;  4DK1 A;  5LOV A;  3ZMZ A;  3WFV A;  3DC6 A;  2X6B A;  5D5P A;  1BT8 A;  2BE3 A;  3RW0 A;  2K1E A;  1VF5 B;  1WPB A;  1V55 C;  4I55 B;  3TJT A;  5KHJ A;  1OCO B;  5JCO C;  5JJE B;  3IJ4 A;  1PKX A;  4E4E A;  1J95 A;  1M56 C;  2QWP B;  2ZCE A;  3B40 A;  2KB1 A;  4JYC A;  2DOS A;  4E2L A;  4WFH A;  5B1A C;  3AG3 B;  4XBF A;  1NZ6 A;  4PDL A;  1I5X A;  5GON A;  2B1I A;  4QGP A;  1XMQ B;  4LF8 B;  3D36 C;  5JJJ B;  2Z0A A;  4LFB O;  2HFE C;  1URF A;  4IYI A;  1QLE C;  5GW7 A;  3ZHS A;  1DTO A;  2HVK C;  1FJG O;  4JI8 O;  1GM7 A;  2FML A;  5IE9 A;  5LMU O;  4B3M B;  1JNB A;  2YI9 A;  5LP6 C;  4DUY O;  1ORQ C;  3K58 A;  2CTQ A;  3VBB A;  2JDI G;  1ZLZ A;  2Q0A A;  3D3I A;  1IBK O;  3C3S A;  4WCE V;  3ASN B;  1GN4 A;  2Q67 A;  5H6R A;  3FB6 C;  1YCI A;  4NB5 A;  4DXW A;  4JI7 B;  4IIJ B;  5BY1 A;  1HW7 A;  4UCT A;  4GX5 A;  2VQE O;  5L3D A;  3CJH A;  3ZHT A;  4DR2 O;  1TGO A;  1AI4 A;  4LCU C;  5BMV B;  2IBZ H;  3G6B A;  4GLX A;  3RFR A;  2D3O W;  2CH7 B;  3HR0 A;  4MVR A;  4X1Y A;  1VF6 A;  3PN1 A;  1H2S B;  1VP7 A;  1N4C A;  1HDJ A;  4LF7 B;  4F6R A;  3K59 A;  1Q82 W;  4JI0 B;  2UU9 O;  5LMN B;  2Q9L A;  5H9C A;  1R3J C;  5CBG A;  1WP8 A;  1FXH A;  3BA8 A;  4C7U A;  1M90 W;  1B04 A;  2ZE5 A;  1FFT B;  2M6Y A;  1NH2 B;  5L3C A;  4QE7 A;  3O9O A;  1G1X B;  4DR3 B;  2GDS A;  2Y48 A;  2QWR B;  2LGQ A;  2GUZ A;  2VRZ A;  4JI6 O;  1AR1 B;  5KMG A;  5IJ9 A;  1UJW B;  1FOU A;  4WFB V;  2EX3 A;  2Y0I A;  1JJO A;  1SQQ H;  3K57 A;  1M1K W;  1KYO F;  2QM4 A;  5EIB D;  2Z5U A;  4JGS A;  1ZL8 B;  5C8Y A;  4JI1 O;  3UKM A;  5LA6 B;  1PNM A;  1XRE A;  4EFB A;  4DR5 B;  1XHX A;  1G4Y B;  2HG5 C;  3DXR B;  5EBL C;  5ITZ A;  1US6 A;  2DQ0 A;  4PV1 B;  3JAS B;  4D7T A;  3HPL C;  2XAF A;  5CBH A;  1LR1 A;  1AI5 A;  3LSQ A;  5B66 Z;  4PDV A;  1I94 O;  3A0H Z;  2YUA A;  4ICG A;  5DN6 G;  1UFI A;  3JAL A;  3SYA A;  4I9W A;  3P30 A;  5FPR A;  3CCR V;  2ZM6 B;  2OT5 A;  1ENV A;  2WLH A;  3W7U A;  2RJZ A;  4EEQ A;  2X7R B;  4HAM A;  1KC8 W;  2GTS A;  5B1A B;  3B8N A;  4H13 B;  4LWS A;  5CA3 A;  4B7K A;  3K3W A;  1Y66 A;  4DR1 B;  5CB4 B;  1QLE B;  1S0V A;  2WLM A;  1IBL O;  5D5Q A;  3C3T A;  5KAF Z;  4ZIB A;  1TVK B;  3JSL A;  2CAZ C;  5HFL A;  1N36 O;  4UB6 Z;  1NR7 A;  2YI8 A;  1KB9 F;  4AIL C;  4FLU A;  5IYB O;  1HWY A;  5EC2 C;  2LFR