1I0HA

Crystal structure of the e. coli manganese superoxide dismutase mutant y174f at 1.35 angstroms resolution.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIMGLDVWEHAYFLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE Y174F MUTANT
publication title Removing a hydrogen bond in the dimer interface of Escherichia coli manganese superoxide dismutase alters structure and reactivity.
pubmed doi rcsb
source organism Escherichia coli
total genus 77
structure length 205
sequence length 205
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2001-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1i0hA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1i0hA02
4F6EA 4C7UA 1JR9A 1LUVA 1AP6A 1GN3A 1N0JA 3DC5A 4FFKA 3AK1A 2QKAA 1KKCA 3C3TA 1I08A 4JYYA 1LUWA 3QVNA 2P4KA 1BS3A 2QKCA 1BT8A 3OT7A 2CDYA 1GN6A 1VEWA 1MA1A 1EM1A 3RN4A 4X9QA 3AK2A 4GUNA 1I0HA 1ZUQA 5A9GA 4JZGA 1IXBA 1EN5A 1IDSA 4BR6A 5AG2A 1AP5A 1MMMA 1JA8A 2RCVA 3DC6A 1IX9A 3LSUA 1N0NA 1XREA 1ZSPA 1AR4A 1PL4A 2AW9A 1XUQA 1WB7A 2CE4A 1MNGA 3KKYA 1WB8A 1GN2A 1ZLZA 3MDSA 1BSMA 1VARA 1AR5A 3CEIA 3K9SA 4YIOA 1PM9A 3C3SA 1D5NA 2ADPA 1QNMA 1EN4A 3BFRA 4YIPA 1P7GA 1SZXA 1EN6A 1AVMA 1XDCA 1ZTEA 2GDSA 3EVKA 1B06A 1Y67A 4E4EA 4JZ2A 1GN4A 3AK3A 1XILA 3IC9A 3TJTA 1MSDA 2ADQB
chains in the Genus database with same CATH superfamily
3ZIAG 4K8ZA 2CTPA 1G1XB 4FJCC 5EZYB 4GKJB 3RYHA 3ZBHA 1E1QG 2Y69C 3ABLB 1FD9A 1URFA 3CCEV 3RW0A 1WP8A 5TISZ 4JI5B 3RBZA 1JNBA 4QGPA 2Q7HA 5EIBD 2L6LA 4JV5B 2QE7G 3TGUH 1DGSA 1HNWB 4J11A 3U11A 4PELA 4E2LA 3IFXA 2WLLB 1ZL8A 1Q6IA 1YITV 2OTLV 1BQZA 3T1YB 3RYIA 1P7BA 4RUFA 1L0LH 4FPPA 1J95A 4ZI7A 5LOVA 3OEEG 2GUZB 4DRXA 2BSKA 1TUBB 3IGAC 1K5SA 3K0GA 3OW2U 4DV5O 1AP5A 2ZCEA 3AG7A 2BTQB 4UB6Z 2LGQA 5C8YB 4H0LB 4H33A 4WCEV 3HKDA 3IC7A 1O9HA 2HEPA 1SERA 1ENVA 1HW7A 1WB7A 1F7YA 2MW2B 4ZKIA 2LO1A 2DMXA 4UCSA 2NN4A 2EULA 5LBQA 3APQA 3ML0A 4PV1B 1LNQA 4GKJO 3OUSA 4CS2A 2A79B 1AJNA 4JI5O 1XMOB 4PA7A 1IVSA 1VQ9V 2ARHA 4MVUA 5LGTA 4JI1B 1R6NA 1M57B 4HYOA 4LH7A 4JV5O 3ZX6A 1WJZA 4O2AB 2ADQB 1V55C 3ABTA 1HNWO 3ABUA 3K06A 3AG3B 2ZR3A 4XDJA 4F6EA 2QA4V 4JI0B 1VQ4V 5A2QN 5B1OA 1SF9A 5H2FZ 4FMTA 4N21A 1GN3A 1TGOA 4U3FH 1HR0B 4RWUA 4K8XA 1XL4A 4NVPA 2RMKB 4JTDB 2LGWA 1K8AW 3CHXA 4GX5A 1R3JC 3JAMN 3ABMC 4UCTA 3FAVB 4KFMA 1XOUA 2XAFA 3JAWA 1JQ0A 3OGIB 3FFQA 2Z0AA 3AK2A 2EILB 3SGIA 4JI4O 3BAAA 3UO3A 3HR0A 4JTAB 1NKDA 2AHZA 3JAKB 2ITDC 5LMUB 2RCVA 4NTYA 5E1AC 3DC6A 1IX9A 4ZOLB 2CUGA 3LNNA 1XMOO 3RYCB 2DQ0A 4WFFA 1BCCH 4JI1O 4O4HA 3CRMA 5KX5B 5KUMA 1PNLA 1M56B 3WB1A 3CJHA 4JI0O 4UVBA 5KA6A 2JK5C 2YC0A 3HPLC 1FPOA 1VF7A 3H9VA 1NR1A 1P84F 2FKXA 1VQPV 2JEUA 3BCCH 1VQMV 3F5TA 2V7QG 4J10A 2UUBB 2Q9LA 2QDOA 5JH7A 2UXBB 1AB3A 4DK0A 1Q43A 3BY6A 4IHJA 2XAGA 4GKKB 4DR2O 2PTMA 1M4UA 1W2BU 4KL1A 3Q4HB 2HHHB 3CCJV 1V54C 3L74H 5KHKA 2E5LB 2YEVA 1H2LA 5L3EA 3AG1C 4B3MB 2WWWA 4DV1B 5K1XA 1GH6A 3QVNA 1M5IA 2NNUA 5LMUO 2JGDA 3OT7A 3K9AA 4NTXA 4CBCA 3HKCA 2P6JA 3CS5A 2RQ6A 1NQTA 2LP7A 3JALB 4FLXA 1KKDA 4X1IB 2LFSA 3SYOA 3S3XA 5IJ9B 2A0LA 1B3QA 4DR3B 3SYAA 2IH1C 1Y76A 5JJJB 3MD0A 5B1AC 4JYAB 1M9NA 5HFMA 1MZFA 4RQEA 4PA4A 4KHPB 3CE2A 1I5YA 3WFVA 1JX9A 4MVQA 2QJ1A 3VQYA 2UUBO 3N2KB 2LJ2A 2UXBO 4DRXB 5GONB 1US6A 4IGGA 4GKKO 1KQSU 3J7AU 2JIZG 1SZXA 4FFBA 3HKDB 2HHHO 4MTGA 3QO7A 2E5LO 3EVKA 2QWPB 3D36C 4B3MO 4DV1O 3AK3A 3BABA 1XILA 4UCUA 5CA1B 1MSDA 1WPXA 4O4IA 1FXHA 3SPGA 2ZE7A 3SR2C 1BL8A 1YIJV 2XUMA 2ZE8A 5EZYA 3AEIA 4LF6B 5LP6B 3K59A 1Q3EA 4H44B 1SQPH 4DR3O 2HFEC 2ZE5A 3ZHUA 1Q5OA 1M57C 1QCEA 1QU7A 1VQ7V 4X62B 4JYAO 2A9HA 2R72A 1S0VA 1XL6A 4IIJA 4IYIA 3AG3C 1GN6A 1H2GA 3SPCA 3FKSG 3RN4A 1TA8A 1YJNV 1YVWA 4GUNA 3TXQA 4PA9A 4D7TA 5GW7A 3ZS8C 2N05A 2JDIG 2B1IA 2X6CA 5LHIA 4HBNA 3N2GB 1XQ8A 1KB9F 2GUZA 1TUBA 1NH2B 2CTWA 2VWKA 5D5PA 1YTFD 4ASUG 4IT5A 2A7WA 3D36A 1P49A 2EILC 3JATB 4DUYO 1H5WA 2GV9A 4LP8A 4FLTA 3M7MX 1FFTB 1NTMH 3OE7G 1H8HG 4F4LA 2YICA 5BZBA 3JD1A 1X59A 2A06H 4PJ0Z 4LF6O 3DTUB 1W0JG 3BFRA 2QR4A 3JARB 1XDCA 4G27B 3OMIB 1SQQH 4H13B 3K5OA 4JZ2A 3LSSA 1F23A 3H1KH 5BY1A 2OYQA 3CJHB 1MOFA 1V55B 1NR7A 1DF5A 1M56C 4D6TH 2QM7A 4FLWA 