4JZ2A

Crystal structure of co ion substituted sod2 from clostridium difficile
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal structure of Co ion substituted SOD2 from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Oxidoreductase
total genus 71
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jz2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jz2A02
1ZSPA 4YIPA 3BFRA 1GN3A 3AK2A 1GN4A 3MDSA 5AG2A 3AK1A 2RCVA 3DC6A 1PL4A 4C7UA 1P7GA 4X9QA 4GUNA 1AR5A 3EVKA 3CEIA 1XILA 3TJTA 1GN6A 1GN2A 1LUWA 4JZ2A 1I08A 1KKCA 3OT7A 1MA1A 1EN5A 2GDSA 3RN4A 4E4EA 1MSDA 1BT8A 3IC9A 5A9GA 2CDYA 1N0NA 2ADPA 3C3SA 1BS3A 1IXBA 4JYYA 3QVNA 2QKCA 4F6EA 3K9SA 3DC5A 1EN4A 1XDCA 2CE4A 1MMMA 1AP5A 1QNMA 4JZGA 1JA8A 1ZUQA 1PM9A 4YIOA 3AK3A 1XUQA 1EM1A 1N0JA 1IX9A 1SZXA 2P4KA 3LSUA 1XREA 3KKYA 1D5NA 1Y67A 1B06A 1VARA 1BSMA 1LUVA 1AP6A 1MNGA 1WB8A 4BR6A 1JR9A 1VEWA 1EN6A 2QKAA 1AVMA 3C3TA 1ZLZA 1AR4A 1ZTEA 4FFKA 1I0HA 1IDSA 2AW9A 1WB7A 2ADQB
chains in the Genus database with same CATH superfamily
2UUCB 2F93B 4LH6A 1BL8A 3KG2A 1V54B 1SQVH 2UXBO 2NN4A 1SQBH 3SJCC 2WLJA 4JV5B 2Q4PA 5IYDO 3EFFK 5ITZA 4I5SA 2IJIA 5IWAO 4O2BB 2XNDG 1WJZA 2ZDIC 3CB2A 2UXBB 2Q6AA 1SC5B 1XMOB 1H38A 1N36O 1MSDA 1BT8A 2FTKA 5CB4B 1AR1B 3ETDA 4LF6O 4B3RB 2CDYA 3G67A 1N0NA 4N21A 1FXVA 3U0ZA 3CCRV 5IYBO 4JI4O 5JH7B 4LF6B 1GM7A 4JYCA 4G27B 2CE4A 1XEQA 1K9MW 4DV0O 2X7RB 1VF7A 4FFBA 3U11A 4JI4B 1X59A 4DV2B 3ZMVA 1Z5VA 1FFTB 1JQ0A 3FYEB 1N33O 2BOCC 1JA8A 4TSFG 2X0LA 4NTYA 3J80N 4LWSB 3BA8A 4DR6O 1QR9A 4J80A 4CS4A 1EM1A 1WPBA 5IE9A 3JAWB 3LUTB 1NH2B 5B5EZ 4OGQB 4YXWG 2WA4A 1QU7A 4ZBMA 5LHIA 2DYSB 5B1AC 1J5EO 1XHXA 2XHBA 4UCVA 1HWYA 4GZRB 1HNZO 3MAQA 4UCSA 3HB3B 1WB8A 2CUGA 2BTQB 4KL1A 1Q6UA 2A0LA 3L70H 1J5EB 3ZS8C 3SDLA 1HNZB 4KXRA 1TUEB 2K1EA 1XQ8A 3OM3B 1RPOA 1FKAO 1KP2A 2Q5ZA 4HBNA 3AK1A 4KUMA 1VIBA 3WB0A 1F23A 1NT2B 2RDCA 2WLLA 1ZAUA 3JARB 1H8EG 3CC7V 5JCOC 2ILMA 3RYFB 5D5QA 3WFVA 3R65A 1NBMG 2HVKC 1MA1A 1EN5A 3VQWA 5LHGA 4JPRA 2LJ2A 1M56B 4J42A 1G1XB 4F6RB 3K79A 4AI8A 4YJ2B 5LXTB 2OCHA 1QLEB 2YXHA 4CH6A 5IYCO 3ML0A 1D2DA 3AG3B 4FM2A 3OTOB 1JFFB 1PNKA 1XDCA 4NTXA 3CMAV 2UXCB 5CA0B 4BW5A 1BQ0A 4WFFA 3IC7A 4PI0A 3A0BZ 1MOFA 2ZR3A 1VQMV 5LL6Y 3S3XA 4J9YB 4YIOA 5BXZA 3AK3A 5EYPA 4PDLA 3D3QA 2QWRB 4DV6B 3H1LH 4JF3A 1HP8A 4J7KA 2H3OA 4FM0A 3RVYA 1Y74A 3JD2A 4JI1O 4IL6Z 4QGPA 4FFBB 1YTFB 5FNVB 2YXLA 2EINC 3K58A 2E74B 4TOIA 4JI1B 1K97A 3IFXA 3FB8C 1IVSA 2F95B 1Z2GA 3AEIA 2ITDC 5GONA 1OCOB 1K73W 5EC2C 4DV4O 3BFRA 2LW1A 3SJQC 3FB6C 3M7MX 4UCOA 4CH3A 4C7UA 1DF4A 3UT5B 2RJZA 2Q67A 3EVKA 2HG5C 1OCCC 3K04A 1K4CC 4YHHB 4X20A 1NKDA 1WP8A 5IY5B 3T1YO 3OR7C 1Q8IA 3K03A 1QQCA 3ZHRA 3RN4A 3N27A 2Q7GA 5L3FA 4GKKB 1DGSA 4J10A 2L35A 5CN0A 3T1YB 2B5UA 3ABLC 4CS3A 3P3NA 1AROP 1MZEA 2QKSA 1D5AA 2QWOB 1KB9F 3ZRSA 4EEQA 4JI2O 1NJIW 1XL4A 3KDRA 4O4LA 2KG7B 5BMVA 1VQLV 3ZMUA 4DK0A 5CBGA 4JI2B 5L3CA 3LDEA 4K8XA 