1I0HA

Crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE Y174F MUTANT
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i0hA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i0hA02
1EN6A 1N0NA 2ADPA 1XDCA 1IXBA 3KKYA 2AW9A 1N0JA 1XILA 5A9GA 1B06A 1P7GA 1KKCA 2QKCA 1AVMA 4YIOA 2RCVA 4E4EA 1BS3A 3AK1A 4JYYA 1MMMA 1MNGA 1BT8A 1JR9A 1PM9A 1XREA 3CEIA 2CE4A 1GN6A 1Y67A 1WB8A 1VEWA 2QKAA 3C3SA 1PL4A 1ZUQA 3C3TA 1I0HA 4JZ2A 1AP5A 1ZLZA 1JA8A 1GN2A 1MSDA 3AK2A 3K9SA 1ZSPA 4X9QA 4GUNA 1BSMA 1ZTEA 3MDSA 3LSUA 3RN4A 1EM1A 1D5NA 1LUVA 3QVNA 1LUWA 3IC9A 1EN5A 2ADQB 4YIPA 3BFRA 1AR4A 1WB7A 5AG2A 1IX9A 4BR6A 1EN4A 1MA1A 3TJTA 4F6EA 3EVKA 1GN4A 3AK3A 1SZXA 3OT7A 1IDSA 3DC5A 2GDSA 1AR5A 4C7UA 1VARA 1QNMA 1AP6A 4FFKA 2P4KA 3DC6A 1I08A 1GN3A 2CDYA 4JZGA 1XUQA
chains in the Genus database with same CATH superfamily
4CS3A 1V55C 5FNVA 1N33O 3OFNG 4DV4O 2CGOA 2JEUA 5CA3A 1VQ7V 1UJWB 1MOFA 4CS2A 1UPGA 5DN6G 4IHJB 1QLNA 1K5SA 2HVKC 4HNAA 4X66O 1QQCA 1YJNV 2X0LA 1H8EG 3ASNB 2ZXWB 3OE7G 3F5TA 5KAIZ 2XAHA 3AG4B 2JVDA 3K5MA 3R66A 2ODMA 3CCSV 3CD6V 1S5JA 4XDLA 3CRQA 3E89A 4X20A 4B3TO 2X6CA 1NBMG 1N34O 4LFAO 2VRZA 2EIKC 4JI5O 4I50B 4R6ZA 3N2GA 4LF9B 5JCOA 2AHYA 4F6RB 3T1CA 1F23A 3H1JH 3RYIA 4YXWG 4JGSA 3E35A 3HKCA 2ETNA 1BHAA 1YDXA 1Q6HA 4NXNO 1EN5A 1J5EO 4GKJB 2ADQB 2ZE5A 1CPYA 2BE3A 1N32B 3H1HH 1L0LH 1VIBA 5JH7A 1K73W 3K58A 1JMKC 4LCUC 1OV9A 1DLBA 3AK3A 3P30A 1MSWD 3ZMUA 4Z2WA 2EBOA 3CCQV 4LF6B 1VMGA 5DM6V 2EJ7A 3AG2C 4AQYB 2QWOB 3ZN0A 4O4LB 1JJ2U 2YS8A 2F4VB 4JI1B 3S3XA 1K92A 1SKVA 3FFQA 3VQXA 5LOVA 4O2BB 2C2AA 3SPIA 4J41A 2DYSB 4PHZA 1QLEC 3H01A 2FYUH 4LR3A 3OW2U 4WFEA 4X62B 3CRCA 1AI4A 4NTYA 2MK3A 1EN6A 4I4TA 3RYCA 2NR5A 2Y48A 3Q4HB 3JAWB 4X65O 2UUAB 2K1EA 2YEVA 3WB0A 1HWYA 5KUKA 4UFZA 2HJFC 5B1BC 1AROP 3A0BZ 3LSQA 3J7AU 4LF4B 2EX3A 3DSQA 1H2NA 2RCVA 1ZAUA 4E4EA 3IGAC 4B3MB 2D2CB 5EBWC 5GW7A 1ZX3A 1L0NH 1SQBH 2VS0A 3E22B 2GUZA 3B77A 4J9YB 2Q67A 4BW9A 5KLVH 2E3CA 1HNZB 2R70A 1KQSU 5EYPB 4JI8B 2UXBO 1F4MA 3C3SA 2F1MA 3L71H 1BGYH 4J7ZA 1P84F 3PN1A 1IXMA 3OTFA 2KKWA 1AI5A 2VWJA 2QWNB 3HKBA 2Z0AA 5H9CA 2DOSA 4I55A 2YUAA 2RN9A 1IZ3A 2IJHA 4X8AA 3W7TA 1N33B 3KZIZ 4P2ZA 4XBFA 1N36O 4KHPO 1COWG 3APOA 3GWOA 3RN4A 3QO5A 4I4TB 3CMAV 3QVNA 2JEXA 1OCCC 2B1GA 1LNQA 5D5PA 1WP7A 1YJWV 4LF4O 4MVRA 3CB2A 4B3RB 3BFRA 2W0XA 4FM0A 1IVSA 2EILB 4O2BA 3ETGA 1PKXA 3B2EE 3OT7A 3CCRV 1F4NA 4B7KA 1R3LC 3LNMB 3AG1C 4K8XA 1SQPH 3G71V 2YEVB 1YIJV 3NR7A 4H33A 2HP8A 2AZ2A 4O2AB 2WLJA 2XTAA 3BA9A 2ZT9B 1QBZA 4YHHB 3AG1B 4DV5B 2R9IA 1I5YA 1FAFA 4DR5B 3ZEDA 3CXHF 3K79A 3ZHVA 3K0GA 2YXYA 3KG2A 4B3MO 2R9AA 2P5OA 3VBBA 4CS4A 1N8RW 1XREA 2CE4A 1GN6A 1LR1A 5LP6C 4X64O 3FB6C 3D8CA 1FXKB 1AP5A 5KX5B 4MVSA 1MSDA 3C90A 2PZSA 2Q9LA 5IDJA 5J9PC 1JJOA 2VQFO 2FMLA 1YSCA 1S5HC 2HLDG 1D5AA 3IAYA 1DK1A 4CH6A 5KMGA 3N27A 4NVPA 1BZKA 2XHBA 2G38A 1Q43A 3SPJA 3JALA 2HFEC 3DXRA 1VQ6V 4LFCB 4DR4B 5JCOC 5FNVB 4PI2A 4MT8A 1JPXA 1TA8A 3ABKB 3ZRXA 2QM7A 3JD3A 4UUJC 3D36A 1IBKO 5JQGA 5LXTB 1I7FA 3ZHUA 2CTRA 2DWDC 3HB3B 2UXDB 2GDSA 3OD4A 1DTOA 4EB6A 4QGPA 4JI3O 1H2SB 1M56C 4CC6A 3AG3C 3UQ8A 1F7YA 4UCSA 1JX9A 3DC6A 3E8BA 2QWPB 3RGBA 2E75B 1SESA 4ZHQA 1Q7YW 3ABMC 1YZBA 4PA9A 1Q5OA 1XOUA 4JTCB 3X2QC 2CAZC 3ABMB 4JI7B 5K1PA 3ML0A 3UKMA 1XNQB 3ETQA 5JVDB 4GKKB 5CBGA 3G4SV 3BHPA 3K57A 4X20B 3S3WA 1SQQH 2LGWA 2XAFA 5HFMA 2EIJB 4JV5B 3BY6A 5KHJA 5B1AB 1RM1C 1XEQA 2BCCH 3CCVV 4O4HA 4FZ1A 1WB8A 1EFRG 2QKAA 1PD3A 1TUBA 4UXNA 2LQTA 1XMOB 1I0HA 4EFBA 4I0XA 4PA4A 2YICA 3OR7C 5CB4B 1Y4MA 2JGDA 4ZI7B 4LF9O 4TWKA 4WFGA 4EB6B 1VQ4V 5FLXN 3RYFA 1W59A 4LFBO 1YJ9V 1WNSA 2Q7EA 2BOCC 2IH3C 3B40A 3VOUA 1FXHA 2ZNJA 2ZCEA 3K59A 2ZM6B 1QU7A 2KG7B 1RFYA 5E79Z 2WPDG 4EEQA 3P3NA 1M93A 4GX2A 1U97A 1S3JA 2F4VO 1FYJA 2MW2B 1SA0A 3LNNA 1V54B 3WU2Z 4LH6A 4YY3B 1GN3A 4O4JA 1QCEA 4X62O 2DQ3A 3CC4V 2RQ6A 3W7WA 4JYBA 2WLHA 1CEZA 4QJFB 3LSSA 2EIKB 1R3KC 5IYCO 4PELA 4JI7O 1XMQB 3TETA 2UXNA 2P6JA 3T4ZA 2QR4A 1A32A 3ZRWA 3E2EA 4JI2B 4DR4O 5EIBD 3HKEB 1AVMA 2HJDA 1T5EA 3APQA 4W4LA 4BIUA 1M56B 4MTGA 2Y69C 1BHBA 1Q3EA 1GRJA 4ZIBA 