3CC2V 1R3LC 5KLVH 2CAZC 1YI2V 3VQXA 1Q6HA 3JCZA 1BE3H 1AI5A 2R9RB 3G71V 1KKCA 1SA0B 2QGNA 4BWAA 1XNQB 4YJ2B 3LDCA 3ZRWA 4NTWA 1M90W 1M1KW 2N04A 4IHJB 1B6QA 1WAZA 1VEWA 3B09A 2Q69A 4CC5A 4JI7B 3FAVA 2QEXV 4X9QA 1S3JA 4QPKA 2EJRA 1Y66A 2UUCB 1COWG 3B8NA 3A0RA 1JJ2U 5DECA 2JGDB 4WFGA 5CN0A 1S76D 5AG2A 3AG4C 2UXCB 2A3QA 3A0HZ 1YHQV 3JAKA 3HKCB 2WPDG 3LDEA 2X6AA 4ZOLA 2GTSA 2KSDA 2NR5A 3H01A 2F1MA 4DR7B 3ZMZA 1ZLZA 5BMVB 1Y76B 1JCHA 5IWAB 2ETNA 3K9SA 2WLMA 4TQFA 5EBLC 1Z5WA 3ABKB 3E35A 5JWPA 4DUZB 4TV8A 1MSWD 1EN4A 4DR6B 2E75B 2QWNB 2HJFC 2P4VA 3L72H 5IT9N 2EZOA 5CBGA 4CH3A 4I0XB 1XNQO 3UQ8A 1H2MA 1VF6C 3JD0A 3OFNG 1PNMA 3B8MA 1L1FA 5B5EZ 1FS0G 1QR9A 1BQ0A 4JI7O 4FFKA 3SJCC 2DN9A 3CRRA 4Z2WA 2VRZA 2X6BA 4JI6B 3RFRA 2AXTZ 2UUCO 4MTFA 3TETA 1IXMA 2Y0IA 4FLVA 5BXZA 4BAYA 3G6EV 2UXCO 1VQOV 5J2TB 4QIWF 5H5NA 5H6RA 4NXMB 4BW9A 3W7TA 4J80A 1I94B 1JJOA 3ASOC 5LP6C 2FB5A 5EBWC 4QE7A 3JALA 4X1IA 4LCUC 2IU3A 1WLEA 1AR1B 4DR7O 2JEXA 4K3AA 4TSFG 2HLDG 5IJ9A 2LW7A 1RPRA 4ABMA 3VQVA 2ZM6B 4DV0O 2ZD9A 5B1AB 5J9PC 4IIJB 4DUZO 1N32O 1F4MA 3OAAG 4P2ZA 4GLXA 3ZJZA 2UU9B 3K3WA 4WBNB 4TUYA 4FM0A 3G67A 2CE4A 2FYUH 3N2KA 1GN2A 3MDSA 4FM2A 2UXDB 1VF6A 1AI4A 3CXHF 3K0DA 5GONA 5CBFA 1PM9A 3SYCA 4A5UB 1ROPA 1W59A 4MVOA 4I55A 2JVDA 4JAVA 3O9OA 1I7FA 2ZDIC 1UJWB 2ATKC 3H1HH 2ZQMA 4JI6O 5JCOC 4DV2B 2UUAO 5BR8B 3CB2A 3UO2A 1Y67A 2XASA 4E4EA 2EIKB 3W7UA 1B04A 5CA1A 1EZVH 1VQ6V 1R6KA 2FMLA 3ETEA 4NXMO 4D7SA 3BHPA 1KP2A 3PN1A 1I94O 4DW0A 4X88A 2EZPA 2DW4A 4JGSA 2ZT9B 1O9GA 4Q20A 2DYRB 2JJ1G 2YIDA 3OR6C 4IYHA 5LP6A 1FYJA 1RSOB 1YDXA 4TQDA 1AJPA 1NT2B 3CCQV 1LR1A 2X7RB 2ZM6O 4JI8B 1E79G 3E89A 4Q6GA 3LDDA 4MTOA 4I5SA 3J81N 2EIMB 3E83A 3JD3A 4OPAA 4XBFA 2XAHA 1HNZB 2UU9O 5FLXN 1QVGU 1ZX3A 2ZINA 3ZMSA 1KC8W 3T1YO 5L3DA 1JVMA 3ZMVA 3MHHC 2UXDO 1D2DA 2IJJA 2Q5ZA 3ZRWB 2P06A 2Q7EA 4KUMA 5LA6A 1DF4A 3N2GA 1K3EA 4P9OA 4PD4F 1KMIZ 1PL4A 2ZDIA 5JCOA 1SESA 3BVOA 3JATA 3A8TA 4PHZA 1CPYA 4YIOA 3EXAA 4EEQA 4KXRA 4MT8A 1EFRG 1QNMA 3LUTB 1GM7A 2UXNA 3RYFB 3KCYA 3JARA 3L9DA 1ZTEA 2QSAA 4WFBV 4R8CA 1Q90D 3M8AA 2YIBA 5KMGB 1A32A 2HG5C 2IJIA 4JI8O 2IM9A 3TJTA 1AROP 1OCRC 3R65A 3OMAB 2M7WA 2K9PA 4U3JB 1X4TA 4TV8B 3ABKC 5B1BB 2WLIB 3RGBA 1HR0O 2CTQA 2MK3A 5EIBC 4AILC 2HVJC 4CC6A 1K4CC 1SA0A 2CH7B 3K08A 1DLBA 4N23A 2WLKA 4YJ2A 1H2SB 1OCCB 4LFAB 1XEQA 1K9MW 4O2BB 2CDYA 5L3CA 2JS5A 1L8DA 1GMGA 2F93B 3JD4A 3CCVV 4AHCA 3E8FA 2YXLA 1Y74B 3P30A 1ZAUA 1NJIW 2VQFB 1IDSA 3CCRV 1KP3A 4PI0A 3AG4B 4B7EA 1OV9A 4UFZA 3K03A 3CRCA 1E1RG 2Q67A 3W7XA 4NXNB 3LSUA 1YXBA 3QF7A 5B3SB 1AR4A 5LL6Y 3LNMB 4CS4A 4JAUA 4RAIA 5IJ0B 1G4YB 1QR8A 2IBZH 3GWOA 4UCVA 5BMVA 3A2FA 1KBHA 4XDLA 5EK0A 2BOBC 1NBMG 3GVMA 4FLYA 1OZ0A 2ITCC 1VIBA 3ZHSA 2WLNA 4TUYB 2B1GA 1VMGA 1B06A 1WNSA 2OT5A 4JI3B 4QJFB 2GBOA 4I0XA 2QKSA 3QTCA 1TVKB 4TT3G 4WFHA 3J80N 3CCMV 4I55B 2ZIMA 4DK1A 2NLJC 5CA0B 3W7WA 2QKAA 4X89A 3I56V 2O57A 4RO2A 4Z1MG 5LXTB 3E8GA 2H3OA 3KCXA 2VQFO 1THZA 2EIKC 4P30A 1ZWIC 3OTOB 1PP9H 2VQEB 1YCIA 3ETQA 1BS3A 2R70A 2VS0A 1YTFB 1NS1A 2WSSG 3TCUA 4NXNO 4DO2A 5J2UA 5J2TA 5JVDA 3ASOB 3K58A 5CB4B 2DYRC 4LF4B 1SZTA 2Q4PA 2D3OW 2PUSA 3E22B 1EN5A 1ORQC 1Q6UA 5C93A 3SPIA 4TOIA 2F66C 4LC1A 2EIMC 4LFBB 2EINC 1XREA 2CK3G 4KHPO 3FB7C 3AG2B 1GAXA 4JI3O 4WBNA 1HP8A 1H38A 3DXRA 1BSMA 1H8EG 1VARA 2ZIOA 1WN7A 5LA6B 2LQTA 1HDJA 4I9WA 4YHHB 1CEZA 1EN6A 3UCSC 4EKWA 4AQYB 3FYEB 3CRAA 1GM9A 2WLHA 3CPWU 4UUJC 3CMAV 3BA8A 3TXSA 3OTOO 4J9ZB 2VQEO 2PI5A 2FL4A 1NVPB 5EC1C 2F4VB 1VP7A 2C2AA 2E74B 4TWKA 2YXYA 4UVAA 2M6YA 1IBLB 1AP6A 1N0JA 1S77D 3AK1A 1OJHA 3ZN1A 2WLJA 4LF4O 1KUQA 1RSOA 4W4LA 3A0BZ 3O65A 3C90A 1P4RA 4GYCB 3ZRSA 1YZBA 2QWOB 3IJ4A 2IU0A 2OIGA 2B9ZA 2V4DA 1R73A 4X62O 1R1BA 1BT8A 4OPHA 3THOA 1WA8B 3SJAC 2DYSC 2Y4TA 3VOUA 2XTAA 5LMNB 2XAJA 3APOA 5B1BC 4NKGB 5KAFZ 3G6BA 3JD2A 3FD9A 3BRCA 3ASNB 1I0HA 4JZGA 1PV0A 2GTAA 4J7ZA 4UB8Z 3ETDA 1N34B 5ITZB 5FPRA 5L3FA 1FAFA 2YDEA 1OCCC 4CH4A 4JASA 3QG5A 2JRIA 1WPBA 3OM3B 3ZRXA 4AQYO 1N36B 3ZHTA 2Y4UA 3VQWA 4RQFA 1OHHG 2XOKG 4MVMA 4O4LB 1S5JA 1WB8A 4JI2B 2R9IA 4J9YB 4PA6A 3CP1A 4HZ3A 4JTCB 4YXWG 5KUKA 2DWDC 1PD3A 2AZ0A 2RN9A 4X65B 3RYFA 1XHXA 