1I0HA

Crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE Y174F MUTANT
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i0hA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i0hA02
1KKCA 3EVKA 1IX9A 3DC6A 4X9QA 3TJTA 1N0NA 1ZTEA 3AK2A 4GUNA 4YIPA 1BS3A 1EN5A 3C3SA 1JA8A 4C7UA 1JR9A 3MDSA 5AG2A 1LUVA 2QKAA 1XUQA 3QVNA 2CE4A 3BFRA 4F6EA 2ADPA 1MNGA 1XDCA 1EN4A 1VARA 1GN2A 1MA1A 1LUWA 1IDSA 4BR6A 1PM9A 1ZUQA 3CEIA 2QKCA 1AP5A 2RCVA 2ADQB 1WB7A 1D5NA 1XILA 3LSUA 1I0HA 3KKYA 1MMMA 3K9SA 1XREA 4YIOA 3C3TA 1BT8A 4E4EA 1GN4A 1I08A 1PL4A 1ZLZA 1P7GA 3AK1A 3IC9A 1AR5A 4FFKA 5A9GA 2P4KA 1BSMA 2AW9A 1SZXA 4JZ2A 3AK3A 1GN3A 3RN4A 4JZGA 1IXBA 3DC5A 1AR4A 1N0JA 4JYYA 2GDSA 1AVMA 1EN6A 1B06A 1ZSPA 3OT7A 1QNMA 1MSDA 1VEWA 1EM1A 1GN6A 1WB8A 1Y67A 2CDYA 1AP6A
chains in the Genus database with same CATH superfamily
1ZX3A 3K06A 4I0XB 1JMKC 3SJBC 1XHZA 2EIKB 1V55B 3ZMTA 4LP8A 4WCEV 4FFBA 4N23A 4JF3A 3WG7C 2V4DA 3C3SA 4C7UA 2XOKG 3ABKC 4DK0A 2FYUH 1NH2B 2EJ7A 1K3EA 3ZJZA 3TETA 4OPAA 2ZR2A 4J41A 2HJFC 4DR2O 1K97A 3H1IH 1HNXO 1JJ2U 4CBCA 5IY5C 4BAYA 4I0XA 1IDSA 5EYPA 3ZMSA 4MVUA 4JI6B 3STZC 4H37A 1VQ5V 5KUMA 2ZM6B 1R6NA 1XILA 3F5TA 1X59A 1HNWO 1R3IC 4TV9B 4HZ3A 1M9NA 2ZE5A 1TUBA 3JASA 4LNUA 2Q4PA 4YIOA 1JOYA 5DM6V 4QJFB 2YI9A 4FM2A 4DR2B 3AG2B 3JYCA 4CS3A 4CH6A 3HR0A 2UUAB 1VQLV 4ZI7A 2UXCO 5CA0A 4WFBV 4PI2A 4J80A 4AILC 5LMUB 3E86A 1N0JA 2LO1A 2BTQB 5L3CA 3RVZA 3N27A 2GDSA 2OT5A 3CRCA 4TOIA 1MZEA 2HHHB 3T4ZA 2F1MA 1KMIZ 2Q69A 3ABMB 4CC5A 3OT7A 2UU9O 3HKBA 1XL4A 1NVPB 2CAZC 5LP6A 3LDDA 1XMQO 1Q8IA 2G38A 1UFIA 3B8NA 3OD4A 2OWOA 3WB1A 4PA7A 1R1BA 4TV8B 2RMKB 2K9PA 1S5HC 3D3IA 1N34O 4LBEC 1NTMH 3AG3B 1L8DA 2ARHA 1FJGB 2GV9A 1OCOB 2BTQA 3E2EA 1FYJA 2QWPB 3AK2A 2H3OA 2R9RB 4FIPC 4LCUC 4DUZB 4NR1A 4PDRA 5KMGA 5C8YB 1L0NH 1XUQA 2JGDB 4JI0O 3HKBB 3D3QA 5CBGA 4PA9A 2ZDIA 3CX5F 2WLLB 5EC1C 4X20B 2P06A 4EFEA 3RYFB 1XI1A 3IJ4A 1VQ8V 3G6BA 2E3CA 2QWOB 4JTAB 3CC4V 3B4SA 4FLWA 5EIBD 3QNEA 3ZEDA 2LFRA 4X64O 2Q7EA 1RP3B 2CH7A 2GUZB 4CH3A 3OTOB 3MD0A 5IJ9B 4OGQB 4LH6A 3SPGA 3AG3C 2JJ1G 2MK3A 4LF4B 3ETGA 5LHHA 3BVOA 1F7YA 4JAVA 3IC9A 3VQVA 4BIUA 4I50A 1PNLA 3ZRWA 3LDEA 4MVRA 3JALA 4F6RB 2DYRB 4JYYA 1JPXA 1Q5OA 1SA0B 4CS4A 1M90W 1R6TA 3FB5C 2CGOA 1TUEB 1NQTA 3D8CA 3ETDA 3KCYA 2Y69B 4TV8A 4DUYB 1QNMA 1RPRA 4TQFA 4IYHA 2Q73A 3SPHA 4JAAA 2JIZG 3HPLC 3RW0A 2CUGA 2VQFB 4D6TH 4KHPO 2EIKC 1WA8B 5BR8O 1IBLO 3UM7A 2QA4V 2E74B 3RYHB 2IJKA 3APOA 3ZRVA 1AI7A 3SYAA 4LFAO 4G27B 3CRMA 1E1QG 1JR9A 2ZIMA 1PNKA 1MABG 3T4DA 4PHZA 3JARA 2OTJV 3BFRA 1F23A 3FFQA 3H1HH 4DR1B 2D3OW 4DO2A 4GKKO 5KAIZ 1G8MA 1EN4A 4DV2B 2Z5UA 4P30A 3CC2V 3ZHTA 4WF9V 4ZBMA 2H8PC 4PJ0Z 1W0KG 4DR7B 1NZ6A 3P3PA 4J7KA 1SQBH 1KQSU 1JX9A 2ZM6O 1FPOA 4DXWA 1N32O 4X1YB 2GUZA 3ASNC 1S76D 1VF6A 2WLKA 3JD1A 2DW4A 1IZ3A 3ABKB 4DK1A 1W59A 2HG5C 1DF4A 2PYJA 1WNSA 1J95A 1SKVA 5JVDA 3K57A 3KCXA 2HEPA 3K5LA 3TGUH 4F6RA 5EBLC 1XOUA 4DV1B 2PGGA 5IJ0B 3JSLA 2JGDA 1KC8W 4IL6Z 3CHXA 2UXBB 4Q20A 3OMAB 1GN3A 2E5LB 4WBNB 4UCTA 3FB6C 4O4LA 1V54B 1I5XA 3BY6A 2UXDB 3RGBA 2CTPA 4JI4O 2M7WA 1OCCC 1MG1A 1QR8A 3B2EE 5ITZB 4DV3B 4X64B 4EFBA 3CCJV 3SJCC 3ZMVA 1VQNV 3R65A 5B5EZ 1S5JA 1YJWV 4UVCA 5EZYB 4GX1A 2HKOA 4KL1A 1P7BA 1AILA 2K1EA 2PI5A 4MTOA 1S0VA 3ABLB 4B3RB 4X9QA 3VOUA 1Z5VA 4GX2A 3PJSK 1M5IA 2A0LA 4MTXA 3CE2A 5IYDO 4K8XA 3OUFA 5IYZB 2QGNA 3C90A 1K34A 2Q9LA 2Y69C 1MZFA 4LFCB 5IYBO 5FL7G 1GN2A 4PI0A 2ZNIA 3CCSV 5J9PC 4DRXA 3ICXA 5J2UA 2OIGA 2XNDG 3UKMA 5LGTA 4TQDA 1FOUA 4JI0B 4JI5O 1YHQV 1P84F 2R9AA 4RAIA 1B3QA 3ETEA 1URFA 2WA3A 1PNMA 3ZBHA 5LHGA 2P22C 3CXHF 2X0LA 4QNHB 2IBZH 3K9AA 2IW5A 1GN4A 2W0XA 2Q67A 5IWAO 2CTQA 2CK3G 3K5MA 1I5YA 4HNAB 5D5PA 3APQA 5JJNB 5CA3A 3JD2A 4MT8A 1CP9A 1Q6IA 4JI1B 4DW0A 1SZXA 5J2TA 3ZS8C 4DR5B 1WPBA 3ZRXA 3A0HZ 4JZGA 3DC5A 5B66Z 2D2CB 1VMGA 1VQ7V 1DK1A 4J7JA 1AI5A 3RFRA 3LSQA 3OEEG 1BQ0A 4J42A 4YJ3B 2XUMA 1VEWA 3B09A 2YEVA 4JYCA 1OCRB 5LHIA 3HKCB 2IM9A 4LH7A 2ZE6A 2HVKC 4I9WA 4HYOA 1PV0A 1Q3EA 1EBOA 3I56V 3DC6A 4UCSA 1FXKB 2JK5C 5JCOA 3E89A 4EB6A 1ZTEA 2UXBO 4Q6GA 1NH2D 2WSSG 3NR7A 