3IJ4A 2QR4A 1FXKA 4HNAA 1NR7A 1IJGA 3STZC 3D36A 3TXSA 1XL6A 1NS1A 5FLXN 3CRCA 1OCZB 2HEPA 1Q82W 1JMKC 2HFEC 4O4IB 4JI5B 3ASOB 3JD0A 5GW7A 4DV3O 1Y4MA 2EIMB 4DXWA 1E1RG 3K57A 1US6A 1MNGA 4WFEA 4BR6A 1THZA 3W7SA 5CMUA 2QM7A 1NQTA 3M99B 1YEWA 4RUFA 3FD9A 5E1AC 1AVMA 1MZFA 2V1DA 4JGSA 2JGUA 4K0KO 1A32A 1QR8A 4WCEV 3CCLV 1HR0O 1Q86W 2JJ1G 1N34B 2VQEO 4ZHQB 4PELA 1L0LH 2ZD9A 3AG4C 3AK2A 3TCUA 4LF8O 3LSQA 4K0KB 4CZZA 4NTWA 1HNWO 5LMNO 5C8YA 2Y69C 2VS0A 1P7GA 4PDMA 4FM1A 3BVOA 5L3DA 5LMUO 3NXSA 1H8HG 5E79Z 1F4MA 1AILA 3QG5A 2PI5A 1HNWB 5LMUB 3FYIB 1Z5WA 1Q6IA 4I50B 5GONB 3IC9A 2B1IA 4K3AA 2QWQB 4PI2A 1K7DA 2DQ3A 1NTKH 1H2GA 3CP1A 2ZKOA 3CYOA 2DMXA 2EIKB 4HYOA 3FAVB 3ABMB 1OZ0A 2X6AA 4J7JA 4JI0O 3RYCB 1MMMA 4X20B 4LR3A 1RM1B 1Y66A 2AXTZ 3L9DA 2EX3A 4TV8A 1S5JA 4JI0B 4DR4O 1R3JC 3LNNA 4R50A 4RQEA 3SYQA 2YC0A 4Z1MG 2W6JG 3JALA 4DR4B 3LSUA 1DLBA 3K5LA 2Z0AA 1YDXA 2A3QA 5H2FZ 1QVFU 4GX5A 3CS5A 2MW2B 1B3QA 3BPZA 2HR3A 2P7TC 3HKEB 5KHHA 1FXKB 4HNAB 2VWKA 1R6KA 3G6BA 2WLMA 3KZIZ 1IDSA 1KMIZ 3VOUA 1G6UA 3W7TA 1GN3A 1JNBA 3SPJA 2ATKC 2B9ZA 4EKWA 5JVDB 3ZMTA 5J2TB 1Q3EA 3W7UA 2YI8A 3DC6A 4ICGA 4OX9O 3ZJZA 3P32A 1M90W 1XILA 3AG7A 4ZOLB 2QDOA 2HVJC 4K35A 5CB4A 4OX9B 1MSWD 5B3SC 1JVMA 3ZIAG 3QO5A 2PF4E 5LOVA 1ZWIC 1N32O 3SPGA 2UU9B 4R8CA 4H37A 5JH7A 3I55V 2OWOA 3HPLC 1AJQA 2M7WA 3F5WC 2GV9A 3ZMSA 3ICXA 2YEVA 4CBCA 4L87A 1XMQO 2RMKB 3T1HO 2X6CA 2QEXV 1XBLA 2XAQA 1AP5A 1SQPH 1SS3A 3SGIA 4X66O 1KQSU 3ASNC 5KHJA 1T5EA 3QO7A 3T1HB 3LDCA 1TUBA 1VQ4V 1M93A 3F7VC 3ZHUA 4JTCB 4CC5A 4UB6Z 3JAWA 3X2QC 4LFCO 4TQDA 1GAXA 5B1AB 3IAYA 1NU1H 2VRZA 3FB7C 4I0XB 2BSKB 1ZL8B 3FFQA 4QNHB 2DN9A 1RPRA 2D2CB 2BTQA 4ASUG 2LP7A 4QPJA 2Z5UA 5LGTA 3CCSV 2PTMA 1MG1A 4U3FH 1NI8A 2QE7G 3MD0A 1X4TA 4DR2O 2IH3C 1UJWB 4IYIA 5J2UB 1TA8A 1YIJV 3JALB 1VQ8V 2B1GA 3HKDB 1VF6C 2FMLA 2E76B 1S5LZ 2DE0X 2F66C 4EFEA 1TVKB 5LYJA 4YJ3A 1PV0A 2CTQA 3ETGA 3JARA 1SQFA 1SESA 4DUZB 2Z3YA 2MK3A 4NVPA 5KUKA 5LP6C 5H6QA 1NTMH 3RYFA 4MVRA 3L75H 2XASA 1PKXA 4WBNA 1NZ6A 4FLWA 2XAGA 3OMAB 4U3JA 1XNRB 1EZJA 4X1KB 3GWKC 1S77D 4F6RA 4KP4A 1WAZA 2EULA 4YJ2A 3E8BA 5LXTA 4W4KA 3C3SA 4PA4A 1VQ7V 1VQ5V 5IJ9A 1RSOA 4DV7O 1PPJH 4QPKA 4Z1VA 2KB1A 1JFFA 4JI8O 2R9RB 5CA0A 3ABKC 1Q5OA 4OPHA 1FYJA 1I7FA 3D8CA 3CCEV 3CD6V 2XAHA 1FD9A 3A2FA 4NR1A 5IWAB 2HJDA 5LOVB 4TUYA 3ETQA 4BIOA 1Q81W 5LA6B 3OGIB 4NXNO 2IM9A 1N36B 4FLUA 1KC8W 2EIJC 2R70A 1D5NA 2R9AA 2YEVB 4BIUA 4NXNB 1IBKO 2YIBA 1P49A 1E79G 2LGWA 4WFGA 4X62O 1M57C 5FNVA 3MHSC 3E89A 1GM8A 5KA5A 1JPXA 4DV0B 1IBKB 4GKJO 1TUBB 3CRMA 1NVPD 2F4VO 2QWNB 4MT8A 5L3GA 1CPYA 1F4NA 1N33B 3CRQA 1P4RA 3ZMZA 2AW9A 4UVBA 4DO2A 4X65O 4GKJB 1KU9A 4DR6B 2XOKG 5IYZB 1OCCB 1S3JA 2Q7EA 3UT5A 2GBOA 4K8ZA 4D7TA 1PL4A 4LF7O 2NR5A 1JX9A 1Q43A 1OJHA 4CH5A 3ZCCA 4LF7B 4FLVA 3AG1C 3ABLB 3ZHTA 2QGNA 2IH1C 5BR8O 1F51A 1YVWA 3CE2A 3H9VA 1FXHA 3T4DA 1XI1A 4JI6O 4JI7O 5LYJB 4UUJC 4B3TO 1GO3F 4YJ3B 2W0XA 5DN6G 2KG7A 