5B3SC 1N33B 3WG7C 2Q0OC 3SJQC 4X20B 4FM1A 4UCRA 2OTJV 5DN6G 4O4JA 5KMGA 4FIPC 4R6ZA 1OCRB 1K97A 3JYCA 2Q73A 1JFFA 2QM4A 3B4SA 3KZIZ 3SJBC 3ICXA 3UM7A 1VQ8V 3OEHG 1U97A 5LMNO 4U3JA 4B08A 2AGAA 2CTRA 4R7CA 2Y0PA 4JYCA 3DC5A 3I55V 2WLIA 2KG7B 2OWOA 3CCSV 3ZN0A 3ZCCA 3RVYA 5IDJA 1MZEA 4JYYA 1F51A 1I5XA 1AILA 2CH7A 1QHTA 3QO8A 4LWSB 1PL0A 3W7SA 4WFEA 1FKAO 3ZHRA 4MVSA 3NXSA 4B3RB 4YY3B 2ZNIA 1N36O 2EX3A 4O2BA 1NZ6A 4Z1VA 5FNVB 1Y6XA 1OCZC 4LFCB 1PPJH 5KA5A 1RM1B 4HNAB 3DSQA 4JI2O 1Y74A 3B77A 1XBLA 2BE3A 2P90A 4PI2A 5J2UB 4DV5B 4QPJA 5JVDB 2YUAA 5KHIA 4X65O 3CWBH 4PDVA 2DWEC 4OX9B 3K5LA 1KU9A 3HKBB 5IJ0A 1SQGA 1J5EB 3ZHQA 1JPXA 2ILMA 1QQCA 5IWAO 5IY5B 3E86A 5CBHA 1FOUA 1IBMB 3C3SA 2E76B 1DK1A 3FX7A 4MVZA 4LBEC 3FB5C 4DR6O 2OIEA 4DV3B 2EIJB 5L3BA 4I4TA 1YEWA 3JSNA 3AG2C 3GB7C 5B1NA 1K33A 1NTKH 3DXRB 3T1HB 2PZSA 3OR7C 4GT1A 5KHGA 4UVCA 3E8HA 3T4ZA 1TVKA 1Q86W 1MABG 4I50B 2PYLA 4B3RO 4YY3O 1KECA 5EBMC 4LF5B 4K0KB 3TK1A 3ZMUA 4EB6B 3E8BA 4LFCO 3P3NA 5CA0A 1GO3F 2Q6AA 3MAQA 3U10A 4DV4B 4X1KB 5LXTA 3E2EA 3M99B 3UT5B 2ZXWC 4CS3A 4DR4B 1HWYA 4HAMA 4NB5A 3OGCC 5IYCO 4U7OA 2YS8A 3WB0A 2JGUA 3CXCU 3S3WA 4OX9O 1U96A 1NU1H 3ZHVA 5IE9A 2QM8A 1OCOC 5CB4A 1UPGA 2RNBA 1J5EO 4G28B 3HB3B 4ZBMA 1BZKA 4LH6A 4X1YB 3WU2Z 3CX5F 4JI4B 1YJ9V 2DQ3A 2XNDG 3B40A 3E22A 1IBKB 5CMUA 5H9CA 3P3PA 4DR5B 2IJHA 1IBMO 2HR3A 4B3TB 2HJDA 4JF3A 1H2NA 3RVZA 2EINB 4G2KA 4J7KA 4DV3O 4DR1B 2H8PC 2BCCH 3ZEDA 3N27A 2PI4A 3D3QA 3T1HO 5LHHA 3ASNC 1K92A 5K1PA 3EHBB 4TV9A 3H1JH 3P32A 3D3IA 4GZRB 3K04A 5LYJA 4LF5O 4K0KO 5IYZB 2X0LA 4MS2A 3SPHA 3I5DA 5KHJA 4DV4O 3L71H 3JASB 2XAQA 4DV2O 5BR8O 1GN4A 3IC9A 3G4SV 1RFYA 2HKOA 1VQ5V 4DR4O 4BIUA 2OCHA 3X2QC 2IH3C 4ZHQB 1K34A 2L35A 2QWQB 1LUVA 4DR2B 5B66Z 3H1IH 2W0XA 3CCLV 1FXKB 4MW3A 2V1DA 5GTIZ 1RPOA 4IL6Z 3CCUV 4O4JB 3STZC 3ZMTA 3D8CA 4CH5A 1IBKO 1JFFB 3CMEV 4DR5O 1BHBA 4B3TO 4F6RA 2DYSB 3T2MA 2Q0AA 2F23A 4DR1O 1HNZO 1WA8A 4WF9V 1G8MA 3R66A 1EM1A 3ZRVA 3T4DA 2YXHA 1JMKC 1FXVA 4AI8A 1GRJA 3FB8C 3QO5A 4LF8B 4UXNA 2P67A 2BTOA 5A9GA 4MTXA 3F5WC 5EYPB 3U0ZA 1VQLV 3CD6V 1FFXB 5ITZA 2E3CA 1XNRB 3JSLA 2GHYA 1S72V 4J41A 5LGNA 4K35A 1JA8A 1SC5B 1N0NA 2Q7GA 1FJGB 3HKEA 1RM1C 2VWJA 5JQGA 1MNGA 3GWKC 4O4LA 1Z5VA 3ETGA 1XI1A 3F7VC 1SQFA 3CEIA 1R3IC 4J7JA 3K79A 1QLEC 1D5NA 1RP3B 5F2VO 2ZE6A 3RT3C 4YJ3B 2AZ2A 4B3SB 4I9QA 2ZNJA 1AVMA 3WG7B 2P22C 4B7KA 4GCZA 5GTHZ 4X20A 4UV8A 1GM8A 2JJ2G 2Z3YA 4CH6A 2P7TC 2Q8VA 5IY5C 5FL7G 1VF5B 1JR9A 3IAYA 1GTOA 3RYHB 3B2EE 1EZJA 2CGNA 2KQXA 2UXXA 4UV9A 3KG2A 3ABLC 3NR7A 4I4TB 2IJKA 4LF8O 1QVFU 2EIJC 2KG7A 4J42A 3C3TA 1I08A 4CZZA 3T1CA 1K4DC 3JCUZ 4PDLA 5KHHA 1W0KG 4R50A 2R9AA 1PNKA 4LFAO 2F95B 2QKCA 1XNRO 2OCCB 4LWSA 1ZL8B 3K57A 3UKMA 1FJGO 1OCZB 2YI9A 4LR3A 4LNUA 1PKXA 5FNVA 4PDRA 3RYIB 3KDRA 1F4NA 4EFEA 4HNAA 4ZI7B 5LOVB 1GKFA 1BMFG 2BSKB 4BR6A 3FB6C 2ODMA 1IZ3A 4FLZA 4ZIBA 1V9PA 2RDCA 1XMQB 4B3SO 1TAEA 2G38A 4FZ0A 2KB1A 4RUEA 4WFAV 5H6QA 2QWRB 2F43G 1CP9A 3VBBA 1K5QA 2PGGA 3HKBA 4JYBA 1T5EA 5JJEB 2AW9A 2BOCC 2QTOA 1Q8IA 4DUYB 4ICGA 3KKYA 3CC4V 2W6IG 1AR5A 1R6TA 1HNXB 2XHBA 2PY5A 4DV6B 5DEDA 3FYIB 2Y69B 4OGQB 4X8AA 5IYDO 1S5HC 2DJVA 4NR1A 5HFLA 4DXWA 2P5OA 4JAAA 1G6UA 4XDKA 1XHZA 5E79Z 4QE9A 2YIAA 5LGUA 4TV9B 4MSWC 3OUFA 1N4CA 2XT9A 5LYJB 2YI8A 3DGEA 1IJGA 1WP7A 4I50A 4W4KA 2Q68A 3BEHA 2WLLA 3K5MA 3L73H 3SPJA 3CYOA 3WB2A 2ZKOA 4EB6A 1AJQA 1SQBH 5EC2C 2HP8A 1IURA 5LHGA 1Z2GA 3K5NA 4QNHB 4X1KA 2ZXWB 4P9PA 1K7DA 3UT5A 1NI8A 1XMQO 1Q81W 1VQKV 2W6JG 4BIZA 1MA1A 2BTQA 3F7YC 3JAWB 4MW8A 2CGOA 5C8YA 1MG1A 3L70H 1FXKC 1OCOB 4FK5C 1NTZH 4LF9B 1ZUQA 4X1YA 4U7NA 1HNXO 2EJ7A 1Q82W 2KKWA 3OMNB 1YJWV 4LF7B 4FVMA 2FTKA 2W0FC 5DM6V 4F6RB 4DV6O 4X66B 4UCOA 3STLC 4GX1A 1SETA 2WAMA 4LFBO 1M93A 2JS3A 3LSQA 3PJSK 1ZSPA 3OD4A 4NYKA 1D5AA 1N8RW 4O4HB 1GK9A 5KAIZ 4X64B 2ZR2A 3SDLA 3CRQA 1BGYH 4O2AA 1TUEB 2ADPA 1SQXH 2D2CB 5IYZA 4YHHO 2HVKC 1R3KC 4YIPA 1P7GA 4MVRA 3HKEB 2YSUB 1NH2D 3JASA 1JOYA 4FZ1A 5JH7B 5JQGB 4DV7B 1KD1W 1AI6A 4PA3A 2WA3A 2DE0X 3X2QB 4DYLA 1YSCA 3ABMB 2F4VO 1KYOF 1SRYA 4C7UA 4ZHQA 1UFIA 1IBLO 1NVPD 1Q7YW 5D5QA 4GX0A 1FXKA 4LF9O 2YEVB 4BIOA 2B5UA 3BA9A 4BW5A 2LFRA 2RJZA 4H37A 2GSMB 2IW5A 5IYBO 4I7ZB 1LUWA 4LF7O 3CSXA 2YIBD 4GX2A 2P4KA 1SQVH 4X66O 2PF4E 2H94A 4PDMA 3RWRD 3RYCA 2N74A 1BHAA 4X64O 5L3GA 1H2KA 5KX5A 1IXBA 1N34O 5EYPA 3CC7V 3SYQA 4DV0B 1FFXA 2AHYA 3SYPA 5CA3A 1CXZB 2QTSA 2OCCC 2WA4A 1N32B 1MMMA 2EBOA 4KP4A 3MHSC 2DOSA 1DTOA 3G80A 4DW1A 4LNUB 1AI7A 4L8JA 4L87A 1Y4MA 3L75H 1SKVA 4DV7O 1XUQA 1QLNA 4EFBA 5JJNB 1EBOA 5FPOA 3H1LH 2Y48A 3EFFK 1YF2A 1QLEB 1S5LZ 4OXSA 3QNEA 3BPZA 4FFBB 4YJ3A 3Q4HA 2Z5UA 1V54B 1N33O 2GDSA 1SS3A 3AG1B 2UUAB 3OTFA 2K1EA 1L0NH 4JPRA 4O4IB 1QBZA 1VQNV 1K73W 4FLUA 2PYJA 2LW1A