2ZINA 3K3WA 2QKAA 3L72H 5LA6A 1YTFD 1Z2GA 3RYCB 2YEVB 4DV7B 3RYHA 1Y6XA 5KHHA 2KQXA 3E8BA 4JV5B 3UO3A 1YSCA 1FD9A 3MHSC 1GAXA 3OFNG 1VQOV 3M99B 5EBWC 1KU9A 3JD4A 4I55B 4NYKA 3IFXA 1W2BU 1VF5B 1IBMO 2X6AA 2ZDIC 4HNAA 1Q81W 3ZHUA 2EULA 3SYCA 2F4VO 2UU9B 1HDJA 1BMFG 1WPXA 5B1BC 2RJZA 3CCQV 2Y48A 4AQYB 5IE9A 2LFSA 3QF7A 2EINC 2YIDA 3Q4HB 5B1AC 5IYZA 1Z5WA 1R73A 4IGGA 3UT5A 1R3KC 4GKJO 2YIBD 3K03A 3H1JH 1YTFB 4DR6B 4IT5A 4JYBA 2WLMA 3DTUB 3TXQA 1NR1A 4PELA 4A5UB 3VQYA 3CYOA 1B06A 4X1KB 4LF6O 2Z0AA 1VQ9V 3JSNA 2QDOA 3RT3C 3ZN1A 3GWKC 2QTOA 4X65O 1FFXB 2CDYA 3WB0A 2OIEA 1VQ4V 5BZBA 1GH6A 4G2KA 4IIJB 4O4HB 3W7UA 4YHHO 1N8RW 4TV9A 1HR0O 5LYJA 1YI2V 4Z2WA 4GUNA 5KMGB 4DR4O 4KHPB 2FTKA 5LOVB 2A06H 1MNGA 4DR3O 3AEIA 2JJ2G 1VARA 3HKDB 2ZXWC 1OCCB 3P3NA 3HKEA 3L9DA 3E8GA 4WFEA 1T5EA 4WFGA 3ZRSA 4H0LB 3RBZA 2NN4A 3ZHQA 3OGIB 1VP7A 1QBZA 4X1IA 2WLNA 2Y4UA 2Y0PA 4RWUA 2CH7B 3K58A 3T1HO 3SPJA 1N32B 1W0JG 3F7YC 4R50A 1G6UA 3IAYA 4FLYA 4OX9O 4DR7O 2B9ZA 4YY3B 4OX9B 3C3TA 4DV4B 2YS8A 1I08A 1PL4A 4JYAB 1QR9A 3K04A 3O9OA 3H9VA 3WU2Z 5CBFA 1L0LH 4DR1O 3ZRWB 2QEXV 5FPRA 4TSFG 4LWSA 5F2VO 4NTWA 4JV5O 4IHJA 1E1RG 3SJAC 2ZR3A 1AI4A 2DYRC 4FVMA 5KHKA 1Q6UA 4O4LB 1ZSPA 1YVWA 4WFFA 3L71H 4LF5B 1SZTA 3STLC 4U3JA 2VRZA 1NBMG 3CC7V 3ZMZA 2EX3A 4MVMA 1KKCA 4FM1A 1GM9A 3G4SV 4J7ZA 1SF9A 4PDMA 1Q6HA 5HFMA 3K79A 2IJIA 5KX5B 2WWWA 5BMVB 2BOCC 2WLHA 5CBHA 4OPHA 5EBMC 1EN5A 2NR5A 3AG4C 1QCEA 4LFBO 1P4RA 3BHPA 3K08A 4MTFA 4JI2O 3B77A 4EKWA 2DWEC 2A3QA 4LC1A 5CN0A 4ZKIA 2YIAA 1J5EB 1H2GA 2L35A 1Q86W 3LNNA 2PUSA 4JI7O 5B3SC 2QWQB 2IJJA 2LP7A 5IJ9A 1PM9A 1VIBA 1Y74B 3CRQA 3W7WA 2EZPA 3BAAA 1AP5A 2RCVA 2ADQB 5K1XA 3LSUA 3JD3A 1OJHA 1I0HA 2X6CA 3ZHVA 5B1AB 2X6BA 4PA3A 2N04A 4X20A 2AGAA 1AJPA 2ZIOA 1V9PA 3AG1C 4LR3A 5LXTA 4X89A 4FFKA 3DXRA 3QO7A 2P4KA 4LWSB 1BSMA 3OMNB 3E22B 1JCHA 2VS0A 2XAQA 4O2BA 3SYOA 4JI6O 1NJIW 3JATB 1DF5A 2A9HA 3AK3A 4O2BB 1HW7A 4X1YA 5JH7A 1M93A 3BA9A 2YXLA 4JI3O 2QM8A 1I94B 5FLXN 4GX5A 3VQXA 3OUSA 4B3MO 1MSDA 4IIJA 2P4VA 1F51A 3U10A 5D5QA 1HNZO 2PZSA 1EZVH 4DV5B 5DN6G 2OTLV 4B7KA 3RVYA 2HVJC 5K1PA 5KLVH 1SQVH 1VQKV 3SGIA 4UB8Z 3E83A 3X2QC 1DGSA 4JAUA 4P2ZA 3QVNA 2CE4A 3DXRB 4X1IB 1SS3A 3SPIA 2P6JA 3J80N 1N33O 2EIJB 3U0ZA 4ZHQA 3ZIAG 1ZUQA 3SJQC 3UCSC 2XHBA 2QM4A 2ZT9B 1X4TA 5CA0B 3EXAA 4NVPA 3S3WA 3CRRA 1GK9A 2GTAA 2QR4A 1I7FA 1YF2A 3MHHC 1MSWD 2XT9A 5LP6C 4LF8B 4UCOA 3CXCU 5JH7B 2UUCO 1WAZA 1S77D 3CRAA 1H5WA 1VF7A 4K0KO 2AW9A 3P30A 3ZX6A 3A0RA 3ABTA 3FB8C 2NLJC 1G1XB 4LF5O 4NXNB 2JEUA 2EILC 4LFCO 4UB6Z 1H38A 5IYCO 2ITCC 2LJ2A 5LA6B 1YJNV 3JALB 5JJEB 1K73W 4ZOLB 4O4JB 4MVOA 5B1BB 4TUYB 4ZOLA 4H33A 2Z3YA 4F4LA 3LNMB 4FPPA 4H13B 4NXNO 3CD6V 2HR3A 1H2LA 2BOBC 1CPYA 3WG7B 1IX9A 4O4HA 4FLUA 4YXWG 4JTCB 4JPRA 1HWYA 1YDXA 3E22A 1COWG 5CA1B 1SESA 2ADPA 2OCCB 3FD9A 3S3XA 1S72V 4JTDB 4OXSA 3GVMA 3JAMN 5FNVA 3CWBH 1K4CC 3WB2A 5KHGA 1K5QA 1JFFA 4NTYA 4DV4O 1NTKH 3MAQA 2YUAA 3L74H 4B3TB 3A0BZ 2Q0OC 2HLDG 1WA8A 3CCRV 5GTHZ 3CCMV 4CC6A 4GX0A 3JCUZ 5H9CA 1ZLZA 3QO8A 4CS2A 4Z1MG 4QIWF 1IXMA 1P49A 3QO5A 2Q5ZA 4MVSA 2JS3A 1DLBA 4X66B 4X66O 1IXBA 2ZD9A 4FM0A 3A2FA 1YXBA 1RSOB 1ZL8A 1CXZB 2ZCEA 3CCLV 4K8ZA 2ETNA 3D36A 3ML0A 3F7VC 3DSQA 4I4TB 4LF7B 1PP9H 3B40A 4WBNA 1WB8A 3CP1A 1YCIA 2B5UA 5LMUO 4TWKA 4GT1A 2BCCH 4X88A 3VQWA 4DV1O 4K0KB 3E8FA 4XDKA 1I94O 1US6A 4O4IB 3OGCC 4LF8O 1KBHA 3TJTA 4UCRA 1GTOA 2WLIA 2YXHA 2KSDA 1KECA 3SYPA 3MDSA 1NU1H 4X62B 1B04A 4FMTA 1N36B 3B8MA 1FXVA 4RUFA 3H01A 2ZKOA 1OV9A 3EHBB 5EYPB 3CCEV 2YDEA 4NXMO 5KHJA 2WLLA 1FXKA 1Q7YW 5CB4B 4JI8B 1JVMA 1BCCH 1XEQA 4QE7A 1R3LC 1ZAUA 1BQZA 1WB7A 4O2AA 3ZHRA 1VQ6V 1GRJA 4RQFA 3L75H 1Q43A 4DYLA 3G67A 1XMOB 1WJZA 1JQ0A 4FLZA 1P7GA 3I55V 2IH3C 1BL8A 5CA1A 1BE3H 1JJOA 5EK0A 1O9GA 1QLNA 4RO2A 4R8CA 3TXSA 1LNQA 1AR4A 2GSMB 5KAFZ 3BCCH 1G4YB 1HNXB 5LMNB 1QVGU 4X1KA 3LSSA 1VQPV 1M57C 3FYIB 1S5LZ 4UCVA 1NKDA 4JI3B 3NXSA 5E79Z 2EIMB 2XAGA 3JARB 1EM1A 4DV5O 2DE0X 3UT5B 1DTOA 4P9PA 1SETA 4JI1O 2JEXA 1XHXA 1ZWIC 1V55C 3AG2C 3BPZA 4MS2A 4JI7B 2CTWA 2BSKA 1N0NA 3JAKB 2EJRA 2A7WA 4GCZA 4YIPA 3SYQA 