3OAAG 4K0KO 3CJHB 2ARHA 1PM9A 5IT9N 2LJ2A 3LDDA 1FJGO 4JI8O 4K8ZA 5L3CA 2Y4TA 2D3OW 1R3JC 1GMGA 5B1NA 3ASOC 5EBMC 1PV0A 3OGIB 4WBNB 1K4CC 2UUBB 3JASB 2Y0PA 4NTXA 4DV1B 2DYSC 1XL4A 3GB7C 1EBOA 2WAMA 1N36B 4LWSA 4NR1A 4KL1A 4DR7B 4UVBA 1YHQV 5EK0A 4XDJA 1XNQO 1US6A 1LUWA 3ZX6A 2GSMB 4R8CA 4UV8A 5LBQA 1BQ0A 3ABTA 5CBHA 4RUFA 1VQ8V 1WJZA 2IJKA 4BR6A 1KP3A 2QWQB 1GN4A 3EVKA 3CCMV 2OCCC 4ICGA 1MABG 1H38A 3U0ZA 3RYHB 4GZRB 5CA1B 5CA0B 4FFKA 1MG1A 1QR9A 3G6EV 2M7WA 2A7WA 1JFFB 3DXRB 4JI4B 4LBEC 3ZIAG 2QSAA 1BQZA 3KKYA 2CH7A 1Y76B 2HHHB 4DR5O 4JI6B 1XHXA 4X1YA 4FLYA 2YDEA 1Y74A 1Z5VA 2YXHA 5A2QN 2CTQA 3HKDA 1AR1B 4YIOA 1YF2A 2JS3A 1JCHA 4JI0B 5LMUO 4NXMO 1R1BA 5KHHA 5EZYB 4TOIA 3JD4A 2X6AA 4P9PA 3RYCB 5J2UB 2IU0A 4IYHA 2PI4A 1Q81W 1OCZB 2JIZG 4J11A 4O4IB 1JNBA 1YVWA 1IBMB 1AI6A 4FLVA 3SPCA 5IYBO 1SQVH 3WG7B 5B1BB 5KHIA 2AGAA 2JRIA 2WLIB 1H5WA 1TVKA 4DR7O 1ZTEA 4DV2O 1QVFU 4GCZA 1X59A 4AI8A 1WLEA 1KD1W 4WBNA 3JYCA 1Q86W 3CYOA 2YSUB 4ZOLB 2UUCO 3OMNB 5EBLC 2K9PA 3CRMA 5LMUB 2VQEB 3NXSA 3TJTA 4RQEA 3WFVA 1S5LZ 4O4IA 4GYCB 1B6QA 3SGIA 1SERA 3N2GB 4DR1B 3W7UA 3BA8A 1M9NA 3ZHRA 4XDKA 5IWAB 1XNRO 3WB1A 1G6UA 4B3TB 5JH7B 5EYPA 4DK1A 1BMFG 3H1IH 4KXRA 2A79B 1HW7A 2Q73A 1OCCB 3H1LH 3UCSC 4H13B 3ZRVA 1XDCA 3QO7A 5TISZ 3K04A 1R73A 1IURA 1XILA 2Q69A 4DR2O 4J7KA 4MTOA 3K5LA 1P7GA 3ABLB 1J5EB 1CXZB 3F7VC 1P7BA 2EJRA 3B4SA 4GKKO 4OX9O 1RM1B 4J80A 3G80A 1SA0B 3Q4HA 3J81N 1P4RA 1K9MW 4J10A 3CPWU 2F93B 2LGQA 1G1XB 1NI8A 4GLXA 2X7RB 1JR9A 1ORQC 2FTKA 3GVMA 4LH7A 2LFSA 3SJAC 4QE7A 3R65A 1HNXB 1Y67A 3UO3A 4Z1VA 3FYIB 3SJQC 3C3TA 1K7DA 5IWAO 4ZKIA 2DJVA 3M7MX 1XMOO 1W0KG 4FLWA 1KP2A 4JZ2A 2ZE7A 2JGUA 2V7QG 2JJ1G 1GKFA 3SYPA 2IH1C 2Y4UA 2QDOA 1S72V 1O9GA 3MHSC 3CCJV 4TUYA 4CZZA 3BRCA 5KHGA 3CC2V 1O9HA 3ZHSA 3IC9A 2YIBA 3JATA 4MTXA 1YI2V 2P06A 4MS2A 2R72A 1UFIA 2QJ1A 2OT5A 2JS5A 2QWRB 1TUBB 2EIMB 3UT5B 1EN4A 5IYDO 1NQTA 4DYLA 3ZJZA 3D36C 1FXVA 2IW5A 1M1KW 3LUTB 3ZMZA 3DC5A 2ZE8A 1NT2B 5B1AC 4I5SA 3RVYA 2ITCC 3FX7A 5H6QA 2F66C 2GTSA 2WWWA 1K3EA 4RWUA 1ZWIC 2ZIOA 1KUQA 5CBFA 2WA4A 1K33A 4JZGA 4WCEV 3GWKC 1VF7A 4MSWC 1FFXB 4CBCA 3OGCC 3ABUA 3HKCB 2ADPA 2CTWA 3O9OA 2Y69B 1IXBA 4DV4B 3RW0A 4KHPB 3CRAA 1KECA 2E76B 4AHCA 4JI2O 4NB5A 1RSOB 3A2FA 5H6RA 2L35A 3TXSA 4ZHQB 1KKCA 4JYCA 1BE3H 2QKCA 4I50A 4B3RO 1IBLB 4KP4A 3PJSK 2IJJA 3AG3B 4MVMA 4BIOA 2VQEO 1YEWA 3P3PA 4B7EA 1SS3A 5FL7G 5LHHA 5JJEB 4JTAB 1KKDA 2WLKA 3JSLA 5J2TA 3QTCA 3B09A 4JI3B 1FD9A 4HNAB 3TK1A 5IJ0A 4FK5C 4TUYB 1K34A 5LL6Y 4DV1O 2IM9A 2UUBO 5KMGB 2DN9A 5E1AC 2XT9A 4X9QA 3ABLC 1JOYA 4GUNA 2BSKA 4DR2B 4X1KA 3SJCC 4P9OA 2PUSA 3MDSA 5KUMA 2XAJA 3N2KB 1D5NA 1NR7A 5LYJB 2QTSA 2O57A 2A06H 2EINC 2WA3A 4ASUG 3KCYA 5AG2A 4TV8B 1IBLO 2VWKA 3QG5A 1OCRC 3E8FA 2IU3A 4CC5A 3CSXA 4JI1O 1WPXA 4DR3B 1VARA 3CC7V 5IYZB 1ZL8A 2N74A 2Z3YA 1FFTB 2UXCB 3JD2A 5IE9A 1TAEA 1TUEB 2QEXV 5IY5C 3KCXA 2UUAO 1I5XA 3B8MA 5BR8B 4ZOLA 4D7TA 1HNWO 2YC0A 3RBZA 2EILC 3T1HO 1VP7A 1AJQA 2BTQA 2LFRA 4J42A 4DW1A 4CH4A 2DQ0A 1NTKH 1TVKB 4KUMA 4MVUA 3JAMN 1WPBA 4IL6Z 4PJ0Z 5LMNO 4JI0O 1S77D 2V4DA 2UXBB 3B8NA 3FD9A 2CK3G 1PL4A 1PNKA 2EIJC 2KB1A 4FLXA 3ZN1A 2YXLA 5B66Z 2HVJC 1OCRB 1GN2A 5L3BA 3KDRA 1ROPA 1M90W 3G67A 3HR0A 4FPPA 4PDVA 1ENVA 5GTHZ 3LSUA 1Q6UA 1EZVH 1LUVA 1Q8IA 4FIPC 2CH7B 5JJNB 1GAXA 4YIPA 1WB7A 3QO8A 3JARB 3SR2C 1IX9A 4UVAA 4K35A 4NTWA 2ATKC 1VQLV 1P49A 1JVMA 4IIJB 4C7UA 3VQYA 3OEHG 1AP6A 1I94B 1VQ5V 2UXCO 4WFHA 5C8YB 1NTMH 1MZFA 1GM8A 1HNWB 1SZTA 3T1HB 2QA4V 2YIDA 5L3DA 2B9ZA 2IBZH 4I9QA 1SC5B 2DE0X 4QNHB 3CX5F 1FS0G 1M4UA 1VQ9V 4PD4F 4FZ0A 4K3AA 5ITZA 4PA7A 4I9WA 3E8GA 1U96A 5LHGA 5L3GA 4OX9B 2ZKOA 4O4LA 2ILMA 1MMMA 4EFEA 3RYHA 4Z1MG 2A9HA 4DO2A 3TXQA 3ZMSA 2ZQMA 4UCRA 5C8YA 1KYOF 3D3IA 1L1FA 4YY3O 1I94O 5EZYA 5IY5B 4UB8Z 2ZDIC 1VQNV 1ZLZA 2F43G 5LGUA 1H2GA 4FM1A 3ZS8C 1PP9H 1XQ8A 1NTZH 1Z2GA 3E8HA 3K08A 4JAUA 5ITZB 1D2DA 2JDIG 1YTFD 3E86A 4X89A 2GHYA 4FLUA 4N23A 1Q82W 1XI1A 3JASA 4LF5B 1S0VA 3EXAA 1H2KA 1VQPV 3IJ4A 2CUGA 3VQWA 4I55B 2NNUA 4K0KB 4PV1B 3T2MA 1AJNA 4WFFA 2L6LA 2OWOA 4MVOA 5GTIZ 4CH3A 3FAVB 5GONA 