chains in the Genus database with same CATH topology
4F6EA 4C7UA 1JR9A 1LUVA 1AP6A 1GN3A 1N0JA 3DC5A 4FFKA 3AK1A 2QKAA 1KKCA 3C3TA 1I08A 4JYYA 1LUWA 3QVNA 2P4KA 1BS3A 2QKCA 1BT8A 3OT7A 2CDYA 1GN6A 1VEWA 1MA1A 1EM1A 3RN4A 4X9QA 3AK2A 4GUNA 3KDRA 1I0HA 1ZUQA 5A9GA 4JZGA 1IXBA 1EN5A 1IDSA 4BR6A 5AG2A 1AP5A 1MMMA 1JA8A 2RCVA 3DC6A 1IX9A 3LSUA 1N0NA 1XREA 1ZSPA 1AR4A 1PL4A 2AW9A 1XUQA 1WB7A 2CE4A 1MNGA 3KKYA 1WB8A 1GN2A 1ZLZA 3MDSA 1BSMA 1VARA 1AR5A 3CEIA 3K9SA 4YIOA 1PM9A 3C3SA 1D5NA 2ADPA 1QNMA 1EN4A 3BFRA 4YIPA 1P7GA 1SZXA 1EN6A 1AVMA 1XDCA 1ZTEA 2GDSA 3EVKA 1B06A 1Y67A 4E4EA 4JZ2A 1GN4A 3AK3A 1XILA 3IC9A 3TJTA 1MSDA 2ADQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F6E A;  4C7U A;  1JR9 A;  1LUV A;  1AP6 A;  1GN3 A;  1N0J A;  3DC5 A;  4FFK A;  3AK1 A;  2QKA A;  1KKC A;  3C3T A;  1I08 A;  4JYY A;  1LUW A;  3QVN A;  2P4K A;  1BS3 A;  2QKC A;  1BT8 A;  3OT7 A;  2CDY A;  1GN6 A;  1VEW A;  1MA1 A;  1EM1 A;  3RN4 A;  4X9Q A;  3AK2 A;  4GUN A;  1I0H A;  1ZUQ A;  5A9G A;  4JZG A;  1IXB A;  1EN5 A;  1IDS A;  4BR6 A;  5AG2 A;  1AP5 A;  1MMM A;  1JA8 A;  2RCV A;  3DC6 A;  1IX9 A;  3LSU A;  1N0N A;  1XRE A;  1ZSP A;  1AR4 A;  1PL4 A;  2AW9 A;  1XUQ A;  1WB7 A;  2CE4 A;  1MNG A;  3KKY A;  1WB8 A;  1GN2 A;  1ZLZ A;  3MDS A;  1BSM A;  1VAR A;  1AR5 A;  3CEI A;  3K9S A;  4YIO A;  1PM9 A;  3C3S A;  1D5N A;  2ADP A;  1QNM A;  1EN4 A;  3BFR A;  4YIP A;  1P7G A;  1SZX A;  1EN6 A;  1AVM A;  1XDC A;  1ZTE A;  2GDS A;  3EVK A;  1B06 A;  1Y67 A;  4E4E A;  4JZ2 A;  1GN4 A;  3AK3 A;  1XIL A;  3IC9 A;  3TJT A;  1MSD A;  2ADQ B; 
#chains in the Genus database with same CATH topology
 3ZIA G;  4K8Z A;  2CTP A;  1G1X B;  4FJC C;  5EZY B;  4GKJ B;  3RYH A;  3ZBH A;  1E1Q G;  2Y69 C;  3ABL B;  1FD9 A;  1URF A;  3CCE V;  3RW0 A;  1WP8 A;  5TIS Z;  4JI5 B;  3RBZ A;  1JNB A;  4QGP A;  2Q7H A;  5EIB D;  2L6L A;  4JV5 B;  2QE7 G;  3TGU H;  1DGS A;  1HNW B;  4J11 A;  3U11 A;  4PEL A;  4E2L A;  3IFX A;  2WLL B;  1ZL8 A;  1Q6I A;  1YIT V;  2OTL V;  1BQZ A;  3T1Y B;  3RYI A;  1P7B A;  4RUF A;  1L0L H;  4FPP A;  1J95 A;  4ZI7 A;  5LOV A;  3OEE G;  2GUZ B;  4DRX A;  2BSK A;  1TUB B;  3IGA C;  1K5S A;  3K0G A;  3OW2 U;  4DV5 O;  1AP5 A;  2ZCE A;  3AG7 A;  2BTQ B;  4UB6 Z;  2LGQ A;  5C8Y B;  4H0L B;  4H33 A;  4WCE V;  3HKD A;  3IC7 A;  1O9H A;  2HEP A;  1SER A;  1ENV A;  1HW7 A;  1WB7 A;  1F7Y A;  2MW2 B;  4ZKI A;  2LO1 A;  2DMX A;  4UCS A;  2NN4 A;  2EUL A;  5LBQ A;  3APQ A;  3ML0 A;  4PV1 B;  1LNQ A;  4GKJ O;  3OUS A;  4CS2 A;  2A79 B;  1AJN A;  4JI5 O;  1XMO B;  4PA7 A;  1IVS A;  1VQ9 V;  2ARH A;  4MVU A;  5LGT A;  4JI1 B;  1R6N A;  1M57 B;  4HYO A;  4LH7 A;  4JV5 O;  3ZX6 A;  1WJZ A;  4O2A B;  2ADQ B;  1V55 C;  3ABT A;  1HNW O;  3ABU A;  3K06 A;  3AG3 B;  2ZR3 A;  4XDJ A;  4F6E A;  2QA4 V;  4JI0 B;  1VQ4 V;  5A2Q N;  5B1O A;  1SF9 A;  5H2F Z;  4FMT A;  4N21 A;  1GN3 A;  1TGO A;  4U3F H;  1HR0 B;  4RWU A;  4K8X A;  1XL4 A;  4NVP A;  2RMK B;  4JTD B;  2LGW A;  1K8A W;  3CHX A;  4GX5 A;  1R3J C;  3JAM N;  3ABM C;  4UCT A;  3FAV B;  4KFM A;  1XOU A;  2XAF A;  3JAW A;  1JQ0 A;  3OGI B;  3FFQ A;  2Z0A A;  3AK2 A;  2EIL B;  3SGI A;  4JI4 O;  3BAA A;  3UO3 A;  3HR0 A;  4JTA B;  1NKD A;  2AHZ A;  3JAK B;  2ITD C;  5LMU B;  2RCV A;  4NTY A;  5E1A C;  3DC6 A;  1IX9 A;  4ZOL B;  2CUG A;  3LNN A;  1XMO O;  3RYC B;  2DQ0 A;  4WFF A;  1BCC H;  4JI1 O;  4O4H A;  3CRM A;  5KX5 B;  5KUM A;  1PNL A;  1M56 B;  3WB1 A;  3CJH A;  4JI0 O;  4UVB A;  5KA6 A;  2JK5 C;  2YC0 A;  3HPL C;  