5BR8B 1WNSA 2WLKA 3CCMV 2OYQA 2IJKA 3S3WA 1IBMO 3LDDA 2UXXA 3CJHA 4JI6B 4BAYA 4JI7B 5B1OA 1W0JG 3I5DA 2YIAA 1FAFA 2NLJC 4WBNB 2N04A 3L72H 4ZKIA 4U3JB 2K9PA 2F43G 1IBMB 2QM4A 2E3CA 5DM6V 2CGNA 3RBZA 1TAEA 3N2KA 5IJ9B 1RSOB 4O4IA 1N0JA 3ABTA 1SERA 4PA9A 1QCEA 2P4KA 3HR0A 5L3BA 1V9PA 3ZX6A 2A79B 2PYLA 4LFBO 5H5NA 1K3EA 3E22B 5B66Z 3E8HA 4TUYB 3HKCA 1IURA 4B3MO 1R73A 3BABA 4ZHQA 4LFBB 2LO1A 1KP3A 2ZE6A 5DEDA 2KKWA 1WB7A 3RYHA 2PYJA 4UXNA 3GVMA 2D3OW 4GX1A 1RP3B 1SRYA 2YS8A 3BRCA 2ZXWC 3MDSA 2XAJA 5KAIZ 2AGAA 3ZN1A 1ENVA 1UFIA 2DYRC 3OFNG 4DR7O 3ETEA 1VQKV 1FJGO 1PNLA 5KMGA 2EILB 4I50A 2ZE5A 3R66A 3CRAA 1FFXB 3E83A 4E4EA 4FLYA 1BHAA 3TXQA 5A9GA 4J9ZB 5B1BB 3OAAG 3BCCH 3H1HH 3FAVA 2JIZG 2QKCA 2ZCEA 4UCRA 5HFMA 3NR7A 4DV4B 3RYCA 4BW9A 1EN4A 3W7XA 1XHZA 1M5IA 1K33A 2V4DA 1R6TA 3LNMB 3K5OA 3AG2C 2H94A 4YY3O 3GWOA 1L8DA 2EZPA 3K5NA 3P30A 4RWUA 1SZXA 1KBHA 4JASA 4YY3B 3FB5C 1M1KW 3L73H 4DV5O 3CJHB 1BE3H 1Y76B 3UCSC 3HKEA 1AP6A 3BY6A 3WG7B 1CP9A 3ZRVA 3H1KH 1YJ9V 1H2KA 4P30A 4TWKA 3EHBB 3WB2A 1YITV 2ZINA 3ZEDA 3RYIB 1YF2A 3C3TA 2QTSA 5GTHZ 1AR4A 3M8AA 1YJWV 1I0HA 3N2KB 2HKOA 2ZNIA 1B04A 3K06A 1CEZA 1B6QA 1I5XA 5JVDA 5J2TA 5KHGA 4UCTA 1K5QA 2G38A 3UQ8A 4I4TA 4AILC 1TGOA 4N23A 2ZDIA 4X9QA 2QA4V 3E8FA 4ZOLA 4WFBV 2F23A 4DV3B 2Q68A 3JCZA 5B3SB 4MSWC 1GN2A 5KHIA 5BY1A 3ZRXA 3HKCB 3AG3C 4X88A 1GRJA 4FZ1A 4AQYO 4DK1A 3RYHB 1BS3A 1HR0B 1VQPV 2VQEB 3E35A 2BTOA 4AQYB 1V55C 2C2AA 3IGAC 4GT1A 4LF8B 5IDJA 2YSUB 2Q69A 4R6ZA 1EBOA 5LMNB 1PP9H 4I55A 4PJ0Z 5KMGB 1KECA 2GTSA 2PUSA 1OV9A 2QTOA 3E2EA 3JD4A 3APQA 3JSNA 1VQNV 3X2QB 4I7ZB 2ZNJA 1XNQO 2JS3A 5CA1B 3SYAA 2N05A 5CBFA 1OCRC 3JYCA 1P84F 4I0XA 3JD3A 2BSKA 4CS2A 1ZL8A 1XNQB 3UKMA 4JI3O 2EJ7A 2YI9A 4U7NA 1B06A 3F5TA 4NKGB 5JJJB 4FLTA 1OCOC 3OE7G 3E86A 3VQVA 3VQXA 4JI3B 5LGNA 1GTOA 2OIGA 2WPDG 5EBLC 4P9PA 5J2UA 1ZTEA 2ARHA 4I9WA 2P22C 3HKDA 1LR1A 2OCCC 5EIBC 1TVKA 3B8NA 4DYLA 1ZSPA 5IY5C 3ZN0A 1W59A 2GTAA 5JCOA 3RW0A 2WAMA 3OMNB 4DV1O 4KHPO 2LQTA 1VP7A 3PJSK 1KKDA 1IXMA 1SKVA 2KQXA 1Q90D 1EZVH 4KHPB 4X1KA 3G6EV 3B8MA 1I08A 3G71V 3UM7A 2ETNA 2R9IA 3WB1A 3OMIB 2CAZC 3ABUA 4UFZA 1KD1W 2P67A 5H6RA 4I4TB 4JYYA 4ZIBA 4LH7A 2HHHO 4DUYO 1IBLO 1FOUA 3LSSA 2EJRA 2A06H 4Q6GA 4PA3A 2AHYA 4QJFB 2O57A 4Q20A 4UV9A 2FKXA 4DW0A 1QNMA 2BE3A 1HW7A 5LA6A 4JTDB 3QO8A 2UUAO 2VQFO 4HZ3A 2LGQA 3JSLA 2Q9LA 1PM9A 3VBBA 2EIJB 3JAKA 1AJNA 2XAFA 1K34A 1OHHG 1URFA 1IX9A 5IJ0B 3UO3A 2IW5A 4WFAV 1ZX3A 2UUBO 1M57B 1N32B 4FLZA 1GK9A 3KKYA 3SYPA 3GB7C 2JJ2G 3K3WA 2JDIG 4MVQA 5EIBD 3A8TA 4I55B 2OTLV 3E8GA 1Q6HA 1XMQB 4XDKA 1H2LA 3B2EE 1AI6A 4X66B 1SZTA 2YICA 2DW4A 3B4SA 4B3SO 4FFKA 3L71H 4RO2A 3OW2U 3F7YC 2EZOA 3ZHSA 5IYZA 4KFMA 1VMGA 4TT3G 1KUQA 4LFCB 3A0HZ 4MVZA 1SF9A 4O4JA 3CCVV 5IT9N 1AI5A 4J41A 3UO2A 4MW8A 3K9AA 3AG1B 4LF5O 1QVGU 1BHBA 2NNUA 1G8MA 2CTRA 1DK1A 1L1FA 4FMTA 3OT7A 2V7QG 3ABMC 2Q0OC 1H2MA 2HJFC 2HP8A 5FPOA 1O9HA 5JWPA 4LCUC 4EB6A 2Q73A 