1K4DC 4X1IB 2CTPA 1NVPB 1OCZC 3ZCCA 1YITV 1NVPD 4FFBA 4DUZB 1GO3F 2GUZB 2B5UA 5FPOA 3K0DA 4N21A 1QR8A 4BAYA 1DGSA 1JFFA 1V9PA 4DXWA 2FKXA 2XOKG 2OCHA 5CMUA 5B5EZ 2XASA 1RP3B 1N0JA 2RJZA 5LYJA 3VQVA 3ZBHA 4JYAO 5CN0A 3I5DA 1URFA 4P30A 4JV5O 2OTLV 4BW5A 1GH6A 3TCUA 1SQXH 4PA6A 4PDMA 2Q4PA 4D7SA 1XBLA 3THOA 5K1XA 1NU1H 1GK9A 2BTOA 2UU9O 1H2MA 2P4VA 2DMXA 1KMIZ 1G4YB 4DV7O 4JI4O 4TQFA 4DUZO 1E1RG 3BABA 2A0LA 4DRXA 2M6YA 3ZMTA 5LP6B 5DEDA 3I55V 3K9SA 3CE2A 4JI6O 2BTQB 4H44B 4LF5O 3CP1A 4ZI7A 4HZ3A 4TV8A 2XAQA 4LNUB 5LA6A 1R6NA 3SPGA 5L3FA 3CCLV 3ICXA 2FB5A 3BAAA 1KU9A 1PPJH 2ZIMA 1VQKV 5IYZA 1OZ0A 2BSKB 3STLC 2P7TC 2XNDG 4JTDB 4B3SO 3CCUV 4NYKA 4PI0A 4DR3O 3MHHC 2ZINA 3QF7A 3MAQA 4U3JA 1NZ6A 2P4KA 1I08A 3OTOO 2QTOA 5KA5A 3UO2A 1EZJA 1QHTA 4UCVA 1OCOC 4LFAB 3JAKB 2RDCA 3OUFA 5D5QA 1N0NA 1Z5WA 5J2TB 3J80N 2WLMA 5BR8O 4CH5A 1AB3A 4O4JB 4FVMA 1M57C 1PL0A 5KAFZ 3CXCU 3K9AA 5FPRA 4GT1A 1B06A 3SYOA 3SDLA 2WLLB 4QIWF 1FPOA 5F2VO 2PI5A 1AI7A 2AHZA 4FMTA 1BS3A 2YI9A 3K06A 3LDCA 2F95B 2W0FC 2PTMA 5LMNB 1TGOA 1FXKA 1SETA 1FOUA 2RNBA 1FJGB 4L87A 4B3SB 4QE9A 3JAKA 5C93A 3ZRSA 4LF7B 3OM3B 2PYJA 1YCIA 1HP8A 4J7JA 4JF3A 1HDJA 4RUEA 1XL6A 3IC7A 2Q0OC 5JJJB 3CMEV 2DYRB 5B3SC 3T1YO 1BL8A 3OUSA 2OCCB 2X6BA 1JA8A 4LC1A 2H8PC 5IJ9B 3RWRD 3AK2A 2Z5UA 3RFRA 4KFMA 4U7OA 4YJ2B 2VQFB 5JVDA 4X88A 2LW7A 1HR0B 1FFXA 5EC1C 5JWPA 1YXBA 4FLTA 4U3JB 5HFLA 4LF8O 4R50A 4BWAA 2PY5A 1GTOA 4OPAA 5DECA 1THZA 2W6IG 2V1DA 1HNXO 2WLNA 2PYLA 1NKDA 4Q6GA 2EZOA 4LF7O 1K5QA 1RSOA 3F5WC 2RMKB 4DV7B 5LXTA 2FL4A 4MTFA 4JI5B 2XUMA 3ZHTA 2ZXWC 3EFFK 2KSDA 4WFBV 3CHXA 4GX1A 4HBNA 3RT3C 1W2BU 2WLLA 2DYRC 5B3SB 5IJ9A 2DW4A 2WLIA 4DW0A 5LGNA 3MD0A 4EKWA 4ABMA 1CP9A 2QE7G 3CS5A 1OCOB 2ZE6A 3CEIA 1VF6A 4RO2A 4AQYO 4HAMA 2ZNIA 2LW1A 1M5IA 3JSNA 4H0LB 3BEHA 3WB2A 2P22C 4UV9A 4NKGB 3D3QA 2UXXA 4OPHA 4YHHO 3U10A 3OEEG 2OTJV 4DV5O 4DV0B 2XAGA 4DV2B 1K8AW 3HKDB 4QPJA 5B1OA 1KBHA 1Y66A 3HKBB 1VF6C 1GM9A 3AEIA 1DF5A 2IJIA 4G27B 3JAWA 4OXSA 3M99B 4DV3O 4PA3A 2QM4A 3L9DA 3W7SA 2N05A 3JCZA 1B04A 5EIBC 1SZXA 1K97A 4DR1O 1NJIW 4W4KA 5BZBA 4F4LA 1QNMA 2N04A 2BOBC 4YJ3A 2YIAA 1R6TA 1KC8W 2E5LB 4LP8A 4LNUA 1AJPA 5J2UA 2NN4A 5LHIA 4IYIA 4PDRA 3CCEV 4O2AA 3SYCA 4DV0O 4R7CA 4GX5A 1XMQO 1HR0O 4JASA 4DRXB 4UB6Z 3ABKC 4HYOA 4QPKA 4ZBMA 4AILC 4JYAB 4LFCO 2Q6AA 5LOVB 4FM2A 3AK1A 4JYYA 1MNGA 3L75H 2ITDC 1Y76A 4IGGA 2QKSA 1VQMV 5EC2C 4FFBB 1VEWA 3P32A 4OGQB 2E74B 2UU9B 3O65A 1ZUQA 1AILA 3AG4C 4X1IA 2B1IA 4G2KA 3FAVA 5GONB 1N34B 1RPRA 1J95A 3ASNC 3QNEA 3DGEA 2KQXA 2GBOA 4A5UB 4JAAA 5CA1A 2DWEC 2E5LO 2PGGA 5L3EA 4IHJA 1WA8B 3SYAA 1V54C 3FB5C 4RAIA 3H1KH 4I7ZB 4L8JA 4DV6B 4NXNB 1EM1A 3A8TA 4H37A 4GKJO 3L70H 4UCTA 1N32O 3IFXA 1SF9A 1WA8A 4DV3B 3E22A 2P90A 5CA0A 1F51A 2HKOA 4X64B 3DTUB 3FKSG 4U7NA 1RPOA 2Q8VA 5H5NA 1E1QG 3G6BA 3FYEB 3JARA 5BY1A 1Q6IA 2R9RB 1BCCH 2CDYA 2Y0IA 1XUQA 4X65B 1M57B 1FXKC 2W6JG 2KG7A 2CGNA 4TV9B 3K03A 4LFBB 4Q20A 4DK0A 1JQ0A 2JJ2G 3BCCH 1Y6XA 2HHHO 3T4DA 3K3WA 1KB9F 2AZ0A 1SQFA 1G8MA 4LWSB 1SRYA 3EHBB 3OMAB 1Q90D 1R6KA 2OIEA 1N4CA 3F7YC 1VQOV 4DUYB 1IBKB 3AG7A 4RQFA 1HNZO 1YTFB 2UXDO 2QGNA 1WAZA 4B08A 4YJ3B 5BXZA 1GM7A 1FKAO 1WN7A 3E83A 3U11A 4DR6B 4IIJA 3T1YB 3RYIB 1NH2D 2HR3A 2AXTZ 1ZL8B 1PNMA 3TGUH 1VF5B 4F6RA 1NH2B 3HKEA 5LGTA 1OHHG 1Y74B 1IBMO 4X1YB 2HEPA 2JK5C 2OYQA 1ZSPA 2YI8A 1BSMA 4TSFG 3A0HZ 4GX0A 4J9ZB 3K5NA 3HPLC 2Q5ZA 3OR6C 3N2KA 4WF9V 4UVCA 2UUCB 4LF8B 3BVOA 4X1KB 4X66B 1MA1A 2ZR3A 4F6EA 4IT5A 2PF4E 1E79G 5BMVA 3ASOB 4TT3G 2ZD9A 4U3FH 5IJ0B 5BMVB 1XNRB 3ZRWB 2Q7HA 4DR6O 2OIGA 1MZEA 1PNLA 1S76D 4JAVA 1DF4A 2WSSG 3ETEA 1NS1A 5KHKA 2GTAA 2QM8A 2EULA 2Q68A 4G28B 2GV9A 2Q0AA 5KA6A 3I56V 2AW9A 3L72H 4MVQA 4DV6O 2LP7A 2F23A 5A9GA 2HG5C 3STZC 3SPHA 2ZM6O 3JD0A 5CB4A 4FLZA 3SYQA 2A3QA 3RYFB 1OJHA 4DUYO 3L73H 3W7XA 5H2FZ 1BT8A 4I0XB 4E2LA 4D6TH 2EIMC 3BPZA 3H9VA 4LF6O 3SJBC 3CJHA 3FB8C 4WFAV 4O4HB 2H3OA 4MW8A 3AG2B 3ZHQA 1W0JG 4FJCC 2P67A 3OTOB 3L74H 5LA6B 2Q7GA 1NR1A 1QLEB 4MVZA 2JGDB 2LO1A 2YIBD 1B3QA 3JD1A 2EINB 3A0RA 3ZMVA 5LP6A 2ZR2A 1L8DA 3CWBH 4TV9A 1QVGU 3JCUZ 1AR4A 2NLJC 4YJ2A 4BIZA 3FB7C 1H8HG 4JPRA 3UM7A 4NXMB 3OMIB 4PDLA 4UCUA 4MW3A 3LDEA 3M8AA 1IDSA 3K5OA 4TQDA 1AR5A 1V55B 1WP8A 2EZPA 5JQGB 5KX5A 1SQGA 3X2QB 3UT5A 1H2LA 4UCOA 1XHZA 1X4TA 2H94A 1IJGA 3CRRA 2ZDIA 3ETDA 3WG7C 3RVZA 3JATB 3JALB 1R3IC