A;  2UUA O;  1RSO A;  1F51 A;  4O4J B;  2OYQ A;  4NXM O;  2HLD G;  3NR7 A;  5H2F Z;  1IUR A;  2M7W A;  4CS4 A;  1EN6 A;  4IIJ A;  2VQF O;  3KKY A;  4JAA A;  1P4R A;  2CGN A;  2XAJ A;  4P30 A;  1HP8 A;  1W59 A;  2F43 G;  2AZ0 A;  1FJG B;  4MTX A;  4BWA A;  3E8H A;  4JI8 B;  5BMV A;  2KG7 A;  2Q6A A;  4DUY B;  1L1F A;  1VF6 C;  4FVM A;  1CP9 A;  1GK9 A;  1V54 B;  2EIL C;  1YEW A;  3TET A;  5EK0 A;  1JX9 A;  4UXN A;  2N74 A;  4MTF A;  2ADQ B;  1TAE A;  2HKO A;  3K79 A;  3CB2 A;  3UO2 A;  3CCE V;  4O2B B;  2VQE B;  2ZNI A;  1O9H A;  1AJN A;  4LF5 O;  4DR2 B;  3GWO A;  2QWQ B;  2YXY A;  1R73 A;  1KKD A;  2E74 B;  1Y76 B;  4LF4 O;  4LFC B;  1CEZ A;  2JJ1 G;  1ARO P;  3J80 N;  4PD4 F;  1OCR B;  2RQ6 A;  4U3J B;  2RNB A;  4DR4 B;  4MVQ A;  1H2M A;  1OV9 A;  3RYI A;  1VQM V;  4OGQ B;  2ETN A;  3B09 A;  2IM9 A;  1D2D A;  5B1O A;  2A79 B;  3QNE A;  1VQ9 V;  4AHC A;  1YJ9 V;  4TQD A;  1RP3 B;  4WFG A;  5IY5 C;  1HNZ O;  3D8C A;  3N27 A;  5JWP A;  3CWB H;  2HR3 A;  2XAG A;  4P9P A;  2ZNJ A;  1GKF A;  5L3B A;  3SJQ C;  4PA7 A;  3WB2 A;  1IBM O;  5LOV B;  3SDL A;  3BEH A;  1I5Y A;  3CCU V;  3ETD A;  2OCC C;  4R8C A;  4J7K A;  4UUJ C;  1S72 V;  1RM1 C;  4JI6 B;  4ZOL B;  4XDK A;  3RGB A;  4L87 A;  2QM8 A;  3L73 H;  5JCO A;  4JI1 B;  4CC6 A;  2W6I G;  5JH7 A;  1MNG A;  1N33 O;  3CRR A;  4X88 A;  5TIS Z;  3K0D A;  2WA3 A;  5DM6 V;  4FPP A;  2YXH A;  1P84 F;  1XNR B;  2LW7 A;  1GH6 A;  3TXQ A;  3D36 A;  2NR5 A;  1Q7Y W;  3APQ A;  1X59 A;  3JCU Z;  1I94 B;  5J2U B;  3OAA G;  4ZI7 B;  1MZE A;  1EN4 A;  2H8P C;  4JV5 B;  2L6L A;  2Y0P A;  4TUY B;  5BZB A;  3SPC A;  2F95 B;  1CXZ B;  5LP6 A;  1HR0 O;  4LP8 A;  4GUN A;  1SQP H;  5E79 Z;  2X6C A;  3OEH G;  2DYS C;  3CX5 F;  3HKE A;  3FB5 C;  4DV0 B;  2LO1 A;  4P2Z A;  5B1B B;  2ZKO A;  2D2C B;  4FZ1 A;  2A3Q A;  4JI5 O;  3E89 A;  2VS0 A;  1SQG A;  4FLY A;  3L9D A;  3UCS C;  2ZD9 A;  3CJH B;  3WG7 B;  1R6T A;  2IJK A;  4N21 A;  1N36 B;  2F93 B;  2FTK A;  2P6J A;  4JI2 O;  1YXB A;  1H2L A;  2C2A A;  4X1Y B;  3BRC A;  3AK2 A;  1MSW D;  5IYC O;  2F66 C;  2EIL B;  2AHZ A;  4F6R B;  3E8F A;  2ZT9 B;  3LDE A;  3PJS K;  2OIE A;  5CA0 B;  2UUA B;  1QU7 A;  3VQV A;  4BIU A;  5KHG A;  3U10 A;  2XTA A;  2W0F C;  1M57 B;  1H8H G;  4CZZ A;  3N2G A;  2CK3 G;  1GM9 A;  3H1I H;  4CC5 A;  4QNH B;  2PTM