4B7EA 5EZYB 3CRRA 4DR2B 1IXBA 4JTAB 4MW3A 3T2MA 1SQGA 4H13B 5LHHA 5K1PA 1WPXA 4J7ZA 3CSXA 3KCXA 2JS5A 4MTGA 2ZT9B 1XOUA 3DTUB 4OPAA 1K92A 2ZE8A 3RVZA 4QIWF 1AJPA 2UUCO 4ABMA 1G4YB 2P06A 2AZ0A 4RUEA 4O2AB 4UCUA 1VF5B 1FXKC 1H2NA 2JGDA 1PD3A 4XBFA 2ZIMA 4RQFA 4DV7B 3BA9A 4JV5O 1W0KG 1I5YA 2GUZA 2PI4A 2YDEA 2Y48A 2DWEC 4JI8B 2P5OA 3E22A 3BHPA 1EFRG 3ZHQA 2CH7A 5EBMC 3C90A 1VQOV 1XMOO 3QNEA 4H33A 3OTFA 4B3RO 5JJNB 3QF7A 3JAKB 4X89A 4F4LA 1R3LC 2ZXWB 3SR2C 4O4HB 4P2ZA 2EINB 3DXRB 2FB5A 2E75B 2GHYA 1AI7A 2DYRB 2N74A 1S5HC 3BAAA 5JJEB 5DECA 4DV2O 4X62B 5FPRA 2JK5C 1QHTA 5GTIZ 1VQ9V 2JEUA 1FFXA 4XDJA 2UXNA 2GDSA 3SJBC 1P7BA 1WN7A 2EBOA 1L0NH 5D5PA 2F4VB 2Q7HA 3Q4HB 2ZR2A 4O4JB 5L3EA 2ZQMA 4X65B 4F6EA 4NYKA 3K5MA 3L74H 2ZE7A 3K9SA 3OGCC 2CGOA 1O9GA 4MVUA 3G4SV 1QLNA 3AG2B 2ODMA 5C93A 3U10A 1HNXO 2QWPB 1R3IC 4EB6B 3CC2V 1VQ6V 4GX0A 1N8RW 1U97A 3WU2Z 4LNUB 1HNXB 5HFLA 4PA7A 1XREA 1SQXH 2Y0IA 4UB8Z 4B3TB 1Y76A 4IIJB 2P90A 1Y67A 3OD4A 1LUVA 4IHJB 2HLDG 2WA3A 1IZ3A 3RYIA 2YUAA 3HKBB 2AHZA 2XT9A 4MS2A 5BZBA 1HDJA 1ZLZA 2X6BA 4DRXB 1LNQA 3OUSA 3ZHVA 4D7SA 4YIPA 2JGDB 3OTOO 3RWRD 4X1YB 2DOSA 2WLIA 1DF5A 2UXCO 1E1QG 2GUZB 4Z2WA 4GUNA 1AR5A 4GCZA 1CXZB 4TV9A 2UXDO 1YHQV 4XDLA 2CH7B 1V54C 3JCUZ 3AG4B 4B7KA 5ITZB 1KKCA 2Y69B 2UXDB 2L6LA 4L8JA 4WF9V 4G28B 4B3MB 1V55B 4HAMA 4DV6O 4LP8A 4MTOA 1COWG 3THOA 3CHXA 3QVNA 4LBEC 5KLVH 1WP7A 1WLEA 3DC5A 1S72V 2CTWA 2RN9A 3CXHF 3RFRA 3K08A 1S76D 2Q0AA 1JJOA 4OXSA 2XUMA 4DR7B 1OCRB 4CC6A 1FJGB 5CA1A 4DR1O 4JZGA 2E5LO 2P6JA 1JJ2U 4A5UB 1ORQC 5JQGA 2Y0PA 4PDVA 1YZBA 4DR1B 1FS0G 1BGYH 2E5LB 1ROPA 2YXYA 4JYAO 4IGGA 3SPIA 2Y4UA 3OUFA 1I94O 1DTOA 4R7CA 4BIZA 3JATA 2ZM6O 3KCYA 3N2GA 4YHHO 4JYAB 1JR9A 1SA0A 2DYSC 1VF6A 3PN1A 1I94B 4DR3O 3ZRWA 3FKSG 2OCCB 2ZM6B 4CH4A 4PHZA 5CBHA 4GKKO 2FYUH 4ZI7A 4U7OA 1J95A 1RFYA 3A0RA 1R6NA 5LP6A 4DR3B 1BMFG 1R1BA 2LW7A 3H1JH 1K5SA 1JOYA 1GN4A 3SPHA 3JAMN 2JEXA 5TISZ 1S0VA 4DV5B 3CEIA 3TJTA 2RNBA 2WLLB 4FVMA 2OIEA 4JZ2A 2FL4A 5LGUA 2OTJV 3CC4V 4P9OA 2W6IG 4BWAA 4FK5C 2XTAA 4JI5O 4LC1A 1H2SB 5KA6A 3FX7A 4IYHA 3W7WA 2OT5A 1M56C 2WLIB 3RGBA 4LF4O 2QSAA 2P4VA 4LF9O 2IU0A 1QLEC 2Y4TA 4TV9B 1GKFA 1FPOA 2WWWA 3JD1A 4LF4B 2IJHA 3G80A 4LF9B 1YCIA 2CTPA 3T1CA 2WLNA 4DR5O 1NH2D 1BCCH 1N4CA 5KX5A 3SJAC 1N34O 1M4UA 2DJVA 3JASA 4J11A 2VWJA 2JVDA 5IJ0A 1XUQA 3K0GA 2DQ0A 4DR5B 5EYPB 5K1XA 3ASNB 1GM9A 4EFBA 4MVMA 1Y74B 3OR6C 4UV8A 3ZBHA 2CK3G 1EN6A 4FJCC 1WA8A 4FIPC 3CMEV 1YJNV 5KHKA 3APOA 1BQZA 2PZSA 4FZ0A 4FLXA 5JQGB 4JAVA 2ADQB 1M9NA 3TGUH 2WSSG 3CCQV 4D6TH 3SPCA 2EILC 3VQYA 3JATB 4LFAO 1NR1A 3N2GB 4MVSA 5EBWC 1SA0B 5B1BC 2JRIA 3H1IH 4PD4F 4LFAB 2IJJA 2LFSA 4MVOA 3ZRWB 2DWDC 3TETA 5EZYA 4ZI7B 3OEEG 1NVPB 5LP6B 2ADPA 2PY5A 2ITCC 1K4DC 3P3PA 3SYOA 5A2QN 3K0DA 4X1IA 5H9CA 1SETA 3OEHG 2W0FC 4JYBA 4FPPA 4DV1B 1SQQH 3O65A 5FL7G 4I9QA 1Q7YW 4O4LB 4GYCB 5BMVB 3TK1A 1YXBA 3DSQA 4B08A 4NB5A 4AHCA 1ZUQA 2F1MA 3ABKB 4O2AA 3B77A 