chains in the Genus database with same CATH topology
1EN6A 1N0NA 2ADPA 1XDCA 1IXBA 3KKYA 2AW9A 1N0JA 1XILA 5A9GA 1B06A 1P7GA 1KKCA 2QKCA 1AVMA 4YIOA 2RCVA 4E4EA 1BS3A 3AK1A 4JYYA 1MMMA 1MNGA 1BT8A 1JR9A 1PM9A 1XREA 3CEIA 2CE4A 1GN6A 1Y67A 1WB8A 1VEWA 2QKAA 3C3SA 1PL4A 1ZUQA 3C3TA 1I0HA 4JZ2A 1AP5A 1ZLZA 1JA8A 1GN2A 1MSDA 3KDRA 3AK2A 3K9SA 1ZSPA 4X9QA 4GUNA 1BSMA 1ZTEA 3MDSA 3LSUA 3RN4A 1EM1A 1D5NA 1LUVA 3QVNA 1LUWA 3IC9A 1EN5A 2ADQB 4YIPA 3BFRA 1AR4A 1WB7A 5AG2A 1IX9A 4BR6A 1EN4A 1MA1A 3TJTA 4F6EA 3EVKA 1GN4A 3AK3A 1SZXA 3OT7A 1IDSA 3DC5A 2GDSA 1AR5A 4C7UA 1VARA 1QNMA 1AP6A 4FFKA 2P4KA 3DC6A 1I08A 1GN3A 2CDYA 4JZGA 1XUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EN6 A;  1N0N A;  2ADP A;  1XDC A;  1IXB A;  3KKY A;  2AW9 A;  1N0J A;  1XIL A;  5A9G A;  1B06 A;  1P7G A;  1KKC A;  2QKC A;  1AVM A;  4YIO A;  2RCV A;  4E4E A;  1BS3 A;  3AK1 A;  4JYY A;  1MMM A;  1MNG A;  1BT8 A;  1JR9 A;  1PM9 A;  1XRE A;  3CEI A;  2CE4 A;  1GN6 A;  1Y67 A;  1WB8 A;  1VEW A;  2QKA A;  3C3S A;  1PL4 A;  1ZUQ A;  3C3T A;  1I0H A;  4JZ2 A;  1AP5 A;  1ZLZ A;  1JA8 A;  1GN2 A;  1MSD A;  3AK2 A;  3K9S A;  1ZSP A;  4X9Q A;  4GUN A;  1BSM A;  1ZTE A;  3MDS A;  3LSU A;  3RN4 A;  1EM1 A;  1D5N A;  1LUV A;  3QVN A;  1LUW A;  3IC9 A;  1EN5 A;  2ADQ B;  4YIP A;  3BFR A;  1AR4 A;  1WB7 A;  5AG2 A;  1IX9 A;  4BR6 A;  1EN4 A;  1MA1 A;  3TJT A;  4F6E A;  3EVK A;  1GN4 A;  3AK3 A;  1SZX A;  3OT7 A;  1IDS A;  3DC5 A;  2GDS A;  1AR5 A;  4C7U A;  1VAR A;  1QNM A;  1AP6 A;  4FFK A;  2P4K A;  3DC6 A;  1I08 A;  1GN3 A;  2CDY A;  4JZG A;  1XUQ A; 
#chains in the Genus database with same CATH topology
 4CS3 A;  1V55 C;  5FNV A;  1N33 O;  3OFN G;  4DV4 O;  2CGO A;  2JEU A;  5CA3 A;  1VQ7 V;  1UJW B;  1MOF A;  4CS2 A;  1UPG A;  5DN6 G;  4IHJ B;  1QLN A;  1K5S A;  2HVK C;  4HNA A;  4X66 O;  1QQC A;  1YJN V;  2X0L A;  1H8E G;  3ASN B;  2ZXW B;  3OE7 G;  3F5T A;  5KAI Z;  2XAH A;  3AG4 B;  2JVD A;  3K5M A;  3R66 A;  2ODM A;  3CCS V;  3CD6 V;  1S5J A;  4XDL A;  3CRQ A;  3E89 A;  4X20 A;  4B3T O;  2X6C A;  1NBM G;  1N34 O;  4LFA O;  2VRZ A;  2EIK C;  4JI5 O;  4I50 B;  4R6Z A;  3N2G A;  4LF9 B;  5JCO A;  2AHY A;  4F6R B;  3T1C A;  1F23 A;  3H1J H;  3RYI A;  4YXW G;  4JGS A;  3E35 A;  3HKC A;  2ETN A;  1BHA A;  1YDX A;  1Q6H A;  4NXN O;  1EN5 A;  1J5E O;  4GKJ B;  2ADQ B;  2ZE5 A;  1CPY A;  2BE3 A;  1N32 B;  3H1H H;  1L0L H;  1VIB A;  5JH7 A;  1K73 W;  3K58 A;  1JMK C;  4LCU C;  1OV9 A;  1DLB A;  3AK3 A;  3P30 A;  1MSW D;  3ZMU A;  4Z2W A;  2EBO A;  3CCQ V;  4LF6 B;  1VMG A;  5DM6 V;  2EJ7 A;  3AG2 C;  4AQY B;  2QWO B;  3ZN0 A;  4O4L B;  1JJ2 U;  2YS8 A;  2F4V B;  4JI1 B;  3S3X A;  1K92 A;  1SKV A;  3FFQ A;  3VQX A;  5LOV A;  4O2B B;  2C2A A;  3SPI A;  4J41 A;  2DYS B;  4PHZ A;  1QLE C;  3H01 A;  2FYU H;  4LR3 A;  3OW2 U;  4WFE A;  4X62 B;  3CRC A;  1AI4 A;  4NTY A;  2MK3 A;  1EN6 A;  4I4T A;  3RYC A;  2NR5 A;  2Y48 A;  3Q4H B;  3JAW B;  4X65 O;  2UUA B;  2K1E A;  2YEV A;  3WB0 A;  1HWY A;  5KUK A;  4UFZ A;  2HJF C;  5B1B C;  1ARO P;  3A0B Z;  3LSQ A;  3J7A U;  4LF4 B;  2EX3 A;  3DSQ A;  1H2N A;  2RCV A;  1ZAU A;  4E4E A;  3IGA C;  4B3M B;  2D2C B;  5EBW C;  5GW7 A;  1ZX3 A;  1L0N H;  1SQB H;  2VS0 A;  3E22 B;  2GUZ A;  3B77 A;  4J9Y B;  2Q67 A;  4BW9 A;  5KLV H;  2E3C A;  1HNZ B;  2R70 A;  1KQS U;  5EYP B;  4JI8 B;  2UXB O;  1F4M A;  3C3S A;  2F1M A;  3L71 H;  1BGY H;  4J7Z A;  1P84 F;  3PN1 A;  1IXM A;  3OTF A;  2KKW A;  1AI5 A;  2VWJ A;  2QWN B;  3HKB A;  2Z0A A;  5H9C A;  2DOS A;  4I55 A;  2YUA A;  2RN9 A;  1IZ3 A;  2IJH A;  4X8A A;  3W7T A;  1N33 B;  3KZI Z;  4P2Z A;  4XBF A;  1N36 O;  4KHP O;  1COW G;  3APO A;  3GWO A;  3RN4 A;  3QO5 A;  4I4T B;  3CMA V;  3QVN A;  2JEX A;  1OCC C;  2B1G A;  1LNQ A;  5D5P A;  