1FPO A;  1VF7 A;  3H9V A;  1NR1 A;  1P84 F;  2FKX A;  1VQP V;  2JEU A;  3BCC H;  1VQM V;  3F5T A;  2V7Q G;  4J10 A;  2UUB B;  2Q9L A;  2QDO A;  5JH7 A;  2UXB B;  1AB3 A;  4DK0 A;  1Q43 A;  3BY6 A;  4IHJ A;  2XAG A;  4GKK B;  4DR2 O;  2PTM A;  1M4U A;  1W2B U;  4KL1 A;  3Q4H B;  2HHH B;  3CCJ V;  1V54 C;  3L74 H;  5KHK A;  2E5L B;  2YEV A;  1H2L A;  5L3E A;  3AG1 C;  4B3M B;  2WWW A;  4DV1 B;  5K1X A;  1GH6 A;  3QVN A;  1M5I A;  2NNU A;  5LMU O;  2JGD A;  3OT7 A;  3K9A A;  4NTX A;  4CBC A;  3HKC A;  2P6J A;  3CS5 A;  2RQ6 A;  1NQT A;  2LP7 A;  3JAL B;  4FLX A;  1KKD A;  4X1I B;  2LFS A;  3SYO A;  3S3X A;  5IJ9 B;  2A0L A;  1B3Q A;  4DR3 B;  3SYA A;  2IH1 C;  1Y76 A;  5JJJ B;  3MD0 A;  5B1A C;  4JYA B;  1M9N A;  5HFM A;  1MZF A;  4RQE A;  4PA4 A;  4KHP B;  3CE2 A;  1I5Y A;  3WFV A;  1JX9 A;  4MVQ A;  2QJ1 A;  3VQY A;  2UUB O;  3N2K B;  2LJ2 A;  2UXB O;  4DRX B;  5GON B;  1US6 A;  4IGG A;  4GKK O;  1KQS U;  3J7A U;  2JIZ G;  1SZX A;  4FFB A;  3HKD B;  2HHH O;  4MTG A;  3QO7 A;  2E5L O;  3EVK A;  2QWP B;  3D36 C;  4B3M O;  4DV1 O;  3AK3 A;  3BAB A;  1XIL A;  4UCU A;  5CA1 B;  1MSD A;  1WPX A;  4O4I A;  1FXH A;  3SPG A;  2ZE7 A;  3SR2 C;  1BL8 A;  1YIJ V;  2XUM A;  2ZE8 A;  5EZY A;  3AEI A;  4LF6 B;  5LP6 B;  3K59 A;  1Q3E A;  4H44 B;  1SQP H;  4DR3 O;  2HFE C;  2ZE5 A;  3ZHU A;  1Q5O A;  1M57 C;  1QCE A;  1QU7 A;  1VQ7 V;  4X62 B;  4JYA O;  2A9H A;  2R72 A;  1S0V A;  1XL6 A;  4IIJ A;  4IYI A;  3AG3 C;  1GN6 A;  1H2G A;  3SPC A;  3FKS G;  3RN4 A;  1TA8 A;  1YJN V;  1YVW A;  4GUN A;  3TXQ A;  4PA9 A;  4D7T A;  5GW7 A;  3ZS8 C;  2N05 A;  2JDI G;  2B1I A;  2X6C A;  5LHI A;  4HBN A;  3N2G B;  1XQ8 A;  1KB9 F;  2GUZ A;  1TUB A;  1NH2 B;  2CTW A;  2VWK A;  5D5P A;  1YTF D;  4ASU G;  4IT5 A;  2A7W A;  3D36 A;  1P49 A;  2EIL C;  3JAT B;  4DUY O;  1H5W A;  2GV9 A;  4LP8 A;  4FLT A;  3M7M X;  1FFT B;  1NTM H;  3OE7 G;  1H8H G;  4F4L A;  2YIC A;  5BZB A;  3JD1 A;  1X59 A;  2A06 H;  4PJ0 Z;  4LF6 O;  3DTU B;  1W0J G;  3BFR A;  2QR4 A;  3JAR B;  1XDC A;  4G27 B;  3OMI B;  1SQQ H;  4H13 B;  3K5O A;  4JZ2 A;  3LSS A;  1F23 A;  3H1K H;  5BY1 A;  2OYQ A;  3CJH B;  1MOF A;  1V55 B;  1NR7 A;  1DF5 A;  1M56 C;  4D6T H;  2QM7 A;  4FLW A;  3CC2 V;  1R3L C;  5KLV H;  2CAZ C;  1YI2 V;  3VQX A;  1Q6H A;  3JCZ A;  1BE3 H;  1AI5 A;  2R9R B;  3G71 V;  1KKC A;  1SA0 B;  2QGN A;  4BWA A;  1XNQ B;  4YJ2 B;  3LDC A;  3ZRW A;  4NTW A;  1M90 W;  1M1K W;  2N04 A;  4IHJ B;  1B6Q A;  1WAZ A;  1VEW A;  3B09 A;  2Q69 A;  4CC5 A;  4JI7 B;  3FAV A;  2QEX V;  4X9Q A;  1S3J A;  4QPK A;  2EJR A;  1Y66 A;  2UUC B;  1COW G;  3B8N A;  3A0R A;  1JJ2 U;  5DEC A;  2JGD B;  4WFG A;  5CN0 A;  1S76 D;  5AG2 A;  3AG4 C;  2UXC B;  2A3Q A;  3A0H Z;  1YHQ V;  3JAK A;  3HKC B;  2WPD G;  3LDE A;  2X6A A;  4ZOL A;  2GTS A;  2KSD A;  2NR5 A;  3H01 A;  2F1M A;  4DR7 B;  3ZMZ A;  1ZLZ A;  5BMV B;  1Y76 B;  1JCH A;  5IWA B;  2ETN A;  3K9S A;  2WLM A;  4TQF A;  5EBL C;  1Z5W A;  3ABK B;  3E35 A;  5JWP A;  4DUZ B;  4TV8 A;  1MSW D;  1EN4 A;  4DR6 B;  2E75 B;  2QWN B;  2HJF C;  2P4V A;  3L72 H;  5IT9 N;  2EZO A;  5CBG A;  4CH3 A;  4I0X B;  1XNQ O;  3UQ8 A;  1H2M A;  1VF6 C;  3JD0 A;  3OFN G;  1PNM A;  3B8M A;  1L1F A;  5B5E Z;  1FS0 G;  1QR9 A;  1BQ0 A;  4JI7 O;  4FFK A;  3SJC C;  2DN9 A;  3CRR A;  4Z2W A;  2VRZ A;  2X6B A;  4JI6 B;  3RFR A;  2AXT Z;  2UUC O;  4MTF A;  3TET A;  1IXM A;  2Y0I A;  4FLV A;  5BXZ A;  4BAY A;  3G6E V;  2UXC O;  1VQO V;  5J2T B;  4QIW F;  5H5N A;  5H6R A;  4NXM B;  4BW9 A;  3W7T A;  4J80 A;  1I94 B;  1JJO A;  3ASO C;  5LP6 C;  2FB5 A;  5EBW C;  4QE7 A;  3JAL A;  4X1I A;  4LCU C;  2IU3 A;  1WLE A;  1AR1 B;  4DR7 O;  2JEX A;  4K3A A;  4TSF G;  2HLD G;  5IJ9 A;  2LW7 A;  1RPR A;  4ABM A;  3VQV A;  2ZM6 B;  4DV0 O;  2ZD9 A;  5B1A B;  5J9P C;  4IIJ B;  4DUZ O;  1N32 O;  1F4M A;  3OAA G;  4P2Z A;  4GLX A;  3ZJZ A;  2UU9 B;  3K3W A;  4WBN B;  4TUY A;  4FM0 A;  3G67 A;  2CE4 A;  2FYU H;  3N2K A;  1GN2 A;  3MDS A;  4FM2 A;  2UXD B;  1VF6 A;  1AI4 A;  3CXH F;  3K0D A;  5GON A;  5CBF A;  1PM9 A;  3SYC A;  4A5U B;  1ROP A;  