3WG7C 2YIDA 1YTFD 2YIBD 4QE9A 5B1NA 1W2BU 3K59A 1VARA 2HHHB 4DUYB 2AZ2A 1OCZC 1IBLB 1BSMA 4PDRA 3D3IA 1R3KC 1Y6XA 3I56V 3DGEA 3RT3C 3ASOC 3B09A 4W4LA 2EIMC 3CX5F 4JAAA 2QKAA 5KUMA 3H01A 4O2BA 2PGGA 5KX5B 3JASB 1YI2V 5CA3A 2IBZH 4O4HA 3BEHA 2UU9O 2UUAB 1GMGA 3DXRA 2VQFB 1F7YA 4UVAA 5EC1C 4NXMO 1KYOF 2GSMB 1BZKA 2UUBB 3QTCA 5AG2A 2QJ1A 2RCVA 2H8PC 1U96A 4H0LB 3MHHC 2IU3A 5C8YB 2Q8VA 3CWBH 4NXMB 1H5WA 1YSCA 4X8AA 1GN6A 1LUWA 2QM8A 2BCCH 1WA8B 3J7AU 1UPGA 3Q4HA 4PV1B 4TQFA 3O9OA 3CPWU 4X64O 4LWSA 4GX2A 4B3SB 1MABG 2A9HA 3T4ZA 3B40A 1AB3A 4WFHA 4X64B 4MTFA 5LBQA 3CCJV 4GLXA 4MTXA 1JCHA 2EIKC 4E2LA 3CCUV 3STLC 4PA6A 2LFRA 4IT5A 4LF5B 4H44B 1AI4A 2WLHA 3J81N 4G2KA 4TV8B 1RM1C 2BOBC 4LNUA 4X1IB 2M6YA 3SYCA 2ZIOA 1NTZH 1QBZA 4IIJA 2A7WA 5KAFZ 2RQ6A 1PNMA 4DW1A 4DUZO 1PL0A 4UVCA 5EK0A 3EXAA 4IHJA 4QE7A 3HKBA 1VEWA 5J9PC 1GH6A 1XNRO 1K8AW 4DRXA 2KSDA 4JAUA 4RAIA 2R72A 5F2VO 3CXCU 4X1YA 3D36C
chains in the Genus database with same CATH topology
1ZSPA 4YIPA 3BFRA 1GN3A 3AK2A 1GN4A 3MDSA 5AG2A 3AK1A 2RCVA 3DC6A 1PL4A 4C7UA 1P7GA 4X9QA 4GUNA 1AR5A 3EVKA 3CEIA 1XILA 3TJTA 1GN6A 1GN2A 1LUWA 4JZ2A 1I08A 1KKCA 3OT7A 1MA1A 1EN5A 2GDSA 3RN4A 4E4EA 1MSDA 1BT8A 3IC9A 5A9GA 2CDYA 1N0NA 2ADPA 3C3SA 1BS3A 1IXBA 4JYYA 3QVNA 2QKCA 4F6EA 3K9SA 3KDRA 3DC5A 1EN4A 1XDCA 2CE4A 1MMMA 1AP5A 1QNMA 4JZGA 1JA8A 1ZUQA 1PM9A 4YIOA 3AK3A 1XUQA 1EM1A 1N0JA 1IX9A 1SZXA 2P4KA 3LSUA 1XREA 3KKYA 1D5NA 1Y67A 1B06A 1VARA 1BSMA 1LUVA 1AP6A 1MNGA 1WB8A 4BR6A 1JR9A 1VEWA 1EN6A 2QKAA 1AVMA 3C3TA 1ZLZA 1AR4A 1ZTEA 4FFKA 1I0HA 1IDSA 2AW9A 1WB7A 2ADQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZSP A;  4YIP A;  3BFR A;  1GN3 A;  3AK2 A;  1GN4 A;  3MDS A;  5AG2 A;  3AK1 A;  2RCV A;  3DC6 A;  1PL4 A;  4C7U A;  1P7G A;  4X9Q A;  4GUN A;  1AR5 A;  3EVK A;  3CEI A;  1XIL A;  3TJT A;  1GN6 A;  1GN2 A;  1LUW A;  4JZ2 A;  1I08 A;  1KKC A;  3OT7 A;  1MA1 A;  1EN5 A;  2GDS A;  3RN4 A;  4E4E A;  1MSD A;  1BT8 A;  3IC9 A;  5A9G A;  2CDY A;  1N0N A;  2ADP A;  3C3S A;  1BS3 A;  1IXB A;  4JYY A;  3QVN A;  2QKC A;  4F6E A;  3K9S A;  3DC5 A;  1EN4 A;  1XDC A;  2CE4 A;  1MMM A;  1AP5 A;  1QNM A;  4JZG A;  1JA8 A;  1ZUQ A;  1PM9 A;  4YIO A;  3AK3 A;  1XUQ A;  1EM1 A;  1N0J A;  1IX9 A;  1SZX A;  2P4K A;  3LSU A;  1XRE A;  3KKY A;  1D5N A;  1Y67 A;  1B06 A;  1VAR A;  1BSM A;  1LUV A;  1AP6 A;  1MNG A;  1WB8 A;  4BR6 A;  1JR9 A;  1VEW A;  1EN6 A;  2QKA A;  1AVM A;  3C3T A;  1ZLZ A;  1AR4 A;  1ZTE A;  4FFK A;  1I0H A;  1IDS A;  2AW9 A;  1WB7 A;  2ADQ B; 
#chains in the Genus database with same CATH topology