5EIBC 2E75B 4DV6B 3ZN0A 1OCOC 1LUVA 4JYAO 4GZRB 4JI5B 2PI4A 4J9ZB 2UUBB 3K0DA 1WLEA 2EILB 3RYFA 2QM7A 2WLJA 5L3EA 2QJ1A 4ASUG 1FKAO 2E76B 2LW1A 1LUWA 5LGNA 4BR6A 1FFTB 5JWPA 3RYCA 2JS5A 3CMEV 4LF9O 2OCCC 4UVBA 3RWRD 1OHHG 3TK1A 1K9MW 4UV9A 4DUZO 4LFAB 5LBQA 1XQ8A 3K59A 3KKYA 4NXMB 5J2UB 3K0GA 1MMMA 4JGSA 5JVDB 4JI8O 2HP8A 3L73H 3ASOC 2CGNA 4XDLA 4XDJA 1TGOA 4X62O 3AK1A 2OYQA 2AXTZ 2QSAA 1THZA 1VQMV 3FYEB 4W4KA 3JCZA 1AR1B 2DJVA 2V7QG 4CH5A 4X8AA 4DRXB 3N2GA 3OR6C 4FLTA 3J7AU 2JRIA 2UUCB 2JDIG 1U97A 3N2GB 3I5DA 4QPJA 2PY5A 2XAJA 4QGPA 3N2KB 1GMGA 3ETQA 1NT2B 5CMUA 4ABMA 5KA6A 3K5NA 1IURA 4KFMA 4NKGB 1XMOO 1U96A 4I9QA 2GHYA 1K5SA 2B1IA 1GO3F 4D7SA 1J5EO 1IJGA 2DQ0A 3OEHG 3E35A 1BGYH 1H8EG 4PDLA 1GKFA 2UUBO 2C2AA 2DOSA 1M56C 2CTRA 5IJ0A 4P9OA 3W7SA 1XDCA 4DV0O 2WLIB 2F4VB 1QLEB 2EIJC 1LR1A 1TA8A 5BMVA 4J11A 2RN9A 3D36C 3OE7G 4YY3O 1GM7A 3ZCCA 1XBLA 1H8HG 2P5OA 1XNQB 2OCHA 1D5NA 2IH1C 1HNZB 1Y4MA 3CB2A 1WN7A 2R70A 4R6ZA 1QQCA 4U7OA 3RYIB 4EB6B 1XREA 2EZOA 3FKSG 4IHJB 5TISZ 2B1GA 2KG7A 1N36O 2DYSB 1IVSA 1AR5A 2Y0IA 4G28B 2VQFO 4JZ2A 4DR4B 2ZQMA 5H6RA 4X65B 5B3SB 1AROP 1K92A 3Q4HA 2GBOA 4B08A 4O4IA 4UXNA 2O57A 3CS5A 3OR7C 3ASNB 2EIMC 3KDRA 4U7NA 5HFLA 4E2LA 2IU3A 2Q68A 3G71V 3OTOO 4CH4A 3ZHSA 1YITV 1B6QA 4DW1A 2FKXA 1AP6A 2BE3A 2YXYA 1YEWA 2LW7A 4B3MB 4O4JA 3DGEA 2ODMA 3KZIZ 1AJQA 2AHZA 2BTOA 3PN1A 4BW5A 4LF7O 3BA8A 1E79G 4PA6A 1ROPA 4FZ0A 1ENVA 3T2MA 3X2QB 4DR3B 4NTXA 4BIOA 1BS3A 1JA8A 2Q0AA 5AG2A 1IBKB 1S3JA 4I50B 5BXZA 2WPDG 4FJCC 3FAVA 3JAKA 5LYJB 4LFBB 3EFFK 2P67A 2DN9A 1FS0G 4JASA 1PPJH 4CZZA 1NR7A 3OW2U 2VQEO 2XTAA 4UVAA 4MW8A 4L8JA 1EFRG 4GYCB 2ZE8A 2JGUA 1KKDA 1GM8A 4GLXA 2F93B 3ASOB 4I55A 2KB1A 1M4UA 2QKCA 1M57B 1M56B 1SQFA 2PF4E 3AG4B 3CCUV 3IGAC 2IJHA 5GW7A 2F66C 1F4MA 1KYOF 2KG7B 1H2SB 4LF4O 2FMLA 2XAFA 4PA4A 2F95B 1SQXH 1KUQA 1FJGO 5EC2C 3ZMUA 4DUYO 4KXRA 3FB7C 3JASB 4BW9A 2RQ6A 3THOA 2IU0A 1N4CA 4R7CA 4BWAA 1XMQB 2Q6AA 1PKXA 2YICA 4ZI7B 2QWRB 1V54C 5LXTB 5B1OA 1A32A 1O9HA 3JAWA 4I4TA 1QVFU 1YZBA 2F43G 5KX5A 1RPOA 1WP8A 3M7MX 1SA0A 3H1LH 3E8HA 1TUBB 4LNUB 5LOVA 1TVKB 1K8AW 3K5OA 1BHBA 2KKWA 2UUAO 5LP6B 1RFYA 5L3DA 1XNRO 5GONB 2UXDO 4I5SA 2Q7HA 3HB3B 1Y66A 2X7RB 1VF6C 3GB7C 2QWNB 5KUKA 1XNRB 4QE9A 1ZL8B 3G6EV 2R72A 2PTMA 5B1NA 5LGUA 1SC5B 3O65A 2P7TC 4K3AA 1KP3A 2ZE7A 1AJNA 1K4DC 1UJWB 5CB4A 4HAMA 2Y4TA 2R9IA 4YJ2B 1HP8A 3OAAG 3IC7A 4YHHB 3SDLA 2HHHO 2UXCB 1JNBA 2LGQA 4DV6O 1H2KA 1Y74A 2PYLA 1D5AA 3LUTB 3CJHB 3W7XA 1H2MA 1KD1W 4WFAV 5E1AC 5DEDA 5GONA 1HNWB 5H2FZ 2E5LO 3CCVV 4FK5C 1SERA 2ATKC 4W4LA 1UPGA 1R6KA 4Z1VA 3UO2A 4EEQA 2MW2B 4RQEA 4PDVA 5DECA 2N74A 4I7ZB 1PD3A 2UXXA 1NTZH 3W7TA 2GTSA 1AVMA 4AQYO 5IDJA 3F5WC 4J10A 3HKDA 3GWOA 1IBKO 1SQGA 1RM1B 3VBBA 5JQGB 1SRYA 5H5NA 1IBMB 1Y76A 3N2KA 4DV3O 1Y76B 4H44B 1F4NA 2YC0A 3EVKA 4TT3G 4JI4B 2RDCA 2YSUB 4MVQA 4B3SO 3CJHA 1OZ0A 1R3JC 3CPWU 3JATA 4HBNA 2DWDC 4JI2B 1NS1A 4QPKA 1K7DA 2HFEC 2ITDC 2JVDA 5JQGA 2AZ0A 4PV1B 1KP2A 3OTFA 1H2NA 2VWKA 4UFZA 5H6QA 3H1KH 1OCZB 4FLVA 1BZKA 5FPOA 2H94A 2YI8A 1WP7A 2W0FC 4U3JB 5BY1A 4AHCA 4XBFA 3UQ8A 3AG1B 2EINB 3K9SA 4N21A 3J81N 4B3TO 5C93A 3HKEB 2FB5A 3CSXA 1BT8A 2DQ3A 3RYIA 5JCOC 2L6LA 4E4EA 3SR2C 1RSOA 4ICGA 1JFFB 3L70H 2P90A 1YIJV 4FZ1A 5C8YA 2F23A 2XASA 1CEZA 1OCRC 2LQTA 1TVKA 2VQEB 1XL6A 3LDCA 4U3FH 4B7EA 1K33A 3ABMC 4ZHQB 4PD4F 3A8TA 5IWAB 1EN6A 2Q7GA 3KG2A 4YJ2A 5L3GA 1NVPD 5BR8B 1IBLB 2WAMA 4WFHA 2QTSA 1AI6A 4UUJC 4IYIA 3T1HB 1Y67A 2W6IG 5EZYA 5ITZA 1Q82W 4KP4A 3M8AA 3AG7A 2YIBA 3FX7A 2DYSC 3T1YB 4UV8A 4D7TA 3ABLC 2NNUA 2ZNJA 4MVZA 4KUMA 4LF6B 3T1YO 3U11A 4DV2O 5IT9N 4GKJB 1ORQC 4DR5O 1QHTA 4DR6O 4K35A 5L3BA 1FXKC 3P32A 1RM1C 4GKKB 1OCZC 4ZIBA 2Q8VA 3TCUA 2AZ2A 3BRCA 3QTCA 4F6EA 2DMXA 3QG5A 2RNBA 1M1KW 2M6YA 1Q90D 4AI8A 4B3SB 1SQQH 4FLXA 5GTIZ 3JAWB 1MA1A 4BIZA 3SPCA 1AB3A 1QU7A 1NI8A 2FL4A 1D2DA 3BABA 4MSWC 4B3RO 2QKSA 4UCUA 3CEIA 3BEHA 1FFXA 5FNVB 1EZJA 2WA4A 2ILMA 3ABUA 2AHYA 1N33B 4J9YB 4L87A 3JD0A 4YJ3A 5KHIA 2BSKB 4NB5A 1BHAA 4RUEA 1FXHA 5JJJB 4O2AB 3WFVA 1SQPH 1PL0A 2W6JG 4DV7O 1TAEA 2EBOA 5A9GA 3FAVB 5KA5A 2UXNA 4LF9B 1L1FA 1YJ9V 2LGWA 3OM3B 4MW3A 3RN4A 5J2TB 1XNQO 2N05A 5L3FA 4FFBB 2ZXWB 3T1CA 1HR0B 5LL6Y 2A79B 4DV0B 2QE7G 5IY5B 4MTGA 1N34B 2VWJA 5LMNO 3CMAV 1QLEC 1GN6A 1KB9F 4TUYA 3OMIB 3R66A 1FAFA 5A2QN 2HJDA 1MOFA 2V1DA 3G80A 2XAHA 3HKCA