1W59 A;  4MVO A;  4I55 A;  2JVD A;  4JAV A;  3O9O A;  1I7F A;  2ZDI C;  1UJW B;  2ATK C;  3H1H H;  2ZQM A;  4JI6 O;  5JCO C;  4DV2 B;  2UUA O;  5BR8 B;  3CB2 A;  3UO2 A;  1Y67 A;  2XAS A;  4E4E A;  2EIK B;  3W7U A;  1B04 A;  5CA1 A;  1EZV H;  1VQ6 V;  1R6K A;  2FML A;  3ETE A;  4NXM O;  4D7S A;  3BHP A;  1KP2 A;  3PN1 A;  1I94 O;  4DW0 A;  4X88 A;  2EZP A;  2DW4 A;  4JGS A;  2ZT9 B;  1O9G A;  4Q20 A;  2DYR B;  2JJ1 G;  2YID A;  3OR6 C;  4IYH A;  5LP6 A;  1FYJ A;  1RSO B;  1YDX A;  4TQD A;  1AJP A;  1NT2 B;  3CCQ V;  1LR1 A;  2X7R B;  2ZM6 O;  4JI8 B;  1E79 G;  3E89 A;  4Q6G A;  3LDD A;  4MTO A;  4I5S A;  3J81 N;  2EIM B;  3E83 A;  3JD3 A;  4OPA A;  4XBF A;  2XAH A;  1HNZ B;  2UU9 O;  5FLX N;  1QVG U;  1ZX3 A;  2ZIN A;  3ZMS A;  1KC8 W;  3T1Y O;  5L3D A;  1JVM A;  3ZMV A;  3MHH C;  2UXD O;  1D2D A;  2IJJ A;  2Q5Z A;  3ZRW B;  2P06 A;  2Q7E A;  4KUM A;  5LA6 A;  1DF4 A;  3N2G A;  1K3E A;  4P9O A;  4PD4 F;  1KMI Z;  1PL4 A;  2ZDI A;  5JCO A;  1SES A;  3BVO A;  3JAT A;  3A8T A;  4PHZ A;  1CPY A;  4YIO A;  3EXA A;  4EEQ A;  4KXR A;  4MT8 A;  1EFR G;  1QNM A;  3LUT B;  1GM7 A;  2UXN A;  3RYF B;  3KCY A;  3JAR A;  3L9D A;  1ZTE A;  2QSA A;  4WFB V;  4R8C A;  1Q90 D;  3M8A A;  2YIB A;  5KMG B;  1A32 A;  2HG5 C;  2IJI A;  4JI8 O;  2IM9 A;  3TJT A;  1ARO P;  1OCR C;  3R65 A;  3OMA B;  2M7W A;  2K9P A;  4U3J B;  1X4T A;  4TV8 B;  3ABK C;  5B1B B;  2WLI B;  3RGB A;  1HR0 O;  2CTQ A;  2MK3 A;  5EIB C;  4AIL C;  2HVJ C;  4CC6 A;  1K4C C;  1SA0 A;  2CH7 B;  3K08 A;  1DLB A;  4N23 A;  2WLK A;  4YJ2 A;  1H2S B;  1OCC B;  4LFA B;  1XEQ A;  1K9M W;  4O2B B;  2CDY A;  5L3C A;  2JS5 A;  1L8D A;  1GMG A;  2F93 B;  3JD4 A;  3CCV V;  4AHC A;  3E8F A;  2YXL A;  1Y74 B;  3P30 A;  1ZAU A;  1NJI W;  2VQF B;  1IDS A;  3CCR V;  1KP3 A;  4PI0 A;  3AG4 B;  4B7E A;  1OV9 A;  4UFZ A;  3K03 A;  3CRC A;  1E1R G;  2Q67 A;  3W7X A;  4NXN B;  3LSU A;  1YXB A;  3QF7 A;  5B3S B;  1AR4 A;  5LL6 Y;  3LNM B;  4CS4 A;  4JAU A;  4RAI A;  5IJ0 B;  1G4Y B;  1QR8 A;  2IBZ H;  3GWO A;  4UCV A;  5BMV A;  3A2F A;  1KBH A;  4XDL A;  5EK0 A;  2BOB C;  1NBM G;  3GVM A;  4FLY A;  1OZ0 A;  2ITC C;  1VIB A;  3ZHS A;  2WLN A;  4TUY B;  2B1G A;  1VMG A;  1B06 A;  1WNS A;  2OT5 A;  4JI3 B;  4QJF B;  2GBO A;  4I0X A;  2QKS A;  3QTC A;  1TVK B;  4TT3 G;  4WFH A;  3J80 N;  3CCM V;  4I55 B;  2ZIM A;  4DK1 A;  2NLJ C;  5CA0 B;  3W7W A;  2QKA A;  4X89 A;  3I56 V;  2O57 A;  4RO2 A;  4Z1M G;  5LXT B;  3E8G A;  2H3O A;  3KCX A;  2VQF O;  1THZ A;  2EIK C;  4P30 A;  1ZWI C;  3OTO B;  1PP9 H;  2VQE B;  1YCI A;  3ETQ A;  1BS3 A;  2R70 A;  2VS0 A;  1YTF B;  1NS1 A;  2WSS G;  3TCU A;  4NXN O;  4DO2 A;  5J2U A;  5J2T A;  5JVD A;  3ASO B;  3K58 A;  5CB4 B;  2DYR C;  4LF4 B;  1SZT A;  2Q4P A;  2D3O W;  2PUS A;  3E22 B;  1EN5 A;  1ORQ C;  1Q6U A;  5C93 A;  3SPI A;  4TOI A;  2F66 C;  4LC1 A;  2EIM C;  4LFB B;  2EIN C;  1XRE A;  2CK3 G;  4KHP O;  3FB7 C;  3AG2 B;  1GAX A;  4JI3 O;  4WBN A;  1HP8 A;  1H38 A;  3DXR A;  1BSM A;  1H8E G;  1VAR A;  2ZIO A;  1WN7 A;  5LA6 B;  2LQT A;  1HDJ A;  4I9W A;  4YHH B;  1CEZ A;  1EN6 A;  3UCS C;  4EKW A;  4AQY B;  3FYE B;  3CRA A;  1GM9 A;  2WLH A;  3CPW U;  4UUJ C;  3CMA V;  3BA8 A;  3TXS A;  3OTO O;  4J9Z B;  2VQE O;  2PI5 A;  2FL4 A;  1NVP B;  5EC1 C;  2F4V B;  1VP7 A;  2C2A A;  2E74 B;  4TWK A;  2YXY A;  4UVA A;  2M6Y A;  1IBL B;  1AP6 A;  1N0J A;  1S77 D;  3AK1 A;  1OJH A;  3ZN1 A;  2WLJ A;  4LF4 O;  1KUQ A;  1RSO A;  4W4L A;  3A0B Z;  3O65 A;  3C90 A;  1P4R A;  4GYC B;  3ZRS A;  1YZB A;  2QWO B;  3IJ4 A;  2IU0 A;  2OIG A;  2B9Z A;  2V4D A;  1R73 A;  4X62 O;  1R1B A;  1BT8 A;  4OPH A;  3THO A;  1WA8 B;  3SJA C;  2DYS C;  2Y4T A;  3VOU A;  2XTA A;  5LMN B;  2XAJ A;  3APO A;  5B1B C;  4NKG B;  5KAF Z;  3G6B A;  3JD2 A;  3FD9 A;  3BRC A;  3ASN B;  1I0H A;  4JZG A;  1PV0 A;  2GTA A;  4J7Z A;  4UB8 Z;  3ETD A;  1N34 B;  5ITZ B;  5FPR A;  5L3F A;  1FAF A;  2YDE A;  1OCC C;  4CH4 A;  4JAS A;  3QG5 A;  2JRI A;  1WPB A;  3OM3 B;  3ZRX A;  4AQY O;  1N36 B;  3ZHT A;  2Y4U A;  3VQW A;  4RQF A;  1OHH G;  2XOK G;  4MVM