 2UUC B;  2F93 B;  4LH6 A;  1BL8 A;  3KG2 A;  1V54 B;  1SQV H;  2UXB O;  2NN4 A;  1SQB H;  3SJC C;  2WLJ A;  4JV5 B;  2Q4P A;  5IYD O;  3EFF K;  5ITZ A;  4I5S A;  2IJI A;  5IWA O;  4O2B B;  2XND G;  1WJZ A;  2ZDI C;  3CB2 A;  2UXB B;  2Q6A A;  1SC5 B;  1XMO B;  1H38 A;  1N36 O;  1MSD A;  1BT8 A;  2FTK A;  5CB4 B;  1AR1 B;  3ETD A;  4LF6 O;  4B3R B;  2CDY A;  3G67 A;  1N0N A;  4N21 A;  1FXV A;  3U0Z A;  3CCR V;  5IYB O;  4JI4 O;  5JH7 B;  4LF6 B;  1GM7 A;  4JYC A;  4G27 B;  2CE4 A;  1XEQ A;  1K9M W;  4DV0 O;  2X7R B;  1VF7 A;  4FFB A;  3U11 A;  4JI4 B;  1X59 A;  4DV2 B;  3ZMV A;  1Z5V A;  1FFT B;  1JQ0 A;  3FYE B;  1N33 O;  2BOC C;  1JA8 A;  4TSF G;  2X0L A;  4NTY A;  3J80 N;  4LWS B;  3BA8 A;  4DR6 O;  1QR9 A;  4J80 A;  4CS4 A;  1EM1 A;  1WPB A;  5IE9 A;  3JAW B;  3LUT B;  1NH2 B;  5B5E Z;  4OGQ B;  4YXW G;  2WA4 A;  1QU7 A;  4ZBM A;  5LHI A;  2DYS B;  5B1A C;  1J5E O;  1XHX A;  2XHB A;  4UCV A;  1HWY A;  4GZR B;  1HNZ O;  3MAQ A;  4UCS A;  3HB3 B;  1WB8 A;  2CUG A;  2BTQ B;  4KL1 A;  1Q6U A;  2A0L A;  3L70 H;  1J5E B;  3ZS8 C;  3SDL A;  1HNZ B;  4KXR A;  1TUE B;  2K1E A;  1XQ8 A;  3OM3 B;  1RPO A;  1FKA O;  1KP2 A;  2Q5Z A;  4HBN A;  3AK1 A;  4KUM A;  1VIB A;  3WB0 A;  1F23 A;  1NT2 B;  2RDC A;  2WLL A;  1ZAU A;  3JAR B;  1H8E G;  3CC7 V;  5JCO C;  2ILM A;  3RYF B;  5D5Q A;  3WFV A;  3R65 A;  1NBM G;  2HVK C;  1MA1 A;  1EN5 A;  3VQW A;  5LHG A;  4JPR A;  2LJ2 A;  1M56 B;  4J42 A;  1G1X B;  4F6R B;  3K79 A;  4AI8 A;  4YJ2 B;  5LXT B;  2OCH A;  1QLE B;  2YXH A;  4CH6 A;  5IYC O;  3ML0 A;  1D2D A;  3AG3 B;  4FM2 A;  3OTO B;  1JFF B;  1PNK A;  1XDC A;  4NTX A;  3CMA V;  2UXC B;  5CA0 B;  4BW5 A;  1BQ0 A;  4WFF A;  3IC7 A;  4PI0 A;  3A0B Z;  1MOF A;  2ZR3 A;  1VQM V;  5LL6 Y;  3S3X A;  4J9Y B;  4YIO A;  5BXZ A;  3AK3 A;  5EYP A;  4PDL A;  3D3Q A;  2QWR B;  4DV6 B;  3H1L H;  4JF3 A;  1HP8 A;  4J7K A;  2H3O A;  4FM0 A;  3RVY A;  1Y74 A;  3JD2 A;  4JI1 O;  4IL6 Z;  4QGP A;  4FFB B;  1YTF B;  5FNV B;  2YXL A;  2EIN C;  3K58 A;  2E74 B;  4TOI A;  4JI1 B;  1K97 A;  3IFX A;  3FB8 C;  1IVS A;  2F95 B;  1Z2G A;  3AEI A;  2ITD C;  5GON A;  1OCO B;  1K73 W;  5EC2 C;  4DV4 O;  3BFR A;  2LW1 A;  3SJQ C;  3FB6 C;  3M7M X;  4UCO A;  4CH3 A;  4C7U A;  1DF4 A;  3UT5 B;  2RJZ A;  2Q67 A;  3EVK A;  2HG5 C;  1OCC C;  3K04 A;  1K4C C;  4YHH B;  4X20 A;  1NKD A;  1WP8 A;  5IY5 B;  3T1Y O;  3OR7 C;  1Q8I A;  3K03 A;  1QQC A;  3ZHR A;  3RN4 A;  3N27 A;  2Q7G A;  5L3F A;  4GKK B;  1DGS A;  4J10 A;  2L35 A;  5CN0 A;  3T1Y B;  2B5U A;  3ABL C;  4CS3 A;  3P3N A;  1ARO P;  1MZE A;  2QKS A;  1D5A A;  2QWO B;  1KB9 F;  3ZRS A;  4EEQ A;  4JI2 O;  1NJI W;  1XL4 A;  3KDR A;  4O4L A;  2KG7 B;  5BMV A;  1VQL V;  3ZMU A;  4DK0 A;  5CBG A;  4JI2 B;  5L3C A;  3LDE A;  4K8X A;  3IJ4 A;  2QR4 A;  1FXK A;  4HNA A;  1NR7 A;  1IJG A;  3STZ C;  3D36 A;  3TXS A;  1XL6 A;  1NS1 A;  5FLX N;  3CRC A;  1OCZ B;  2HEP A;  1Q82 W;  1JMK C;  2HFE C;  4O4I B;  4JI5 B;  3ASO B;  3JD0 A;  5GW7 A;  4DV3 O;  1Y4M A;  2EIM B;  4DXW A;  1E1R G;  3K57 A;  1US6 A;  1MNG A;  4WFE A;  4BR6 A;  1THZ A;  3W7S A;  5CMU A;  2QM7 A;  1NQT A;  3M99 B;  1YEW A;  4RUF A;  3FD9 A;  5E1A C;  1AVM A;  1MZF A;  2V1D A;  