chains in the Genus database with same CATH topology
1KKCA 3EVKA 1IX9A 3DC6A 4X9QA 3TJTA 1N0NA 1ZTEA 3AK2A 4GUNA 4YIPA 1BS3A 1EN5A 3C3SA 1JA8A 4C7UA 1JR9A 3MDSA 5AG2A 1LUVA 2QKAA 1XUQA 3QVNA 2CE4A 3BFRA 4F6EA 2ADPA 1MNGA 1XDCA 1EN4A 1VARA 1GN2A 1MA1A 1LUWA 1IDSA 4BR6A 1PM9A 1ZUQA 3CEIA 2QKCA 1AP5A 2RCVA 2ADQB 1WB7A 1D5NA 1XILA 3LSUA 1I0HA 3KKYA 1MMMA 3K9SA 1XREA 4YIOA 3C3TA 1BT8A 4E4EA 1GN4A 1I08A 1PL4A 1ZLZA 1P7GA 3AK1A 3IC9A 1AR5A 4FFKA 5A9GA 2P4KA 1BSMA 2AW9A 1SZXA 4JZ2A 3AK3A 1GN3A 3RN4A 4JZGA 1IXBA 3DC5A 1AR4A 1N0JA 4JYYA 2GDSA 1AVMA 1EN6A 1B06A 1ZSPA 3KDRA 3OT7A 1QNMA 1MSDA 1VEWA 1EM1A 1GN6A 1WB8A 1Y67A 2CDYA 1AP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KKC A;  3EVK A;  1IX9 A;  3DC6 A;  4X9Q A;  3TJT A;  1N0N A;  1ZTE A;  3AK2 A;  4GUN A;  4YIP A;  1BS3 A;  1EN5 A;  3C3S A;  1JA8 A;  4C7U A;  1JR9 A;  3MDS A;  5AG2 A;  1LUV A;  2QKA A;  1XUQ A;  3QVN A;  2CE4 A;  3BFR A;  4F6E A;  2ADP A;  1MNG A;  1XDC A;  1EN4 A;  1VAR A;  1GN2 A;  1MA1 A;  1LUW A;  1IDS A;  4BR6 A;  1PM9 A;  1ZUQ A;  3CEI A;  2QKC A;  1AP5 A;  2RCV A;  2ADQ B;  1WB7 A;  1D5N A;  1XIL A;  3LSU A;  1I0H A;  3KKY A;  1MMM A;  3K9S A;  1XRE A;  4YIO A;  3C3T A;  1BT8 A;  4E4E A;  1GN4 A;  1I08 A;  1PL4 A;  1ZLZ A;  1P7G A;  3AK1 A;  3IC9 A;  1AR5 A;  4FFK A;  5A9G A;  2P4K A;  1BSM A;  2AW9 A;  1SZX A;  4JZ2 A;  3AK3 A;  1GN3 A;  3RN4 A;  4JZG A;  1IXB A;  3DC5 A;  1AR4 A;  1N0J A;  4JYY A;  2GDS A;  1AVM A;  1EN6 A;  1B06 A;  1ZSP A;  3OT7 A;  1QNM A;  1MSD A;  1VEW A;  1EM1 A;  1GN6 A;  1WB8 A;  1Y67 A;  2CDY A;  1AP6 A; 
#chains in the Genus database with same CATH topology
 1ZX3 A;  3K06 A;  4I0X B;  1JMK C;  3SJB C;  1XHZ A;  2EIK B;  1V55 B;  3ZMT A;  4LP8 A;  4WCE V;  4FFB A;  4N23 A;  4JF3 A;  3WG7 C;  2V4D A;  3C3S A;  4C7U A;  2XOK G;  3ABK C;  4DK0 A;  2FYU H;  1NH2 B;  2EJ7 A;  1K3E A;  3ZJZ A;  3TET A;  4OPA A;  2ZR2 A;  4J41 A;  2HJF C;  4DR2 O;  1K97 A;  3H1I H;  1HNX O;  1JJ2 U;  4CBC A;  5IY5 C;  4BAY A;  4I0X A;  1IDS A;  5EYP A;  3ZMS A;  4MVU A;  4JI6 B;  3STZ C;  4H37 A;  1VQ5 V;  5KUM A;  2ZM6 B;  1R6N A;  1XIL A;  3F5T A;  1X59 A;  1HNW O;  1R3I C;  4TV9 B;  4HZ3 A;  1M9N A;  2ZE5 A;  1TUB A;  3JAS A;  4LNU A;  2Q4P A;  4YIO A;  1JOY A;  5DM6 V;  4QJF B;  2YI9 A;  4FM2 A;  4DR2 B;  3AG2 B;  3JYC A;  4CS3 A;  4CH6 A;  3HR0 A;  2UUA B;  1VQL V;  4ZI7 A;  2UXC O;  5CA0 A;  4WFB V;  4PI2 A;  4J80 A;  4AIL C;  5LMU B;  3E86 A;  1N0J A;  2LO1 A;  2BTQ B;  5L3C A;  3RVZ A;  3N27 A;  2GDS A;  2OT5 A;  3CRC A;  4TOI A;  1MZE A;  2HHH B;  3T4Z A;  2F1M A;  1KMI Z;  2Q69 A;  3ABM B;  4CC5 A;  3OT7 A;  2UU9 O;  3HKB A;  1XL4 A;  1NVP B;  2CAZ C;  5LP6 A;  3LDD A;  1XMQ O;  1Q8I A;  2G38 A;  1UFI A;  3B8N A;  3OD4 A;  2OWO A;  3WB1 A;  4PA7 A;  1R1B A;  4TV8 B;  2RMK B;  2K9P A;  1S5H C;  3D3I A;  1N34 O;  4LBE C;  1NTM H;  3AG3 B;  1L8D A;  2ARH A;  1FJG B;  2GV9 A;  1OCO B;  2BTQ A;  3E2E A;  1FYJ A;  2QWP B;  3AK2 A;  2H3O A;  2R9R B;  4FIP C;  4LCU C;  4DUZ B;  4NR1 A;  4PDR A;  5KMG A;  5C8Y B;  1L0N H;  1XUQ A;  2JGD B;  4JI0 O;  3HKB B;  3D3Q A;  5CBG A;  4PA9 A;  2ZDI A;  3CX5 F;  2WLL B;  5EC1 C;  4X20 B;  2P06 A;  4EFE A;  3RYF B;  1XI1 A;  3IJ4 A;  1VQ8 V;  3G6B A;  2E3C A;  2QWO B;  4JTA B;  3CC4 V;  3B4S A;  4FLW A;  5EIB D;  3QNE A;  3ZED A;  2LFR A;  4X64 O;  2Q7E A;  1RP3 B;  2CH7 A;  2GUZ B;  4CH3 A;  3OTO B;  3MD0 A;  5IJ9 B;  4OGQ B;  4LH6 A;  3SPG A;  3AG3 C;  2JJ1 G;  2MK3 A;  4LF4 B;  3ETG A;  5LHH A;  3BVO A;  1F7Y A;  4JAV A;  3IC9 A;  3VQV A;  4BIU A;  4I50 A;  1PNL A;  3ZRW A;  3LDE A;  4MVR A;  3JAL A;  4F6R B;  2DYR B;  4JYY A;  1JPX A;  1Q5O A;  1SA0 B;  4CS4 A;  1M90 W;  1R6T A;  3FB5 C;  2CGO A;  1TUE B;  1NQT A;  3D8C A;  3ETD A;  3KCY A;  