1WP7 A;  1YJW V;  4LF4 O;  4MVR A;  3CB2 A;  4B3R B;  3BFR A;  2W0X A;  4FM0 A;  1IVS A;  2EIL B;  4O2B A;  3ETG A;  1PKX A;  3B2E E;  3OT7 A;  3CCR V;  1F4N A;  4B7K A;  1R3L C;  3LNM B;  3AG1 C;  4K8X A;  1SQP H;  3G71 V;  2YEV B;  1YIJ V;  3NR7 A;  4H33 A;  2HP8 A;  2AZ2 A;  4O2A B;  2WLJ A;  2XTA A;  3BA9 A;  2ZT9 B;  1QBZ A;  4YHH B;  3AG1 B;  4DV5 B;  2R9I A;  1I5Y A;  1FAF A;  4DR5 B;  3ZED A;  3CXH F;  3K79 A;  3ZHV A;  3K0G A;  2YXY A;  3KG2 A;  4B3M O;  2R9A A;  2P5O A;  3VBB A;  4CS4 A;  1N8R W;  1XRE A;  2CE4 A;  1GN6 A;  1LR1 A;  5LP6 C;  4X64 O;  3FB6 C;  3D8C A;  1FXK B;  1AP5 A;  5KX5 B;  4MVS A;  1MSD A;  3C90 A;  2PZS A;  2Q9L A;  5IDJ A;  5J9P C;  1JJO A;  2VQF O;  2FML A;  1YSC A;  1S5H C;  2HLD G;  1D5A A;  3IAY A;  1DK1 A;  4CH6 A;  5KMG A;  3N27 A;  4NVP A;  1BZK A;  2XHB A;  2G38 A;  1Q43 A;  3SPJ A;  3JAL A;  2HFE C;  3DXR A;  1VQ6 V;  4LFC B;  4DR4 B;  5JCO C;  5FNV B;  4PI2 A;  4MT8 A;  1JPX A;  1TA8 A;  3ABK B;  3ZRX A;  2QM7 A;  3JD3 A;  4UUJ C;  3D36 A;  1IBK O;  5JQG A;  5LXT B;  1I7F A;  3ZHU A;  2CTR A;  2DWD C;  3HB3 B;  2UXD B;  2GDS A;  3OD4 A;  1DTO A;  4EB6 A;  4QGP A;  4JI3 O;  1H2S B;  1M56 C;  4CC6 A;  3AG3 C;  3UQ8 A;  1F7Y A;  4UCS A;  1JX9 A;  3DC6 A;  3E8B A;  2QWP B;  3RGB A;  2E75 B;  1SES A;  4ZHQ A;  1Q7Y W;  3ABM C;  1YZB A;  4PA9 A;  1Q5O A;  1XOU A;  4JTC B;  3X2Q C;  2CAZ C;  3ABM B;  4JI7 B;  5K1P A;  3ML0 A;  3UKM A;  1XNQ B;  3ETQ A;  5JVD B;  4GKK B;  5CBG A;  3G4S V;  3BHP A;  3K57 A;  4X20 B;  3S3W A;  1SQQ H;  2LGW A;  2XAF A;  5HFM A;  2EIJ B;  4JV5 B;  3BY6 A;  5KHJ A;  5B1A B;  1RM1 C;  1XEQ A;  2BCC H;  3CCV V;  4O4H A;  4FZ1 A;  1WB8 A;  1EFR G;  2QKA A;  1PD3 A;  1TUB A;  4UXN A;  2LQT A;  1XMO B;  1I0H A;  4EFB A;  4I0X A;  4PA4 A;  2YIC A;  3OR7 C;  5CB4 B;  1Y4M A;  2JGD A;  4ZI7 B;  4LF9 O;  4TWK A;  4WFG A;  4EB6 B;  1VQ4 V;  5FLX N;  3RYF A;  1W59 A;  4LFB O;  1YJ9 V;  1WNS A;  2Q7E A;  2BOC C;  2IH3 C;  3B40 A;  3VOU A;  1FXH A;  2ZNJ A;  2ZCE A;  3K59 A;  2ZM6 B;  1QU7 A;  2KG7 B;  1RFY A;  5E79 Z;  2WPD G;  4EEQ A;  3P3N A;  1M93 A;  4GX2 A;  1U97 A;  1S3J A;  2F4V O;  1FYJ A;  2MW2 B;  1SA0 A;  3LNN A;  1V54 B;  3WU2 Z;  4LH6 A;  4YY3 B;  1GN3 A;  4O4J A;  1QCE A;  4X62 O;  2DQ3 A;  3CC4 V;  2RQ6 A;  3W7W A;  4JYB A;  2WLH A;  1CEZ A;  4QJF B;  3LSS A;  2EIK B;  1R3K C;  5IYC O;  4PEL A;  4JI7 O;  1XMQ B;  3TET A;  2UXN A;  2P6J A;  3T4Z A;  2QR4 A;  1A32 A;  3ZRW A;  3E2E A;  4JI2 B;  4DR4 O;  5EIB D;  3HKE B;  1AVM A;  2HJD A;  1T5E A;  3APQ A;  4W4L A;  4BIU A;  1M56 B;  4MTG A;  2Y69 C;  1BHB A;  1Q3E A;  1GRJ A;  4ZIB A;  3OAA G;  4K0K O;  3CJH B;  2ARH A;  1PM9 A;  5IT9 N;  2LJ2 A;  3LDD A;  1FJG O;  4JI8 O;  4K8Z A;  5L3C A;  2Y4T A;  2D3O W;  1R3J C;  1GMG A;  5B1N A;  3ASO C;  5EBM C;  1PV0 A;  3OGI B;  4WBN B;  1K4C C;  2UUB B;  3JAS B;  2Y0P A;  4NTX A;  4DV1 B;  2DYS C;  1XL4 A;  3GB7 C;  1EBO A;  2WAM A;  1N36 B;  4LWS A;  4NR1 A;  4KL1 A;  4DR7 B;  4UVB A;  1YHQ V;  5EK0 A;  4XDJ A;  1XNQ O;  1US6 A;  1LUW A;  3ZX6 A;  2GSM B;  4R8C A;  4UV8 A;  5LBQ A;  1BQ0 A;  3ABT A;  5CBH A;  4RUF A;  1VQ8 V;  1WJZ A;  2IJK A;  4BR6 A;  1KP3 A;  2QWQ B;  1GN4 A;  3EVK A;  3CCM V;  2OCC C;  4ICG A;  1MAB G;  1H38 A;  3U0Z A;  3RYH B;  4GZR B;  5CA1 B;  5CA0 B;  4FFK A;  1MG1 A;  1QR9 A;  3G6E V;  2M7W A;  2A7W A;  1JFF B;  3DXR B;  4JI4 B;  4LBE C;  3ZIA G;  2QSA A;  1BQZ A;  3KKY A;  2CH7 A;  1Y76 B;  2HHH B;  4DR5 O;  4JI6 B;  1XHX A;  4X1Y A;  4FLY A;  2YDE A;  1Y74 A;  1Z5V A;  2YXH A;  5A2Q N;  2CTQ A;  3HKD A;  1AR1 B;  4YIO A;  1YF2 A;  2JS3 A;  1JCH A;  4JI0 B;  5LMU O;  4NXM O;  1R1B A;  5KHH A;  5EZY B;  4TOI A;  3JD4 A;  2X6A A;  4P9P A;  3RYC B;  5J2U B;  2IU0 A;  4IYH A;  2PI4 A;  1Q81 W;  1OCZ B;  2JIZ G;  4J11 A;  4O4I B;  1JNB A;  1YVW A;  1IBM B;  1AI6 A;  4FLV A;  3SPC A;  5IYB O;  1SQV H;  3WG7 B;  5B1B B;  5KHI A;  2AGA A;  2JRI A;  2WLI B;  1H5W A;  1TVK A;  4DR7 O;  1ZTE A;  4DV2 O;  1QVF U;  4GCZ A;  1X59 A;  