A;  4O4L B;  1S5J A;  1WB8 A;  4JI2 B;  2R9I A;  4J9Y B;  4PA6 A;  3CP1 A;  4HZ3 A;  4JTC B;  4YXW G;  5KUK A;  2DWD C;  1PD3 A;  2AZ0 A;  2RN9 A;  4X65 B;  3RYF A;  1XHX A;  5B3S C;  1N33 B;  3WG7 C;  2Q0O C;  3SJQ C;  4X20 B;  4FM1 A;  4UCR A;  2OTJ V;  5DN6 G;  4O4J A;  5KMG A;  4FIP C;  4R6Z A;  1OCR B;  1K97 A;  3JYC A;  2Q73 A;  1JFF A;  2QM4 A;  3B4S A;  3KZI Z;  3SJB C;  3ICX A;  3UM7 A;  1VQ8 V;  3OEH G;  1U97 A;  5LMN O;  4U3J A;  4B08 A;  2AGA A;  2CTR A;  4R7C A;  2Y0P A;  4JYC A;  3DC5 A;  3I55 V;  2WLI A;  2KG7 B;  2OWO A;  3CCS V;  3ZN0 A;  3ZCC A;  3RVY A;  5IDJ A;  1MZE A;  4JYY A;  1F51 A;  1I5X A;  1AIL A;  2CH7 A;  1QHT A;  3QO8 A;  4LWS B;  1PL0 A;  3W7S A;  4WFE A;  1FKA O;  3ZHR A;  4MVS A;  3NXS A;  4B3R B;  4YY3 B;  2ZNI A;  1N36 O;  2EX3 A;  4O2B A;  1NZ6 A;  4Z1V A;  5FNV B;  1Y6X A;  1OCZ C;  4LFC B;  1PPJ H;  5KA5 A;  1RM1 B;  4HNA B;  3DSQ A;  4JI2 O;  1Y74 A;  3B77 A;  1XBL A;  2BE3 A;  2P90 A;  4PI2 A;  5J2U B;  4DV5 B;  4QPJ A;  5JVD B;  2YUA A;  5KHI A;  4X65 O;  3CWB H;  4PDV A;  2DWE C;  4OX9 B;  3K5L A;  1KU9 A;  3HKB B;  5IJ0 A;  1SQG A;  1J5E B;  3ZHQ A;  1JPX A;  2ILM A;  1QQC A;  5IWA O;  5IY5 B;  3E86 A;  5CBH A;  1FOU A;  1IBM B;  3C3S A;  2E76 B;  1DK1 A;  3FX7 A;  4MVZ A;  4LBE C;  3FB5 C;  4DR6 O;  2OIE A;  4DV3 B;  2EIJ B;  5L3B A;  4I4T A;  1YEW A;  3JSN A;  3AG2 C;  3GB7 C;  5B1N A;  1K33 A;  1NTK H;  3DXR B;  3T1H B;  2PZS A;  3OR7 C;  4GT1 A;  5KHG A;  4UVC A;  3E8H A;  3T4Z A;  1TVK A;  1Q86 W;  1MAB G;  4I50 B;  2PYL A;  4B3R O;  4YY3 O;  1KEC A;  5EBM C;  4LF5 B;  4K0K B;  3TK1 A;  3ZMU A;  4EB6 B;  3E8B A;  4LFC O;  3P3N A;  5CA0 A;  1GO3 F;  2Q6A A;  3MAQ A;  3U10 A;  4DV4 B;  4X1K B;  5LXT A;  3E2E A;  3M99 B;  3UT5 B;  2ZXW C;  4CS3 A;  4DR4 B;  1HWY A;  4HAM A;  4NB5 A;  3OGC C;  5IYC O;  4U7O A;  2YS8 A;  3WB0 A;  2JGU A;  3CXC U;  3S3W A;  4OX9 O;  1U96 A;  1NU1 H;  3ZHV A;  5IE9 A;  2QM8 A;  1OCO C;  5CB4 A;  1UPG A;  2RNB A;  1J5E O;  4G28 B;  3HB3 B;  4ZBM A;  1BZK A;  4LH6 A;  4X1Y B;  3WU2 Z;  3CX5 F;  4JI4 B;  1YJ9 V;  2DQ3 A;  2XND G;  3B40 A;  3E22 A;  1IBK B;  5CMU A;  5H9C A;  3P3P A;  4DR5 B;  2IJH A;  1IBM O;  2HR3 A;  4B3T B;  2HJD A;  4JF3 A;  1H2N A;  3RVZ A;  2EIN B;  4G2K A;  4J7K A;  4DV3 O;  4DR1 B;  2H8P C;  2BCC H;  3ZED A;  3N27 A;  2PI4 A;  3D3Q A;  3T1H O;  5LHH A;  3ASN C;  1K92 A;  5K1P A;  3EHB B;  4TV9 A;  3H1J H;  3P32 A;  3D3I A;  4GZR B;  3K04 A;  5LYJ A;  4LF5 O;  4K0K O;  5IYZ B;  2X0L A;  4MS2 A;  3SPH A;  3I5D A;  5KHJ A;  4DV4 O;  3L71 H;  3JAS B;  2XAQ A;  4DV2 O;  5BR8 O;  1GN4 A;  3IC9 A;  3G4S V;  1RFY A;  2HKO A;  1VQ5 V;  4DR4 O;  4BIU A;  2OCH A;  3X2Q C;  2IH3 C;  4ZHQ B;  1K34 A;  2L35 A;  2QWQ B;  1LUV A;  4DR2 B;  5B66 Z;  3H1I H;  2W0X A;  3CCL V;  1FXK B;  4MW3 A;  2V1D A;  5GTI Z;  1RPO A;  4IL6 Z;  3CCU V;  4O4J B;  3STZ C;  3ZMT A;  3D8C A;  4CH5 A;  1IBK O;  1JFF B;  3CME V;  4DR5 O;  1BHB A;  4B3T O;  4F6R A;  2DYS B;  3T2M A;  2Q0A A;  2F23 A;  4DR1 O;  1HNZ O;  1WA8 A;  4WF9 V;  1G8M A;  3R66 A;  1EM1 A;  3ZRV A;  3T4D A;  2YXH A;  1JMK C;  1FXV A;  4AI8 A;  1GRJ A;  3FB8 C;  3QO5 A;  4LF8 B;  4UXN A;  2P67 A;  2BTO A;  5A9G A;  4MTX A;  3F5W C;  5EYP B;  3U0Z A;  1VQL V;  3CD6 V;  1FFX B;  5ITZ A;  2E3C A;  1XNR B;  3JSL A;  2GHY A;  1S72 V;  4J41 A;  5LGN A;  4K35 A;  1JA8 A;  1SC5 B;  1N0N A;  2Q7G A;  1FJG B;  3HKE A;  1RM1 C;  2VWJ A;  5JQG A;  1MNG A;  3GWK C;  4O4L A;  1Z5V A;  3ETG A;  1XI1 A;  3F7V C;  1SQF A;  3CEI A;  1R3I C;  4J7J A;  3K79 A;  1QLE C;  1D5N A;  1RP3 B;  5F2V O;  2ZE6 A;  3RT3 C;  4YJ3 B;  2AZ2 A;  4B3S B;  4I9Q A;  2ZNJ A;  1AVM A;  3WG7 B;  2P22 C;  4B7K A;  4GCZ A;  5GTH Z;  4X20 A;  4UV8 A;  1GM8 A;  2JJ2 G;  2Z3Y A;  4CH6 A;  2P7T C;  2Q8V A;  5IY5 C;  5FL7 G;  1VF5 B;  1JR9 A;  3IAY A;  1GTO A;  3RYH B;  3B2E E;  1EZJ A;  2CGN A;  2KQX A;  2UXX A;  4UV9 A;  3KG2 A;  3ABL C;  3NR7 A;  4I4T B;  2IJK A;  4LF8 O;  1QVF U;  2EIJ C;  2KG7 A;  4J42 A;  3C3T A;  1I08 A;  4CZZ A;  3T1C A;  1K4D C;  3JCU Z;  4PDL A;  5KHH A;  