2Y69 B;  4TV8 A;  4DUY B;  1QNM A;  1RPR A;  4TQF A;  4IYH A;  2Q73 A;  3SPH A;  4JAA A;  2JIZ G;  3HPL C;  3RW0 A;  2CUG A;  2VQF B;  4D6T H;  4KHP O;  2EIK C;  1WA8 B;  5BR8 O;  1IBL O;  3UM7 A;  2QA4 V;  2E74 B;  3RYH B;  2IJK A;  3APO A;  3ZRV A;  1AI7 A;  3SYA A;  4LFA O;  4G27 B;  3CRM A;  1E1Q G;  1JR9 A;  2ZIM A;  1PNK A;  1MAB G;  3T4D A;  4PHZ A;  3JAR A;  2OTJ V;  3BFR A;  1F23 A;  3FFQ A;  3H1H H;  4DR1 B;  2D3O W;  4DO2 A;  4GKK O;  5KAI Z;  1G8M A;  1EN4 A;  4DV2 B;  2Z5U A;  4P30 A;  3CC2 V;  3ZHT A;  4WF9 V;  4ZBM A;  2H8P C;  4PJ0 Z;  1W0K G;  4DR7 B;  1NZ6 A;  3P3P A;  4J7K A;  1SQB H;  1KQS U;  1JX9 A;  2ZM6 O;  1FPO A;  4DXW A;  1N32 O;  4X1Y B;  2GUZ A;  3ASN C;  1S76 D;  1VF6 A;  2WLK A;  3JD1 A;  2DW4 A;  1IZ3 A;  3ABK B;  4DK1 A;  1W59 A;  2HG5 C;  1DF4 A;  2PYJ A;  1WNS A;  1J95 A;  1SKV A;  5JVD A;  3K57 A;  3KCX A;  2HEP A;  3K5L A;  3TGU H;  4F6R A;  5EBL C;  1XOU A;  4DV1 B;  2PGG A;  5IJ0 B;  3JSL A;  2JGD A;  1KC8 W;  4IL6 Z;  3CHX A;  2UXB B;  4Q20 A;  3OMA B;  1GN3 A;  2E5L B;  4WBN B;  4UCT A;  3FB6 C;  4O4L A;  1V54 B;  1I5X A;  3BY6 A;  2UXD B;  3RGB A;  2CTP A;  4JI4 O;  2M7W A;  1OCC C;  1MG1 A;  1QR8 A;  3B2E E;  5ITZ B;  4DV3 B;  4X64 B;  4EFB A;  3CCJ V;  3SJC C;  3ZMV A;  1VQN V;  3R65 A;  5B5E Z;  1S5J A;  1YJW V;  4UVC A;  5EZY B;  4GX1 A;  2HKO A;  4KL1 A;  1P7B A;  1AIL A;  2K1E A;  2PI5 A;  4MTO A;  1S0V A;  3ABL B;  4B3R B;  4X9Q A;  3VOU A;  1Z5V A;  4GX2 A;  3PJS K;  1M5I A;  2A0L A;  4MTX A;  3CE2 A;  5IYD O;  4K8X A;  3OUF A;  5IYZ B;  2QGN A;  3C90 A;  1K34 A;  2Q9L A;  2Y69 C;  1MZF A;  4LFC B;  5IYB O;  5FL7 G;  1GN2 A;  4PI0 A;  2ZNI A;  3CCS V;  5J9P C;  4DRX A;  3ICX A;  5J2U A;  2OIG A;  2XND G;  3UKM A;  5LGT A;  4TQD A;  1FOU A;  4JI0 B;  4JI5 O;  1YHQ V;  1P84 F;  2R9A A;  4RAI A;  1B3Q A;  3ETE A;  1URF A;  2WA3 A;  1PNM A;  3ZBH A;  5LHG A;  2P22 C;  3CXH F;  2X0L A;  4QNH B;  2IBZ H;  3K9A A;  2IW5 A;  1GN4 A;  2W0X A;  2Q67 A;  5IWA O;  2CTQ A;  2CK3 G;  3K5M A;  1I5Y A;  4HNA B;  5D5P A;  3APQ A;  5JJN B;  5CA3 A;  3JD2 A;  4MT8 A;  1CP9 A;  1Q6I A;  4JI1 B;  4DW0 A;  1SZX A;  5J2T A;  3ZS8 C;  4DR5 B;  1WPB A;  3ZRX A;  3A0H Z;  4JZG A;  3DC5 A;  5B66 Z;  2D2C B;  1VMG A;  1VQ7 V;  1DK1 A;  4J7J A;  1AI5 A;  3RFR A;  3LSQ A;  3OEE G;  1BQ0 A;  4J42 A;  4YJ3 B;  2XUM A;  1VEW A;  3B09 A;  2YEV A;  4JYC A;  1OCR B;  5LHI A;  3HKC B;  2IM9 A;  4LH7 A;  2ZE6 A;  2HVK C;  4I9W A;  4HYO A;  1PV0 A;  1Q3E A;  1EBO A;  3I56 V;  3DC6 A;  4UCS A;  1FXK B;  2JK5 C;  5JCO A;  3E89 A;  4EB6 A;  1ZTE A;  2UXB O;  4Q6G A;  1NH2 D;  2WSS G;  3NR7 A;  2ZIN A;  3K3W A;  2QKA A;  3L72 H;  5LA6 A;  1YTF D;  1Z2G A;  3RYC B;  2YEV B;  4DV7 B;  3RYH A;  1Y6X A;  5KHH A;  2KQX A;  3E8B A;  4JV5 B;  3UO3 A;  1YSC A;  1FD9 A;  3MHS C;  1GAX A;  3OFN G;  1VQO V;  3M99 B;  5EBW C;  1KU9 A;  3JD4 A;  4I55 B;  4NYK A;  3IFX A;  1W2B U;  1VF5 B;  1IBM O;  2X6A A;  2ZDI C;  4HNA A;  1Q81 W;  3ZHU A;  2EUL A;  3SYC A;  2F4V O;  2UU9 B;  1HDJ A;  1BMF G;  1WPX A;  5B1B C;  2RJZ A;  3CCQ V;  2Y48 A;  4AQY B;  5IE9 A;  2LFS A;  3QF7 A;  2EIN C;  2YID A;  3Q4H B;  5B1A C;  5IYZ A;  1Z5W A;  1R73 A;  4IGG A;  3UT5 A;  1R3K C;  4GKJ O;  2YIB D;  3K03 A;  3H1J H;  1YTF B;  4DR6 B;  4IT5 A;  4JYB A;  2WLM A;  3DTU B;  3TXQ A;  1NR1 A;  4PEL A;  4A5U B;  3VQY A;  3CYO A;  1B06 A;  4X1K B;  4LF6 O;  2Z0A A;  1VQ9 V;  3JSN A;  2QDO A;  3RT3 C;  3ZN1 A;  3GWK C;  2QTO A;  4X65 O;  1FFX B;  2CDY A;  3WB0 A;  2OIE A;  1VQ4 V;  5BZB A;  1GH6 A;  4G2K A;  4IIJ B;  4O4H B;  3W7U A;  4YHH O;  1N8R W;  4TV9 A;  1HR0 O;  5LYJ A;  1YI2 V;  4Z2W A;  4GUN A;  5KMG B;  4DR4 O;  4KHP B;  2FTK A;  5LOV B;  2A06 H;  1MNG A;  4DR3 O;  3AEI A;  2JJ2 G;  1VAR A;  3HKD B;  2ZXW C;  1OCC B;  3P3N A;  3HKE A;  3L9D A;  3E8G A;  4WFE A;  1T5E A;  4WFG A;  3ZRS A;  4H0L B;  3RBZ A;  2NN4 A;  3ZHQ A;  3OGI B;  1VP7 A;  1QBZ A;  4X1I A;  2WLN A;  2Y4U A;  2Y0P A;  4RWU A;  2CH7 B;  3K58 A;  3T1H O;  3SPJ A;  