4AI8 A;  1WLE A;  1KD1 W;  4WBN A;  3JYC A;  1Q86 W;  3CYO A;  2YSU B;  4ZOL B;  2UUC O;  3OMN B;  5EBL C;  2K9P A;  3CRM A;  5LMU B;  2VQE B;  3NXS A;  3TJT A;  4RQE A;  3WFV A;  1S5L Z;  4O4I A;  4GYC B;  1B6Q A;  3SGI A;  1SER A;  3N2G B;  4DR1 B;  3W7U A;  3BA8 A;  1M9N A;  3ZHR A;  4XDK A;  5IWA B;  1XNR O;  3WB1 A;  1G6U A;  4B3T B;  5JH7 B;  5EYP A;  4DK1 A;  1BMF G;  3H1I H;  4KXR A;  2A79 B;  1HW7 A;  2Q73 A;  1OCC B;  3H1L H;  3UCS C;  4H13 B;  3ZRV A;  1XDC A;  3QO7 A;  5TIS Z;  3K04 A;  1R73 A;  1IUR A;  1XIL A;  2Q69 A;  4DR2 O;  4J7K A;  4MTO A;  3K5L A;  1P7G A;  3ABL B;  1J5E B;  1CXZ B;  3F7V C;  1P7B A;  2EJR A;  3B4S A;  4GKK O;  4OX9 O;  1RM1 B;  4J80 A;  3G80 A;  1SA0 B;  3Q4H A;  3J81 N;  1P4R A;  1K9M W;  4J10 A;  3CPW U;  2F93 B;  2LGQ A;  1G1X B;  1NI8 A;  4GLX A;  2X7R B;  1JR9 A;  1ORQ C;  2FTK A;  3GVM A;  4LH7 A;  2LFS A;  3SJA C;  4QE7 A;  3R65 A;  1HNX B;  1Y67 A;  3UO3 A;  4Z1V A;  3FYI B;  3SJQ C;  3C3T A;  1K7D A;  5IWA O;  4ZKI A;  2DJV A;  3M7M X;  1XMO O;  1W0K G;  4FLW A;  1KP2 A;  4JZ2 A;  2ZE7 A;  2JGU A;  2V7Q G;  2JJ1 G;  1GKF A;  3SYP A;  2IH1 C;  2Y4U A;  2QDO A;  1S72 V;  1O9G A;  3MHS C;  3CCJ V;  4TUY A;  4CZZ A;  3BRC A;  5KHG A;  3CC2 V;  1O9H A;  3ZHS A;  3IC9 A;  2YIB A;  3JAT A;  4MTX A;  1YI2 V;  2P06 A;  4MS2 A;  2R72 A;  1UFI A;  2QJ1 A;  2OT5 A;  2JS5 A;  2QWR B;  1TUB B;  2EIM B;  3UT5 B;  1EN4 A;  5IYD O;  1NQT A;  4DYL A;  3ZJZ A;  3D36 C;  1FXV A;  2IW5 A;  1M1K W;  3LUT B;  3ZMZ A;  3DC5 A;  2ZE8 A;  1NT2 B;  5B1A C;  4I5S A;  3RVY A;  2ITC C;  3FX7 A;  5H6Q A;  2F66 C;  2GTS A;  2WWW A;  1K3E A;  4RWU A;  1ZWI C;  2ZIO A;  1KUQ A;  5CBF A;  2WA4 A;  1K33 A;  4JZG A;  4WCE V;  3GWK C;  1VF7 A;  4MSW C;  1FFX B;  4CBC A;  3OGC C;  3ABU A;  3HKC B;  2ADP A;  2CTW A;  3O9O A;  2Y69 B;  1IXB A;  4DV4 B;  3RW0 A;  4KHP B;  3CRA A;  1KEC A;  2E76 B;  4AHC A;  4JI2 O;  4NB5 A;  1RSO B;  3A2F A;  5H6R A;  2L35 A;  3TXS A;  4ZHQ B;  1KKC A;  4JYC A;  1BE3 H;  2QKC A;  4I50 A;  4B3R O;  1IBL B;  4KP4 A;  3PJS K;  2IJJ A;  3AG3 B;  4MVM A;  4BIO A;  2VQE O;  1YEW A;  3P3P A;  4B7E A;  1SS3 A;  5FL7 G;  5LHH A;  5JJE B;  4JTA B;  1KKD A;  2WLK A;  3JSL A;  5J2T A;  3QTC A;  3B09 A;  4JI3 B;  1FD9 A;  4HNA B;  3TK1 A;  5IJ0 A;  4FK5 C;  4TUY B;  1K34 A;  5LL6 Y;  4DV1 O;  2IM9 A;  2UUB O;  5KMG B;  2DN9 A;  5E1A C;  2XT9 A;  4X9Q A;  3ABL C;  1JOY A;  4GUN A;  2BSK A;  4DR2 B;  4X1K A;  3SJC C;  4P9O A;  2PUS A;  3MDS A;  5KUM A;  2XAJ A;  3N2K B;  1D5N A;  1NR7 A;  5LYJ B;  2QTS A;  2O57 A;  2A06 H;  2EIN C;  2WA3 A;  4ASU G;  3KCY A;  5AG2 A;  4TV8 B;  1IBL O;  2VWK A;  3QG5 A;  1OCR C;  3E8F A;  2IU3 A;  4CC5 A;  3CSX A;  4JI1 O;  1WPX A;  4DR3 B;  1VAR A;  3CC7 V;  5IYZ B;  1ZL8 A;  2N74 A;  2Z3Y A;  1FFT B;  2UXC B;  3JD2 A;  5IE9 A;  1TAE A;  1TUE B;  2QEX V;  5IY5 C;  3KCX A;  2UUA O;  1I5X A;  3B8M A;  5BR8 B;  4ZOL A;  4D7T A;  1HNW O;  2YC0 A;  3RBZ A;  2EIL C;  3T1H O;  1VP7 A;  1AJQ A;  2BTQ A;  2LFR A;  4J42 A;  4DW1 A;  4CH4 A;  2DQ0 A;  1NTK H;  1TVK B;  4KUM A;  4MVU A;  3JAM N;  1WPB A;  4IL6 Z;  4PJ0 Z;  5LMN O;  4JI0 O;  1S77 D;  2V4D A;  2UXB B;  3B8N A;  3FD9 A;  2CK3 G;  1PL4 A;  1PNK A;  2EIJ C;  2KB1 A;  4FLX A;  3ZN1 A;  2YXL A;  5B66 Z;  2HVJ C;  1OCR B;  1GN2 A;  5L3B A;  3KDR A;  1ROP A;  1M90 W;  3G67 A;  3HR0 A;  4FPP A;  4PDV A;  1ENV A;  5GTH Z;  3LSU A;  1Q6U A;  1EZV H;  1LUV A;  1Q8I A;  4FIP C;  2CH7 B;  5JJN B;  1GAX A;  4YIP A;  1WB7 A;  3QO8 A;  3JAR B;  3SR2 C;  1IX9 A;  4UVA A;  4K35 A;  4NTW A;  2ATK C;  1VQL V;  1P49 A;  1JVM A;  4IIJ B;  4C7U A;  3VQY A;  3OEH G;  1AP6 A;  1I94 B;  1VQ5 V;  2UXC O;  4WFH A;  5C8Y B;  1NTM H;  1MZF A;  1GM8 A;  1HNW B;  1SZT A;  3T1H B;  2QA4 V;  2YID A;  5L3D A;  2B9Z A;  2IBZ H;  4I9Q A;  1SC5 B;  2DE0 X;  4QNH B;  3CX5 F;  1FS0 G;  1M4U A;  1VQ9 V;  4PD4 F;  4FZ0 A;  4K3A A;  5ITZ A;  4PA7 A;  4I9W A;  3E8G A;  1U96 A;  5LHG A;  5L3G A;  4OX9 B;  2ZKO A;  4O4L A;  2ILM A;  1MMM A;  