A;  4X64 B;  4NXM B;  3T4Z A;  2JS3 A;  2JEU A;  3BAA A;  3E83 A;  2UXC O;  2YDE A;  1U96 A;  4DV2 O;  2Y69 C;  1RFY A;  1TA8 A;  3I56 V;  5B3S C;  4JI4 O;  1QR9 A;  3FX7 A;  2PYJ A;  3AEI A;  4O2B A;  3G6E V;  1BHB A;  2OTJ V;  2GUZ B;  3E35 A;  5KMG B;  4J7Z A;  5IJ9 B;  4H0L B;  4FFK A;  2JGD A;  2WLJ A;  1FFX A;  2V1D A;  2W6J G;  3RYC B;  4KP4 A;  1Y76 A;  2Q7H A;  2JGU A;  2EIK C;  5L3F A;  2NLJ C;  1D5A A;  4G28 B;  4NTY A;  2UXB B;  3SPJ A;  4O2A B;  2IU0 A;  4BW9 A;  3TCU A;  2Q69 A;  2OCH A;  5ITZ B;  4TV8 B;  2IJI A;  3HKB A;  4XDL A;  2JIZ G;  3P3N A;  2R9A A;  1DF5 A;  3G4S V;  1K34 A;  3CC7 V;  2QEX V;  1GN3 A;  2OCC B;  5LBQ A;  3MHS C;  4H37 A;  2K9P A;  2QGN A;  1Z5W A;  4LF5 B;  3CC4 V;  1VF7 A;  2LP7 A;  4DV1 O;  3JAL B;  1AJP A;  3STL C;  1VQ5 V;  1WN7 A;  4IT5 A;  5HFM A;  4X1K B;  4LF4 B;  1Q43 A;  3EHB B;  1F4N A;  3SJB C;  3OTO O;  2WLI B;  3W7X A;  4CS2 A;  4RUF A;  1F4M A;  3L72 H;  2PI5 A;  4ZOL A;  1QVF U;  4LWS B;  1JCH A;  4UCR A;  4RUE A;  4DYL A;  1HNZ B;  2P4V A;  4RO2 A;  4J41 A;  4YJ2 A;  2UXD B;  1KBH A;  1DF4 A;  2KSD A;  3H01 A;  3H1H H;  3ABL C;  5KA5 A;  4CS3 A;  4IGG A;  4BW5 A;  3AG1 B;  5KUM A;  4YJ3 B;  5A9G A;  4CH5 A;  1MA1 A;  2DYS B;  5J2U A;  2R9I A;  4ZI7 A;  1L8D A;  2E5L O;  4TUY A;  1RSO B;  2DYR C;  2Q0O C;  1NR1 A;  3K03 A;  2F23 A;  5CMU A;  4QJF B;  4OPH A;  3LSS A;  4MVS A;  4JI3 O;  4KHP B;  1S5J A;  5BR8 B;  1S5L Z;  4AI8 A;  4CH6 A;  4WFE A;  1JPX A;  1BS3 A;  4X65 O;  3APO A;  1IZ3 A;  3ICX A;  2JJ2 G;  3L75 H;  1MAB G;  5LYJ A;  2IJH A;  4H33 A;  5K1P A;  4MTO A;  1DLB A;  3RVZ A;  4EFE A;  5LL6 Y;  3ZMV A;  4HBN A;  2HJD A;  3LNN A;  2KG7 B;  3ASO B;  3OMA B;  4RAI A;  1ZX3 A;  1HR0 B;  1JOY A;  3QO5 A;  4YY3 O;  1WP7 A;  2ITD C;  3JD4 A;  4LFA O;  1QCE A;  3K04 A;  1K33 A;  4U3F H;  3F5T A;  3K0G A;  1PV0 A;  5CA0 A;  2A06 H;  2Y69 B;  3T1C A;  4QIW F;  2ZE8 A;  5B3S B;  1N8R W;  4B3T O;  4IHJ A;  3JSN A;  3LDD A;  4L8J A;  1AP6 A;  4JTA B;  4F6E A;  4JTC B;  4BIZ A;  5AG2 A;  3VQW A;  2EIK B;  4X9Q A;  1HNW B;  1AJQ A;  1GAX A;  3OW2 U;  1XNQ O;  3JAK B;  3RVY A;  4FM1 A;  3RYI B;  4RQF A;  1AR4 A;  1VAR A;  2ARH A;  5EC1 C;  1G6U A;  4O4H B;  2QM7 A;  4PA4 A;  3RYC A;  2ZIO A;  3A0R A;  1Q6I A;  2Q4P A;  3K5N A;  1B06 A;  2YEV B;  2YID A;  3LUT