1N32 B;  1W0J G;  3F7Y C;  4R50 A;  1G6U A;  3IAY A;  4FLY A;  4OX9 O;  4DR7 O;  2B9Z A;  4YY3 B;  4OX9 B;  3C3T A;  4DV4 B;  2YS8 A;  1I08 A;  1PL4 A;  4JYA B;  1QR9 A;  3K04 A;  3O9O A;  3H9V A;  3WU2 Z;  5CBF A;  1L0L H;  4DR1 O;  3ZRW B;  2QEX V;  5FPR A;  4TSF G;  4LWS A;  5F2V O;  4NTW A;  4JV5 O;  4IHJ A;  1E1R G;  3SJA C;  2ZR3 A;  1AI4 A;  2DYR C;  4FVM A;  5KHK A;  1Q6U A;  4O4L B;  1ZSP A;  1YVW A;  4WFF A;  3L71 H;  4LF5 B;  1SZT A;  3STL C;  4U3J A;  2VRZ A;  1NBM G;  3CC7 V;  3ZMZ A;  2EX3 A;  4MVM A;  1KKC A;  4FM1 A;  1GM9 A;  3G4S V;  4J7Z A;  1SF9 A;  4PDM A;  1Q6H A;  5HFM A;  3K79 A;  2IJI A;  5KX5 B;  2WWW A;  5BMV B;  2BOC C;  2WLH A;  5CBH A;  4OPH A;  5EBM C;  1EN5 A;  2NR5 A;  3AG4 C;  1QCE A;  4LFB O;  1P4R A;  3BHP A;  3K08 A;  4MTF A;  4JI2 O;  3B77 A;  4EKW A;  2DWE C;  2A3Q A;  4LC1 A;  5CN0 A;  4ZKI A;  2YIA A;  1J5E B;  1H2G A;  2L35 A;  1Q86 W;  3LNN A;  2PUS A;  4JI7 O;  5B3S C;  2QWQ B;  2IJJ A;  2LP7 A;  5IJ9 A;  1PM9 A;  1VIB A;  1Y74 B;  3CRQ A;  3W7W A;  2EZP A;  3BAA A;  1AP5 A;  2RCV A;  2ADQ B;  5K1X A;  3LSU A;  3JD3 A;  1OJH A;  1I0H A;  2X6C A;  3ZHV A;  5B1A B;  2X6B A;  4PA3 A;  2N04 A;  4X20 A;  2AGA A;  1AJP A;  2ZIO A;  1V9P A;  3AG1 C;  4LR3 A;  5LXT A;  4X89 A;  4FFK A;  3DXR A;  3QO7 A;  2P4K A;  4LWS B;  1BSM A;  3OMN B;  3E22 B;  1JCH A;  2VS0 A;  2XAQ A;  4O2B A;  3SYO A;  4JI6 O;  1NJI W;  3JAT B;  1DF5 A;  2A9H A;  3AK3 A;  4O2B B;  1HW7 A;  4X1Y A;  5JH7 A;  1M93 A;  3BA9 A;  2YXL A;  4JI3 O;  2QM8 A;  1I94 B;  5FLX N;  4GX5 A;  3VQX A;  3OUS A;  4B3M O;  1MSD A;  4IIJ A;  2P4V A;  1F51 A;  3U10 A;  5D5Q A;  1HNZ O;  2PZS A;  1EZV H;  4DV5 B;  5DN6 G;  2OTL V;  4B7K A;  3RVY A;  2HVJ C;  5K1P A;  5KLV H;  1SQV H;  1VQK V;  3SGI A;  4UB8 Z;  3E83 A;  3X2Q C;  1DGS A;  4JAU A;  4P2Z A;  3QVN A;  2CE4 A;  3DXR B;  4X1I B;  1SS3 A;  3SPI A;  2P6J A;  3J80 N;  1N33 O;  2EIJ B;  3U0Z A;  4ZHQ A;  3ZIA G;  1ZUQ A;  3SJQ C;  3UCS C;  2XHB A;  2QM4 A;  2ZT9 B;  1X4T A;  5CA0 B;  3EXA A;  4NVP A;  3S3W A;  3CRR A;  1GK9 A;  2GTA A;  2QR4 A;  1I7F A;  1YF2 A;  3MHH C;  1MSW D;  2XT9 A;  5LP6 C;  4LF8 B;  4UCO A;  3CXC U;  5JH7 B;  2UUC O;  1WAZ A;  1S77 D;  3CRA A;  1H5W A;  1VF7 A;  4K0K O;  2AW9 A;  3P30 A;  3ZX6 A;  3A0R A;  3ABT A;  3FB8 C;  2NLJ C;  1G1X B;  4LF5 O;  4NXN B;  2JEU A;  2EIL C;  4LFC O;  4UB6 Z;  1H38 A;  5IYC O;  2ITC C;  2LJ2 A;  5LA6 B;  1YJN V;  3JAL B;  5JJE B;  1K73 W;  4ZOL B;  4O4J B;  4MVO A;  5B1B B;  4TUY B;  4ZOL A;  4H33 A;  2Z3Y A;  4F4L A;  3LNM B;  4FPP A;  4H13 B;  4NXN O;  3CD6 V;  2HR3 A;  1H2L A;  2BOB C;  1CPY A;  3WG7 B;  1IX9 A;  4O4H A;  4FLU A;  4YXW G;  4JTC B;  4JPR A;  1HWY A;  1YDX A;  3E22 A;  1COW G;  5CA1 B;  1SES A;  2ADP A;  2OCC B;  3FD9 A;  3S3X A;  1S72 V;  4JTD B;  4OXS A;  3GVM A;  3JAM N;  5FNV A;  3CWB H;  1K4C C;  3WB2 A;  5KHG A;  1K5Q A;  1JFF A;  4NTY A;  4DV4 O;  1NTK H;  3MAQ A;  2YUA A;  3L74 H;  4B3T B;  3A0B Z;  2Q0O C;  2HLD G;  1WA8 A;  3CCR V;  5GTH Z;  3CCM V;  4CC6 A;  4GX0 A;  3JCU Z;  5H9C A;  1ZLZ A;  3QO8 A;  4CS2 A;  4Z1M G;  4QIW F;  1IXM A;  1P49 A;  3QO5 A;  2Q5Z A;  4MVS A;  2JS3 A;  1DLB A;  4X66 B;  4X66 O;  1IXB A;  2ZD9 A;  4FM0 A;  3A2F A;  1YXB A;  1RSO B;  1ZL8 A;  1CXZ B;  2ZCE A;  3CCL V;  4K8Z A;  2ETN A;  3D36 A;  3ML0 A;  3F7V C;  3DSQ A;  4I4T B;  4LF7 B;  1PP9 H;  3B40 A;  4WBN A;  1WB8 A;  3CP1 A;  1YCI A;  2B5U A;  5LMU O;  4TWK A;  4GT1 A;  2BCC H;  4X88 A;  3VQW A;  4DV1 O;  4K0K B;  3E8F A;  4XDK A;  1I94 O;  1US6 A;  4O4I B;  3OGC C;  4LF8 O;  1KBH A;  3TJT A;  4UCR A;  1GTO A;  2WLI A;  2YXH A;  2KSD A;  1KEC A;  3SYP A;  3MDS A;  1NU1 H;  4X62 B;  1B04 A;  4FMT A;  1N36 B;  3B8M A;  1FXV A;  4RUF A;  3H01 A;  2ZKO A;  1OV9 A;  3EHB B;  5EYP B;  3CCE V;  2YDE A;  4NXM O;  5KHJ A;  2WLL A;  1FXK A;  1Q7Y W;  5CB4 B;  4JI8 B;  1JVM A;  1BCC H;  1XEQ A;  4QE7 A;  1R3L C;  1ZAU A;  1BQZ A;  1WB7 A;  4O2A A;  3ZHR A;  1VQ6 V;  1GRJ A;  4RQF A;  3L75 H;  1Q43 A;  