4EFE A;  3RYH A;  4Z1M G;  2A9H A;  4DO2 A;  3TXQ A;  3ZMS A;  2ZQM A;  4UCR A;  5C8Y A;  1KYO F;  3D3I A;  1L1F A;  4YY3 O;  1I94 O;  5EZY A;  5IY5 B;  4UB8 Z;  2ZDI C;  1VQN V;  1ZLZ A;  2F43 G;  5LGU A;  1H2G A;  4FM1 A;  3ZS8 C;  1PP9 H;  1XQ8 A;  1NTZ H;  1Z2G A;  3E8H A;  3K08 A;  4JAU A;  5ITZ B;  1D2D A;  2JDI G;  1YTF D;  3E86 A;  4X89 A;  2GHY A;  4FLU A;  4N23 A;  1Q82 W;  1XI1 A;  3JAS A;  4LF5 B;  1S0V A;  3EXA A;  1H2K A;  1VQP V;  3IJ4 A;  2CUG A;  3VQW A;  4I55 B;  2NNU A;  4K0K B;  4PV1 B;  3T2M A;  1AJN A;  4WFF A;  2L6L A;  2OWO A;  4MVO A;  5GTI Z;  4CH3 A;  3FAV B;  5GON A;  1K4D C;  4X1I B;  2CTP A;  1NVP B;  1OCZ C;  3ZCC A;  1YIT V;  1NVP D;  4FFB A;  4DUZ B;  1GO3 F;  2GUZ B;  2B5U A;  5FPO A;  3K0D A;  4N21 A;  1QR8 A;  4BAY A;  1DGS A;  1JFF A;  1V9P A;  4DXW A;  2FKX A;  2XOK G;  2OCH A;  5CMU A;  5B5E Z;  2XAS A;  1RP3 B;  1N0J A;  2RJZ A;  5LYJ A;  3VQV A;  3ZBH A;  4JYA O;  5CN0 A;  3I5D A;  1URF A;  4P30 A;  4JV5 O;  2OTL V;  4BW5 A;  1GH6 A;  3TCU A;  1SQX H;  4PA6 A;  4PDM A;  2Q4P A;  4D7S A;  1XBL A;  3THO A;  5K1X A;  1NU1 H;  1GK9 A;  2BTO A;  2UU9 O;  1H2M A;  2P4V A;  2DMX A;  1KMI Z;  1G4Y B;  4DV7 O;  4JI4 O;  4TQF A;  4DUZ O;  1E1R G;  3BAB A;  2A0L A;  4DRX A;  2M6Y A;  3ZMT A;  5LP6 B;  5DED A;  3I55 V;  3K9S A;  3CE2 A;  4JI6 O;  2BTQ B;  4H44 B;  4LF5 O;  3CP1 A;  4ZI7 A;  4HZ3 A;  4TV8 A;  2XAQ A;  4LNU B;  5LA6 A;  1R6N A;  3SPG A;  5L3F A;  3CCL V;  3ICX A;  2FB5 A;  3BAA A;  1KU9 A;  1PPJ H;  2ZIM A;  1VQK V;  5IYZ A;  1OZ0 A;  2BSK B;  3STL C;  2P7T C;  2XND G;  4JTD B;  4B3S O;  3CCU V;  4NYK A;  4PI0 A;  4DR3 O;  3MHH C;  2ZIN A;  3QF7 A;  3MAQ A;  4U3J A;  1NZ6 A;  2P4K A;  1I08 A;  3OTO O;  2QTO A;  5KA5 A;  3UO2 A;  1EZJ A;  1QHT A;  4UCV A;  1OCO C;  4LFA B;  3JAK B;  2RDC A;  3OUF A;  5D5Q A;  1N0N A;  1Z5W A;  5J2T B;  3J80 N;  2WLM A;  5BR8 O;  4CH5 A;  1AB3 A;  4O4J B;  4FVM A;  1M57 C;  1PL0 A;  5KAF Z;  3CXC U;  3K9A A;  5FPR A;  4GT1 A;  1B06 A;  3SYO A;  3SDL A;  2WLL B;  4QIW F;  1FPO A;  5F2V O;  2PI5 A;  1AI7 A;  2AHZ A;  4FMT A;  1BS3 A;  2YI9 A;  3K06 A;  3LDC A;  2F95 B;  2W0F C;  2PTM A;  5LMN B;  1TGO A;  1FXK A;  1SET A;  1FOU A;  2RNB A;  1FJG B;  4L87 A;  4B3S B;  4QE9 A;  3JAK A;  5C93 A;  3ZRS A;  4LF7 B;  3OM3 B;  2PYJ A;  1YCI A;  1HP8 A;  4J7J A;  4JF3 A;  1HDJ A;  4RUE A;  1XL6 A;  3IC7 A;  2Q0O C;  5JJJ B;  3CME V;  2DYR B;  5B3S C;  3T1Y O;  1BL8 A;  3OUS A;  2OCC B;  2X6B A;  1JA8 A;  4LC1 A;  2H8P C;  5IJ9 B;  3RWR D;  3AK2 A;  2Z5U A;  3RFR A;  4KFM A;  4U7O A;  4YJ2 B;  2VQF B;  5JVD A;  4X88 A;  2LW7 A;  1HR0 B;  1FFX A;  5EC1 C;  5JWP A;  1YXB A;  4FLT A;  4U3J B;  5HFL A;  4LF8 O;  4R50 A;  4BWA A;  2PY5 A;  1GTO A;  4OPA A;  5DEC A;  1THZ A;  2W6I G;  2V1D A;  1HNX O;  2WLN A;  2PYL A;  1NKD A;  4Q6G A;  2EZO A;  4LF7 O;  1K5Q A;  1RSO A;  3F5W C;  2RMK B;  4DV7 B;  5LXT A;  2FL4 A;  4MTF A;  4JI5 B;  2XUM A;  3ZHT A;  2ZXW C;  3EFF K;  2KSD A;  4WFB V;  3CHX A;  4GX1 A;  4HBN A;  3RT3 C;  1W2B U;  2WLL A;  2DYR C;  5B3S B;  5IJ9 A;  2DW4 A;  2WLI A;  4DW0 A;  5LGN A;  3MD0 A;  4EKW A;  4ABM A;  1CP9 A;  2QE7 G;  3CS5 A;  1OCO B;  2ZE6 A;  3CEI A;  1VF6 A;  4RO2 A;  4AQY O;  4HAM A;  2ZNI A;  2LW1 A;  1M5I A;  3JSN A;  4H0L B;  3BEH A;  3WB2 A;  2P22 C;  4UV9 A;  4NKG B;  3D3Q A;  2UXX A;  4OPH A;  4YHH O;  3U10 A;  3OEE G;  2OTJ V;  4DV5 O;  4DV0 B;  2XAG A;  4DV2 B;  1K8A W;  3HKD B;  4QPJ A;  5B1O A;  1KBH A;  1Y66 A;  3HKB B;  1VF6 C;  1GM9 A;  3AEI A;  1DF5 A;  2IJI A;  4G27 B;  3JAW A;  4OXS A;  3M99 B;  4DV3 O;  4PA3 A;  2QM4 A;  3L9D A;  3W7S A;  2N05 A;  3JCZ A;  1B04 A;  5EIB C;  1SZX A;  1K97 A;  4DR1 O;  1NJI W;  4W4K A;  5BZB A;  4F4L A;  1QNM A;  2N04 A;  2BOB C;  4YJ3 A;  2YIA A;  1R6T A;  1KC8 W;  2E5L B;  4LP8 A;  4LNU A;  1AJP A;  5J2U A;  2NN4 A;  5LHI A;  4IYI A;  4PDR A;  3CCE V;  4O2A A;  3SYC A;  4DV0 O;  4R7C A;  4GX5 A;  1XMQ O;  1HR0 O;  4JAS A;  4DRX B;  4UB6 Z;  3ABK C;  4HYO A;  4QPK A;  