4JGS A;  2JGU A;  4K0K O;  1A32 A;  1QR8 A;  4WCE V;  3CCL V;  1HR0 O;  1Q86 W;  2JJ1 G;  1N34 B;  2VQE O;  4ZHQ B;  4PEL A;  1L0L H;  2ZD9 A;  3AG4 C;  3AK2 A;  3TCU A;  4LF8 O;  3LSQ A;  4K0K B;  4CZZ A;  4NTW A;  1HNW O;  5LMN O;  5C8Y A;  2Y69 C;  2VS0 A;  1P7G A;  4PDM A;  4FM1 A;  3BVO A;  5L3D A;  5LMU O;  3NXS A;  1H8H G;  5E79 Z;  1F4M A;  1AIL A;  3QG5 A;  2PI5 A;  1HNW B;  5LMU B;  3FYI B;  1Z5W A;  1Q6I A;  4I50 B;  5GON B;  3IC9 A;  2B1I A;  4K3A A;  2QWQ B;  4PI2 A;  1K7D A;  2DQ3 A;  1NTK H;  1H2G A;  3CP1 A;  2ZKO A;  3CYO A;  2DMX A;  2EIK B;  4HYO A;  3FAV B;  3ABM B;  1OZ0 A;  2X6A A;  4J7J A;  4JI0 O;  3RYC B;  1MMM A;  4X20 B;  4LR3 A;  1RM1 B;  1Y66 A;  2AXT Z;  3L9D A;  2EX3 A;  4TV8 A;  1S5J A;  4JI0 B;  4DR4 O;  1R3J C;  3LNN A;  4R50 A;  4RQE A;  3SYQ A;  2YC0 A;  4Z1M G;  2W6J G;  3JAL A;  4DR4 B;  3LSU A;  1DLB A;  3K5L A;  2Z0A A;  1YDX A;  2A3Q A;  5H2F Z;  1QVF U;  4GX5 A;  3CS5 A;  2MW2 B;  1B3Q A;  3BPZ A;  2HR3 A;  2P7T C;  3HKE B;  5KHH A;  1FXK B;  4HNA B;  2VWK A;  1R6K A;  3G6B A;  2WLM A;  3KZI Z;  1IDS A;  1KMI Z;  3VOU A;  1G6U A;  3W7T A;  1GN3 A;  1JNB A;  3SPJ A;  2ATK C;  2B9Z A;  4EKW A;  5JVD B;  3ZMT A;  5J2T B;  1Q3E A;  3W7U A;  2YI8 A;  3DC6 A;  4ICG A;  4OX9 O;  3ZJZ A;  3P32 A;  1M90 W;  1XIL A;  3AG7 A;  4ZOL B;  2QDO A;  2HVJ C;  4K35 A;  5CB4 A;  4OX9 B;  1MSW D;  5B3S C;  1JVM A;  3ZIA G;  3QO5 A;  2PF4 E;  5LOV A;  1ZWI C;  1N32 O;  3SPG A;  2UU9 B;  4R8C A;  4H37 A;  5JH7 A;  3I55 V;  2OWO A;  3HPL C;  1AJQ A;  2M7W A;  3F5W C;  2GV9 A;  3ZMS A;  3ICX A;  2YEV A;  4CBC A;  4L87 A;  1XMQ O;  2RMK B;  3T1H O;  2X6C A;  2QEX V;  1XBL A;  2XAQ A;  1AP5 A;  1SQP H;  1SS3 A;  3SGI A;  4X66 O;  1KQS U;  3ASN C;  5KHJ A;  1T5E A;  3QO7 A;  3T1H B;  3LDC A;  1TUB A;  1VQ4 V;  1M93 A;  3F7V C;  3ZHU A;  4JTC B;  4CC5 A;  4UB6 Z;  3JAW A;  3X2Q C;  4LFC O;  4TQD A;  1GAX A;  5B1A B;  3IAY A;  1NU1 H;  2VRZ A;  3FB7 C;  4I0X B;  2BSK B;  1ZL8 B;  3FFQ A;  4QNH B;  2DN9 A;  1RPR A;  2D2C B;  2BTQ A;  4ASU G;  2LP7 A;  4QPJ A;  2Z5U A;  5LGT A;  3CCS V;  2PTM A;  1MG1 A;  4U3F H;  1NI8 A;  2QE7 G;  3MD0 A;  1X4T A;  4DR2 O;  2IH3 C;  1UJW B;  4IYI A;  5J2U B;  1TA8 A;  1YIJ V;  3JAL B;  1VQ8 V;  2B1G A;  3HKD B;  1VF6 C;  2FML A;  2E76 B;  1S5L Z;  2DE0 X;  2F66 C;  4EFE A;  1TVK B;  5LYJ A;  4YJ3 A;  1PV0 A;  2CTQ A;  3ETG A;  3JAR A;  1SQF A;  1SES A;  4DUZ B;  2Z3Y A;  2MK3 A;  4NVP A;  5KUK A;  5LP6 C;  5H6Q A;  1NTM H;  3RYF A;  4MVR A;  3L75 H;  2XAS A;  1PKX A;  4WBN A;  1NZ6 A;  4FLW A;  2XAG A;  3OMA B;  4U3J A;  1XNR B;  1EZJ A;  4X1K B;  3GWK C;  1S77 D;  4F6R A;  4KP4 A;  1WAZ A;  2EUL A;  4YJ2 A;  3E8B A;  5LXT A;  4W4K A;  3C3S A;  4PA4 A;  1VQ7 V;  1VQ5 V;  5IJ9 A;  1RSO A;  4DV7 O;  1PPJ H;  4QPK A;  4Z1V A;  2KB1 A;  1JFF A;  4JI8 O;  2R9R B;  5CA0 A;  3ABK C;  1Q5O A;  4OPH A;  