4DYL A;  3G67 A;  1XMO B;  1WJZ A;  1JQ0 A;  4FLZ A;  1P7G A;  3I55 V;  2IH3 C;  1BL8 A;  5CA1 A;  1BE3 H;  1JJO A;  5EK0 A;  1O9G A;  1QLN A;  4RO2 A;  4R8C A;  3TXS A;  1LNQ A;  1AR4 A;  2GSM B;  5KAF Z;  3BCC H;  1G4Y B;  1HNX B;  5LMN B;  1QVG U;  4X1K A;  3LSS A;  1VQP V;  1M57 C;  3FYI B;  1S5L Z;  4UCV A;  1NKD A;  4JI3 B;  3NXS A;  5E79 Z;  2EIM B;  2XAG A;  3JAR B;  1EM1 A;  4DV5 O;  2DE0 X;  3UT5 B;  1DTO A;  4P9P A;  1SET A;  4JI1 O;  2JEX A;  1XHX A;  1ZWI C;  1V55 C;  3AG2 C;  3BPZ A;  4MS2 A;  4JI7 B;  2CTW A;  2BSK A;  1N0N A;  3JAK B;  2EJR A;  2A7W A;  4GCZ A;  4YIP A;  3SYQ A;  5EIB C;  2E75 B;  4DV6 B;  3ZN0 A;  1OCO C;  1LUV A;  4JYA O;  4GZR B;  4JI5 B;  2PI4 A;  4J9Z B;  2UUB B;  3K0D A;  1WLE A;  2EIL B;  3RYF A;  2QM7 A;  2WLJ A;  5L3E A;  2QJ1 A;  4ASU G;  1FKA O;  2E76 B;  2LW1 A;  1LUW A;  5LGN A;  4BR6 A;  1FFT B;  5JWP A;  3RYC A;  2JS5 A;  3CME V;  4LF9 O;  2OCC C;  4UVB A;  3RWR D;  1OHH G;  3TK1 A;  1K9M W;  4UV9 A;  4DUZ O;  4LFA B;  5LBQ A;  1XQ8 A;  3K59 A;  3KKY A;  4NXM B;  5J2U B;  3K0G A;  1MMM A;  4JGS A;  5JVD B;  4JI8 O;  2HP8 A;  3L73 H;  3ASO C;  2CGN A;  4XDL A;  4XDJ A;  1TGO A;  4X62 O;  3AK1 A;  2OYQ A;  2AXT Z;  2QSA A;  1THZ A;  1VQM V;  3FYE B;  4W4K A;  3JCZ A;  1AR1 B;  2DJV A;  2V7Q G;  4CH5 A;  4X8A A;  4DRX B;  3N2G A;  3OR6 C;  4FLT A;  3J7A U;  2JRI A;  2UUC B;  2JDI G;  1U97 A;  3N2G B;  3I5D A;  4QPJ A;  2PY5 A;  2XAJ A;  4QGP A;  3N2K B;  1GMG A;  3ETQ A;  1NT2 B;  5CMU A;  4ABM A;  5KA6 A;  3K5N A;  1IUR A;  4KFM A;  4NKG B;  1XMO O;  1U96 A;  4I9Q A;  2GHY A;  1K5S A;  2B1I A;  1GO3 F;  4D7S A;  1J5E O;  1IJG A;  2DQ0 A;  3OEH G;  3E35 A;  1BGY H;  1H8E G;  4PDL A;  1GKF A;  2UUB O;  2C2A A;  2DOS A;  1M56 C;  2CTR A;  5IJ0 A;  4P9O A;  3W7S A;  1XDC A;  4DV0 O;  2WLI B;  2F4V B;  1QLE B;  2EIJ C;  1LR1 A;  1TA8 A;  5BMV A;  4J11 A;  2RN9 A;  3D36 C;  3OE7 G;  4YY3 O;  1GM7 A;  3ZCC A;  1XBL A;  1H8H G;  2P5O A;  1XNQ B;  2OCH A;  1D5N A;  2IH1 C;  1HNZ B;  1Y4M A;  3CB2 A;  1WN7 A;  2R70 A;  4R6Z A;  1QQC A;  4U7O A;  3RYI B;  4EB6 B;  1XRE A;  2EZO A;  3FKS G;  4IHJ B;  5TIS Z;  2B1G A;  2KG7 A;  1N36 O;  2DYS B;  1IVS A;  1AR5 A;  2Y0I A;  4G28 B;  2VQF O;  4JZ2 A;  4DR4 B;  2ZQM A;  5H6R A;  4X65 B;  5B3S B;  1ARO P;  1K92 A;  3Q4H A;  2GBO A;  4B08 A;  4O4I A;  4UXN A;  2O57 A;  3CS5 A;  3OR7 C;  3ASN B;  2EIM C;  3KDR A;  4U7N A;  5HFL A;  4E2L A;  2IU3 A;  2Q68 A;  3G71 V;  3OTO O;  4CH4 A;  3ZHS A;  1YIT V;  1B6Q A;  4DW1 A;  2FKX A;  1AP6 A;  2BE3 A;  2YXY A;  1YEW A;  2LW7 A;  4B3M B;  4O4J A;  3DGE A;  2ODM A;  3KZI Z;  1AJQ A;  2AHZ A;  2BTO A;  3PN1 A;  4BW5 A;  4LF7 O;  3BA8 A;  1E79 G;  4PA6 A;  1ROP A;  4FZ0 A;  1ENV A;  3T2M A;  3X2Q B;  4DR3 B;  4NTX A;  4BIO A;  1BS3 A;  1JA8 A;  2Q0A A;  5AG2 A;  1IBK B;  1S3J A;  4I50 B;  5BXZ A;  2WPD G;  4FJC C;  3FAV A;  3JAK A;  5LYJ B;  4LFB B;  3EFF K;  2P67 A;  2DN9 A;  1FS0 G;  4JAS A;  1PPJ H;  4CZZ A;  1NR7 A;  3OW2 U;  2VQE O;  2XTA A;  4UVA A;  4MW8 A;  4L8J A;  1EFR G;  4GYC B;  2ZE8 A;  2JGU A;  1KKD A;  1GM8 A;  4GLX A;  2F93 B;  3ASO B;  4I55 A;  2KB1 A;  1M4U A;  2QKC A;  1M57 B;  1M56 B;  1SQF A;  2PF4 E;  3AG4 B;  3CCU V;  3IGA C;  2IJH A;  5GW7 A;  2F66 C;  1F4M A;  1KYO F;  2KG7 B;  1H2S B;  4LF4 O;  2FML A;  2XAF A;  4PA4 A;  2F95 B;  1SQX H;  1KUQ A;  1FJG O;  5EC2 C;  3ZMU A;  4DUY O;  4KXR A;  3FB7 C;  3JAS B;  4BW9 A;  2RQ6 A;  3THO A;  2IU0 A;  1N4C A;  4R7C A;  4BWA A;  1XMQ B;  2Q6A A;  1PKX A;  2YIC A;  4ZI7 B;  2QWR B;  1V54 C;  5LXT B;  5B1O A;  1A32 A;  1O9H A;  3JAW A;  4I4T A;  1QVF U;  1YZB A;  2F43 G;  5KX5 A;  1RPO A;  1WP8 A;  3M7M X;  1SA0 A;  3H1L H;  3E8H A;  1TUB B;  4LNU B;  5LOV A;  1TVK B;  1K8A W;  3K5O A;  1BHB A;  2KKW A;  2UUA O;  5LP6 B;  1RFY A;  5L3D A;  1XNR O;  5GON B;  2UXD O;  4I5S A;  2Q7H A;  3HB3 B;  1Y66 A;  2X7R B;  1VF6 C;  3GB7 C;  2QWN B;  5KUK A;  1XNR B;  4QE9 A;  1ZL8 B;  3G6E V;  2R72 A;  2PTM A;  5B1N A;  5LGU A;  1SC5 B;  