1W0K G;  4R50 A;  2R9A A;  1PNK A;  4LFA O;  2F95 B;  2QKC A;  1XNR O;  2OCC B;  4LWS A;  1ZL8 B;  3K57 A;  3UKM A;  1FJG O;  1OCZ B;  2YI9 A;  4LR3 A;  4LNU A;  1PKX A;  5FNV A;  4PDR A;  3RYI B;  3KDR A;  1F4N A;  4EFE A;  4HNA A;  4ZI7 B;  5LOV B;  1GKF A;  1BMF G;  2BSK B;  4BR6 A;  3FB6 C;  2ODM A;  1IZ3 A;  4FLZ A;  4ZIB A;  1V9P A;  2RDC A;  1XMQ B;  4B3S O;  1TAE A;  2G38 A;  4FZ0 A;  2KB1 A;  4RUE A;  4WFA V;  5H6Q A;  2QWR B;  2F43 G;  1CP9 A;  3VBB A;  1K5Q A;  2PGG A;  3HKB A;  4JYB A;  1T5E A;  5JJE B;  2AW9 A;  2BOC C;  2QTO A;  1Q8I A;  4DUY B;  4ICG A;  3KKY A;  3CC4 V;  2W6I G;  1AR5 A;  1R6T A;  1HNX B;  2XHB A;  2PY5 A;  4DV6 B;  5DED A;  3FYI B;  2Y69 B;  4OGQ B;  4X8A A;  5IYD O;  1S5H C;  2DJV A;  4NR1 A;  5HFL A;  4DXW A;  2P5O A;  4JAA A;  1G6U A;  4XDK A;  1XHZ A;  5E79 Z;  4QE9 A;  2YIA A;  5LGU A;  4TV9 B;  4MSW C;  3OUF A;  1N4C A;  2XT9 A;  5LYJ B;  2YI8 A;  3DGE A;  1IJG A;  1WP7 A;  4I50 A;  4W4K A;  2Q68 A;  3BEH A;  2WLL A;  3K5M A;  3L73 H;  3SPJ A;  3CYO A;  3WB2 A;  2ZKO A;  4EB6 A;  1AJQ A;  1SQB H;  5EC2 C;  2HP8 A;  1IUR A;  5LHG A;  1Z2G A;  3K5N A;  4QNH B;  4X1K A;  2ZXW B;  4P9P A;  1K7D A;  3UT5 A;  1NI8 A;  1XMQ O;  1Q81 W;  1VQK V;  2W6J G;  4BIZ A;  1MA1 A;  2BTQ A;  3F7Y C;  3JAW B;  4MW8 A;  2CGO A;  5C8Y A;  1MG1 A;  3L70 H;  1FXK C;  1OCO B;  4FK5 C;  1NTZ H;  4LF9 B;  1ZUQ A;  4X1Y A;  4U7N A;  1HNX O;  2EJ7 A;  1Q82 W;  2KKW A;  3OMN B;  1YJW V;  4LF7 B;  4FVM A;  2FTK A;  2W0F C;  5DM6 V;  4F6R B;  4DV6 O;  4X66 B;  4UCO A;  3STL C;  4GX1 A;  1SET A;  2WAM A;  4LFB O;  1M93 A;  2JS3 A;  3LSQ A;  3PJS K;  1ZSP A;  3OD4 A;  4NYK A;  1D5A A;  1N8R W;  4O4H B;  1GK9 A;  5KAI Z;  4X64 B;  2ZR2 A;  3SDL A;  3CRQ A;  1BGY H;  4O2A A;  1TUE B;  2ADP A;  1SQX H;  2D2C B;  5IYZ A;  4YHH O;  2HVK C;  1R3K C;  4YIP A;  1P7G A;  4MVR A;  3HKE B;  2YSU B;  1NH2 D;  3JAS A;  1JOY A;  4FZ1 A;  5JH7 B;  5JQG B;  4DV7 B;  1KD1 W;  1AI6 A;  4PA3 A;  2WA3 A;  2DE0 X;  3X2Q B;  4DYL A;  1YSC A;  3ABM B;  2F4V O;  1KYO F;  1SRY A;  4C7U A;  4ZHQ A;  1UFI A;  1IBL O;  1NVP D;  1Q7Y W;  5D5Q A;  4GX0 A;  1FXK A;  4LF9 O;  2YEV B;  4BIO A;  2B5U A;  3BA9 A;  4BW5 A;  2LFR A;  2RJZ A;  4H37 A;  2GSM B;  2IW5 A;  5IYB O;  4I7Z B;  1LUW A;  4LF7 O;  3CSX A;  2YIB D;  4GX2 A;  2P4K A;  1SQV H;  4X66 O;  2PF4 E;  2H94 A;  4PDM A;  3RWR D;  3RYC A;  2N74 A;  1BHA A;  4X64 O;  5L3G A;  1H2K A;  5KX5 A;  1IXB A;  1N34 O;  5EYP A;  3CC7 V;  3SYQ A;  4DV0 B;  1FFX A;  2AHY A;  3SYP A;  5CA3 A;  1CXZ B;  2QTS A;  2OCC C;  2WA4 A;  1N32 B;  1MMM A;  2EBO A;  4KP4 A;  3MHS C;  2DOS A;  1DTO A;  3G80 A;  4DW1 A;  4LNU B;  1AI7 A;  4L8J A;  4L87 A;  1Y4M A;  3L75 H;  1SKV A;  4DV7 O;  1XUQ A;  1QLN A;  4EFB A;  5JJN B;  1EBO A;  5FPO A;  3H1L H;  2Y48 A;  3EFF K;  1YF2 A;  1QLE B;  1S5L Z;  4OXS A;  3QNE A;  3BPZ A;  4FFB B;  4YJ3 A;  3Q4H A;  2Z5U A;  1V54 B;  1N33 O;  2GDS A;  1SS3 A;  3AG1 B;  2UUA B;  3OTF A;  2K1E A;  1L0N H;  4JPR A;  4O4I B;  1QBZ A;  1VQN V;  1K73 W;  4FLU A;  2PYJ A;  2LW1 A; 
#chains in the Genus database with same CATH homology
 4F6E A;  4C7U A;  1JR9 A;  1LUV A;  1AP6 A;  1GN3 A;  1N0J A;  3DC5 A;  4FFK A;  3AK1 A;  2QKA A;  1KKC A;  3C3T A;  1I08 A;  4JYY A;  1LUW A;  3QVN A;  2P4K A;  1BS3 A;  2QKC A;  1BT8 A;  3OT7 A;  2CDY A;  1GN6 A;  1VEW A;  1MA1 A;  1EM1 A;  3RN4 A;  4X9Q A;  3AK2 A;  4GUN A;  3KDR A;  1I0H A;  1ZUQ A;  5A9G A;  4JZG A;  1IXB A;  1EN5 A;  1IDS A;  4BR6 A;  5AG2 A;  1AP5 A;  1MMM A;  1JA8 A;  2RCV A;  3DC6 A;  1IX9 A;  3LSU A;  1N0N A;  1XRE A;  1ZSP A;  1AR4 A;  1PL4 A;  2AW9 A;  1XUQ A;  1WB7 A;  2CE4 A;  1MNG A;  3KKY A;  1WB8 A;  1GN2 A;  1ZLZ A;  3MDS A;  1BSM A;  1VAR A;  1AR5 A;  3CEI A;  3K9S A;  4YIO A;  1PM9 A;  3C3S A;  1D5N A;  2ADP A;  1QNM A;  1EN4 A;  3BFR A;  4YIP A;  1P7G A;  1SZX A;  1EN6 A;  1AVM A;  1XDC A;  1ZTE A;  2GDS A;  3EVK A;  1B06 A;  1Y67 A;  4E4E A;  4JZ2 A;  1GN4 A;  3AK3 A;  1XIL A;  3IC9 A;  3TJT A;  1MSD A;  2ADQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...