4ZBM A;  4AIL C;  4JYA B;  4LFC O;  2Q6A A;  5LOV B;  4FM2 A;  3AK1 A;  4JYY A;  1MNG A;  3L75 H;  2ITD C;  1Y76 A;  4IGG A;  2QKS A;  1VQM V;  5EC2 C;  4FFB B;  1VEW A;  3P32 A;  4OGQ B;  2E74 B;  2UU9 B;  3O65 A;  1ZUQ A;  1AIL A;  3AG4 C;  4X1I A;  2B1I A;  4G2K A;  3FAV A;  5GON B;  1N34 B;  1RPR A;  1J95 A;  3ASN C;  3QNE A;  3DGE A;  2KQX A;  2GBO A;  4A5U B;  4JAA A;  5CA1 A;  2DWE C;  2E5L O;  2PGG A;  5L3E A;  4IHJ A;  1WA8 B;  3SYA A;  1V54 C;  3FB5 C;  4RAI A;  3H1K H;  4I7Z B;  4L8J A;  4DV6 B;  4NXN B;  1EM1 A;  3A8T A;  4H37 A;  4GKJ O;  3L70 H;  4UCT A;  1N32 O;  3IFX A;  1SF9 A;  1WA8 A;  4DV3 B;  3E22 A;  2P90 A;  5CA0 A;  1F51 A;  2HKO A;  4X64 B;  3DTU B;  3FKS G;  4U7N A;  1RPO A;  2Q8V A;  5H5N A;  1E1Q G;  3G6B A;  3FYE B;  3JAR A;  5BY1 A;  1Q6I A;  2R9R B;  1BCC H;  2CDY A;  2Y0I A;  1XUQ A;  4X65 B;  1M57 B;  1FXK C;  2W6J G;  2KG7 A;  2CGN A;  4TV9 B;  3K03 A;  4LFB B;  4Q20 A;  4DK0 A;  1JQ0 A;  2JJ2 G;  3BCC H;  1Y6X A;  2HHH O;  3T4D A;  3K3W A;  1KB9 F;  2AZ0 A;  1SQF A;  1G8M A;  4LWS B;  1SRY A;  3EHB B;  3OMA B;  1Q90 D;  1R6K A;  2OIE A;  1N4C A;  3F7Y C;  1VQO V;  4DUY B;  1IBK B;  3AG7 A;  4RQF A;  1HNZ O;  1YTF B;  2UXD O;  2QGN A;  1WAZ A;  4B08 A;  4YJ3 B;  5BXZ A;  1GM7 A;  1FKA O;  1WN7 A;  3E83 A;  3U11 A;  4DR6 B;  4IIJ A;  3T1Y B;  3RYI B;  1NH2 D;  2HR3 A;  2AXT Z;  1ZL8 B;  1PNM A;  3TGU H;  1VF5 B;  4F6R A;  1NH2 B;  3HKE A;  5LGT A;  1OHH G;  1Y74 B;  1IBM O;  4X1Y B;  2HEP A;  2JK5 C;  2OYQ A;  1ZSP A;  2YI8 A;  1BSM A;  4TSF G;  3A0H Z;  4GX0 A;  4J9Z B;  3K5N A;  3HPL C;  2Q5Z A;  3OR6 C;  3N2K A;  4WF9 V;  4UVC A;  2UUC B;  4LF8 B;  3BVO A;  4X1K B;  4X66 B;  1MA1 A;  2ZR3 A;  4F6E A;  4IT5 A;  2PF4 E;  1E79 G;  5BMV A;  3ASO B;  4TT3 G;  2ZD9 A;  4U3F H;  5IJ0 B;  5BMV B;  1XNR B;  3ZRW B;  2Q7H A;  4DR6 O;  2OIG A;  1MZE A;  1PNL A;  1S76 D;  4JAV A;  1DF4 A;  2WSS G;  3ETE A;  1NS1 A;  5KHK A;  2GTA A;  2QM8 A;  2EUL A;  2Q68 A;  4G28 B;  2GV9 A;  2Q0A A;  5KA6 A;  3I56 V;  2AW9 A;  3L72 H;  4MVQ A;  4DV6 O;  2LP7 A;  2F23 A;  5A9G A;  2HG5 C;  3STZ C;  3SPH A;  2ZM6 O;  3JD0 A;  5CB4 A;  4FLZ A;  3SYQ A;  2A3Q A;  3RYF B;  1OJH A;  4DUY O;  3L73 H;  3W7X A;  5H2F Z;  1BT8 A;  4I0X B;  4E2L A;  4D6T H;  2EIM C;  3BPZ A;  3H9V A;  4LF6 O;  3SJB C;  3CJH A;  3FB8 C;  4WFA V;  4O4H B;  2H3O A;  4MW8 A;  3AG2 B;  3ZHQ A;  1W0J G;  4FJC C;  2P67 A;  3OTO B;  3L74 H;  5LA6 B;  2Q7G A;  1NR1 A;  1QLE B;  4MVZ A;  2JGD B;  2LO1 A;  2YIB D;  1B3Q A;  3JD1 A;  2EIN B;  3A0R A;  3ZMV A;  5LP6 A;  2ZR2 A;  1L8D A;  3CWB H;  4TV9 A;  1QVG U;  3JCU Z;  1AR4 A;  2NLJ C;  4YJ2 A;  4BIZ A;  3FB7 C;  1H8H G;  4JPR A;  3UM7 A;  4NXM B;  3OMI B;  4PDL A;  4UCU A;  4MW3 A;  3LDE A;  3M8A A;  1IDS A;  3K5O A;  4TQD A;  1AR5 A;  1V55 B;  1WP8 A;  2EZP A;  5JQG B;  5KX5 A;  1SQG A;  3X2Q B;  3UT5 A;  1H2L A;  4UCO A;  1XHZ A;  1X4T A;  2H94 A;  1IJG A;  3CRR A;  2ZDI A;  3ETD A;  3WG7 C;  3RVZ A;  3JAT B;  3JAL B;  1R3I C; 
#chains in the Genus database with same CATH homology
 1EN6 A;  1N0N A;  2ADP A;  1XDC A;  1IXB A;  3KKY A;  2AW9 A;  1N0J A;  1XIL A;  5A9G A;  1B06 A;  1P7G A;  1KKC A;  2QKC A;  1AVM A;  4YIO A;  2RCV A;  4E4E A;  1BS3 A;  3AK1 A;  4JYY A;  1MMM A;  1MNG A;  1BT8 A;  1JR9 A;  1PM9 A;  1XRE A;  3CEI A;  2CE4 A;  1GN6 A;  1Y67 A;  1WB8 A;  1VEW A;  2QKA A;  3C3S A;  1PL4 A;  1ZUQ A;  3C3T A;  1I0H A;  4JZ2 A;  1AP5 A;  1ZLZ A;  1JA8 A;  1GN2 A;  1MSD A;  3KDR A;  3AK2 A;  3K9S A;  1ZSP A;  4X9Q A;  4GUN A;  1BSM A;  1ZTE A;  3MDS A;  3LSU A;  3RN4 A;  1EM1 A;  1D5N A;  1LUV A;  3QVN A;  1LUW A;  3IC9 A;  1EN5 A;  2ADQ B;  4YIP A;  3BFR A;  1AR4 A;  1WB7 A;  5AG2 A;  1IX9 A;  4BR6 A;  1EN4 A;  1MA1 A;  3TJT A;  4F6E A;  3EVK A;  1GN4 A;  3AK3 A;  1SZX A;  3OT7 A;  1IDS A;  3DC5 A;  2GDS A;  1AR5 A;  4C7U A;  1VAR A;  1QNM A;  1AP6 A;  4FFK A;  2P4K A;  3DC6 A;  1I08 A;  1GN3 A;  2CDY A;  4JZG A;  1XUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...