3O65 A;  2P7T C;  4K3A A;  1KP3 A;  2ZE7 A;  1AJN A;  1K4D C;  1UJW B;  5CB4 A;  4HAM A;  2Y4T A;  2R9I A;  4YJ2 B;  1HP8 A;  3OAA G;  3IC7 A;  4YHH B;  3SDL A;  2HHH O;  2UXC B;  1JNB A;  2LGQ A;  4DV6 O;  1H2K A;  1Y74 A;  2PYL A;  1D5A A;  3LUT B;  3CJH B;  3W7X A;  1H2M A;  1KD1 W;  4WFA V;  5E1A C;  5DED A;  5GON A;  1HNW B;  5H2F Z;  2E5L O;  3CCV V;  4FK5 C;  1SER A;  2ATK C;  4W4L A;  1UPG A;  1R6K A;  4Z1V A;  3UO2 A;  4EEQ A;  2MW2 B;  4RQE A;  4PDV A;  5DEC A;  2N74 A;  4I7Z B;  1PD3 A;  2UXX A;  1NTZ H;  3W7T A;  2GTS A;  1AVM A;  4AQY O;  5IDJ A;  3F5W C;  4J10 A;  3HKD A;  3GWO A;  1IBK O;  1SQG A;  1RM1 B;  3VBB A;  5JQG B;  1SRY A;  5H5N A;  1IBM B;  1Y76 A;  3N2K A;  4DV3 O;  1Y76 B;  4H44 B;  1F4N A;  2YC0 A;  3EVK A;  4TT3 G;  4JI4 B;  2RDC A;  2YSU B;  4MVQ A;  4B3S O;  3CJH A;  1OZ0 A;  1R3J C;  3CPW U;  3JAT A;  4HBN A;  2DWD C;  4JI2 B;  1NS1 A;  4QPK A;  1K7D A;  2HFE C;  2ITD C;  2JVD A;  5JQG A;  2AZ0 A;  4PV1 B;  1KP2 A;  3OTF A;  1H2N A;  2VWK A;  4UFZ A;  5H6Q A;  3H1K H;  1OCZ B;  4FLV A;  1BZK A;  5FPO A;  2H94 A;  2YI8 A;  1WP7 A;  2W0F C;  4U3J B;  5BY1 A;  4AHC A;  4XBF A;  3UQ8 A;  3AG1 B;  2EIN B;  3K9S A;  4N21 A;  3J81 N;  4B3T O;  5C93 A;  3HKE B;  2FB5 A;  3CSX A;  1BT8 A;  2DQ3 A;  3RYI A;  5JCO C;  2L6L A;  4E4E A;  3SR2 C;  1RSO A;  4ICG A;  1JFF B;  3L70 H;  2P90 A;  1YIJ V;  4FZ1 A;  5C8Y A;  2F23 A;  2XAS A;  1CEZ A;  1OCR C;  2LQT A;  1TVK A;  2VQE B;  1XL6 A;  3LDC A;  4U3F H;  4B7E A;  1K33 A;  3ABM C;  4ZHQ B;  4PD4 F;  3A8T A;  5IWA B;  1EN6 A;  2Q7G A;  3KG2 A;  4YJ2 A;  5L3G A;  1NVP D;  5BR8 B;  1IBL B;  2WAM A;  4WFH A;  2QTS A;  1AI6 A;  4UUJ C;  4IYI A;  3T1H B;  1Y67 A;  2W6I G;  5EZY A;  5ITZ A;  1Q82 W;  4KP4 A;  3M8A A;  3AG7 A;  2YIB A;  3FX7 A;  2DYS C;  3T1Y B;  4UV8 A;  4D7T A;  3ABL C;  2NNU A;  2ZNJ A;  4MVZ A;  4KUM A;  4LF6 B;  3T1Y O;  3U11 A;  4DV2 O;  5IT9 N;  4GKJ B;  1ORQ C;  4DR5 O;  1QHT A;  4DR6 O;  4K35 A;  5L3B A;  1FXK C;  3P32 A;  1RM1 C;  4GKK B;  1OCZ C;  4ZIB A;  2Q8V A;  3TCU A;  2AZ2 A;  3BRC A;  3QTC A;  4F6E A;  2DMX A;  3QG5 A;  2RNB A;  1M1K W;  2M6Y A;  1Q90 D;  4AI8 A;  4B3S B;  1SQQ H;  4FLX A;  5GTI Z;  3JAW B;  1MA1 A;  4BIZ A;  3SPC A;  1AB3 A;  1QU7 A;  1NI8 A;  2FL4 A;  1D2D A;  3BAB A;  4MSW C;  4B3R O;  2QKS A;  4UCU A;  3CEI A;  3BEH A;  1FFX A;  5FNV B;  1EZJ A;  2WA4 A;  2ILM A;  3ABU A;  2AHY A;  1N33 B;  4J9Y B;  4L87 A;  3JD0 A;  4YJ3 A;  5KHI A;  2BSK B;  4NB5 A;  1BHA A;  4RUE A;  1FXH A;  5JJJ B;  4O2A B;  3WFV A;  1SQP H;  1PL0 A;  2W6J G;  4DV7 O;  1TAE A;  2EBO A;  5A9G A;  3FAV B;  5KA5 A;  2UXN A;  4LF9 B;  1L1F A;  1YJ9 V;  2LGW A;  3OM3 B;  4MW3 A;  3RN4 A;  5J2T B;  1XNQ O;  2N05 A;  5L3F A;  4FFB B;  2ZXW B;  3T1C A;  1HR0 B;  5LL6 Y;  2A79 B;  4DV0 B;  2QE7 G;  5IY5 B;  4MTG A;  1N34 B;  2VWJ A;  5LMN O;  3CMA V;  1QLE C;  1GN6 A;  1KB9 F;  4TUY A;  3OMI B;  3R66 A;  1FAF A;  5A2Q N;  2HJD A;  1MOF A;  2V1D A;  3G80 A;  2XAH A;  3HKC A; 
#chains in the Genus database with same CATH homology
 1KKC A;  3EVK A;  1IX9 A;  3DC6 A;  4X9Q A;  3TJT A;  1N0N A;  1ZTE A;  3AK2 A;  4GUN A;  4YIP A;  1BS3 A;  1EN5 A;  3C3S A;  1JA8 A;  4C7U A;  1JR9 A;  3MDS A;  5AG2 A;  1LUV A;  2QKA A;  1XUQ A;  3QVN A;  2CE4 A;  3BFR A;  4F6E A;  2ADP A;  1MNG A;  1XDC A;  1EN4 A;  1VAR A;  1GN2 A;  1MA1 A;  1LUW A;  1IDS A;  4BR6 A;  1PM9 A;  1ZUQ A;  3CEI A;  2QKC A;  1AP5 A;  2RCV A;  2ADQ B;  1WB7 A;  1D5N A;  1XIL A;  3LSU A;  1I0H A;  3KKY A;  1MMM A;  3K9S A;  1XRE A;  4YIO A;  3C3T A;  1BT8 A;  4E4E A;  1GN4 A;  1I08 A;  1PL4 A;  1ZLZ A;  1P7G A;  3AK1 A;  3IC9 A;  1AR5 A;  4FFK A;  5A9G A;  2P4K A;  1BSM A;  2AW9 A;  1SZX A;  4JZ2 A;  3AK3 A;  1GN3 A;  3RN4 A;  4JZG A;  1IXB A;  3DC5 A;  1AR4 A;  1N0J A;  4JYY A;  2GDS A;  1AVM A;  1EN6 A;  1B06 A;  1ZSP A;  3KDR A;  3OT7 A;  1QNM A;  1MSD A;  1VEW A;  1EM1 A;  1GN6 A;  1WB8 A;  1Y67 A;  2CDY A;  1AP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...