B;  1X4T A;  3BHP A;  4DK0 A;  1XMO O;  2H3O A;  1EZV H;  3AG2 C;  2ZIM A;  4O2A A;  1XUQ A;  5J2T B;  3C90 A;  1Q8I A;  4TV8 A;  4MTG A;  5EZY B;  4UVC A;  4PDM A;  2EZO A;  1VQ4 V;  2BOB C;  3DGE A;  3OGI B;  1A32 A;  4FZ0 A;  3DTU B;  4R50 A;  4UVA A;  1EZJ A;  1V55 B;  4DRX A;  1NTZ H;  4X1K A;  2RN9 A;  1K9M W;  4KUM A;  4NYK A;  3UM7 A;  1M56 B;  1ZUQ A;  2WLI A;  4R6Z A;  5JH7 B;  1SF9 A;  1Q5O A;  1GN2 A;  5C93 A;  2PGG A;  5EBM C;  3ETE A;  4TV9 A;  2GHY A;  3CCS V;  1BMF G;  4FLW A;  3K06 A;  3CS5 A;  3THO A;  4UCO A;  2V7Q G;  2IU3 A;  2AGA A;  3OGC C;  3K08 A;  4TSF G;  4X66 B;  1Z5V A;  2FL4 A;  3ABK C;  2DMX A;  1VMG A;  1YVW A;  5LP6 B;  3E8G A;  4B08 A;  4NXN O;  4NTX A;  3TGU H;  4YJ3 A;  3CHX A;  4FFB A;  2A9H A;  2QTO A;  3RT3 C;  3HKE B;  3ZHU A;  3JD3 A;  5IT9 N;  2PYL A;  4OX9 O;  3KZI Z;  5JJN B;  3SYO A;  1R1B A;  2EJR A;  2N04 A;  2Q68 A;  1I0H A;  4WBN B;  3T1Y O;  2JRI A;  2ZR3 A;  5JVD B;  2XUM A;  3BVO A;  4JF3 A;  2YIB A;  3STZ C;  3OR6 C;  1Q90 D;  4LFB B;  1SZT A;  4J7J A;  1NS1 A;  4X8A A;  1SZX A;  1SA0 A;  4G2K A;  3Q4H A;  4OXS A;  5LMU B;  2E5L B;  4K0K O;  2YSU B;  1FXV A;  3N2G B;  4AQY O;  1JR9 A;  4JI3 B;  2UUB O;  5H6Q A;  1NVP D;  5KUK A;  3SJC C;  1IBK B;  1FKA O;  2QDO A;  1U97 A;  4GKK O;  2FB5 A;  1IDS A;  3EXA A; 
#chains in the Genus database with same CATH homology
 4BR6 A;  4E4E A;  1P7G A;  1IX9 A;  4YIO A;  2GDS A;  2QKA A;  3K9S A;  1N0N A;  3AK2 A;  2RCV A;  3AK3 A;  1AP6 A;  4YIP A;  3IC9 A;  3MDS A;  3QVN A;  1ZSP A;  2ADP A;  1MMM A;  1KKC A;  4F6E A;  3BFR A;  1XRE A;  1MSD A;  2QKC A;  5AG2 A;  3AK1 A;  3DC5 A;  3CEI A;  1Y67 A;  1PM9 A;  1EN6 A;  1XIL A;  1JA8 A;  4X9Q A;  3KKY A;  4JZG A;  4JYY A;  1ZLZ A;  1AR4 A;  1VAR A;  3C3S A;  1BSM A;  3RN4 A;  1GN4 A;  2AW9 A;  5A9G A;  1MNG A;  1N0J A;  1WB7 A;  1MA1 A;  1EM1 A;  1I0H A;  1ZTE A;  3EVK A;  1I08 A;  1B06 A;  1XDC A;  3KDR A;  1D5N A;  1IXB A;  1QNM A;  4FFK A;  1XUQ A;  1WB8 A;  2ADQ B;  1SZX A;  3OT7 A;  2P4K A;  1AR5 A;  1EN4 A;  1BS3 A;  1VEW A;  2CDY A;  1AP5 A;  4JZ2 A;  2CE4 A;  1LUV A;  1PL4 A;  1JR9 A;  3DC6 A;  4GUN A;  1BT8 A;  3LSU A;  1EN5 A;  3C3T A;  1GN3 A;  1ZUQ A;  3TJT A;  4C7U A;  1GN2 A;  1IDS A;  1LUW A;  1AVM A;  1GN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...