1FYJ A;  1I7F A;  3D8C A;  3CCE V;  3CD6 V;  2XAH A;  1FD9 A;  3A2F A;  4NR1 A;  5IWA B;  2HJD A;  5LOV B;  4TUY A;  3ETQ A;  4BIO A;  1Q81 W;  5LA6 B;  3OGI B;  4NXN O;  2IM9 A;  1N36 B;  4FLU A;  1KC8 W;  2EIJ C;  2R70 A;  1D5N A;  2R9A A;  2YEV B;  4BIU A;  4NXN B;  1IBK O;  2YIB A;  1P49 A;  1E79 G;  2LGW A;  4WFG A;  4X62 O;  1M57 C;  5FNV A;  3MHS C;  3E89 A;  1GM8 A;  5KA5 A;  1JPX A;  4DV0 B;  1IBK B;  4GKJ O;  1TUB B;  3CRM A;  1NVP D;  2F4V O;  2QWN B;  4MT8 A;  5L3G A;  1CPY A;  1F4N A;  1N33 B;  3CRQ A;  1P4R A;  3ZMZ A;  2AW9 A;  4UVB A;  4DO2 A;  4X65 O;  4GKJ B;  1KU9 A;  4DR6 B;  2XOK G;  5IYZ B;  1OCC B;  1S3J A;  2Q7E A;  3UT5 A;  2GBO A;  4K8Z A;  4D7T A;  1PL4 A;  4LF7 O;  2NR5 A;  1JX9 A;  1Q43 A;  1OJH A;  4CH5 A;  3ZCC A;  4LF7 B;  4FLV A;  3AG1 C;  3ABL B;  3ZHT A;  2QGN A;  2IH1 C;  5BR8 O;  1F51 A;  1YVW A;  3CE2 A;  3H9V A;  1FXH A;  3T4D A;  1XI1 A;  4JI6 O;  4JI7 O;  5LYJ B;  4UUJ C;  4B3T O;  1GO3 F;  4YJ3 B;  2W0X A;  5DN6 G;  2KG7 A;  5BR8 B;  1WNS A;  2WLK A;  3CCM V;  2OYQ A;  2IJK A;  3S3W A;  1IBM O;  3LDD A;  2UXX A;  3CJH A;  4JI6 B;  4BAY A;  4JI7 B;  5B1O A;  1W0J G;  3I5D A;  2YIA A;  1FAF A;  2NLJ C;  4WBN B;  2N04 A;  3L72 H;  4ZKI A;  4U3J B;  2K9P A;  2F43 G;  1IBM B;  2QM4 A;  2E3C A;  5DM6 V;  2CGN A;  3RBZ A;  1TAE A;  3N2K A;  5IJ9 B;  1RSO B;  4O4I A;  1N0J A;  3ABT A;  1SER A;  4PA9 A;  1QCE A;  2P4K A;  3HR0 A;  5L3B A;  1V9P A;  3ZX6 A;  2A79 B;  2PYL A;  4LFB O;  5H5N A;  1K3E A;  3E22 B;  5B66 Z;  3E8H A;  4TUY B;  3HKC A;  1IUR A;  4B3M O;  1R73 A;  3BAB A;  4ZHQ A;  4LFB B;  2LO1 A;  1KP3 A;  2ZE6 A;  5DED A;  2KKW A;  1WB7 A;  3RYH A;  2PYJ A;  4UXN A;  3GVM A;  2D3O W;  4GX1 A;  1RP3 B;  1SRY A;  2YS8 A;  3BRC A;  2ZXW C;  3MDS A;  2XAJ A;  5KAI Z;  2AGA A;  3ZN1 A;  1ENV A;  1UFI A;  2DYR C;  3OFN G;  4DR7 O;  3ETE A;  1VQK V;  1FJG O;  1PNL A;  5KMG A;  2EIL B;  4I50 A;  2ZE5 A;  3R66 A;  3CRA A;  1FFX B;  3E83 A;  4E4E A;  4FLY A;  1BHA A;  3TXQ A;  5A9G A;  4J9Z B;  5B1B B;  3OAA G;  3BCC H;  3H1H H;  3FAV A;  2JIZ G;  2QKC A;  2ZCE A;  4UCR A;  5HFM A;  3NR7 A;  4DV4 B;  3RYC A;  4BW9 A;  1EN4 A;  3W7X A;  1XHZ A;  1M5I A;  1K33 A;  2V4D A;  1R6T A;  3LNM B;  3K5O A;  3AG2 C;  2H94 A;  4YY3 O;  3GWO A;  1L8D A;  2EZP A;  3K5N A;  3P30 A;  4RWU A;  1SZX A;  1KBH A;  4JAS A;  4YY3 B;  3FB5 C;  1M1K W;  3L73 H;  4DV5 O;  3CJH B;  1BE3 H;  1Y76 B;  3UCS C;  3HKE A;  1AP6 A;  3BY6 A;  3WG7 B;  1CP9 A;  3ZRV A;  3H1K H;  1YJ9 V;  1H2K A;  4P30 A;  4TWK A;  3EHB B;  3WB2 A;  1YIT V;  2ZIN A;  3ZED A;  3RYI B;  1YF2 A;  3C3T A;  2QTS A;  5GTH Z;  1AR4 A;  3M8A A;  1YJW V;  1I0H A;  3N2K B;  2HKO A;  2ZNI A;  1B04 A;  3K06 A;  1CEZ A;  1B6Q A;  1I5X A;  5JVD A;  5J2T A;  5KHG A;  4UCT A;  1K5Q A;  2G38 A;  3UQ8 A;  4I4T A;  4AIL C;  1TGO A;  4N23 A;  2ZDI A;  4X9Q A;  2QA4 V;  3E8F A;  4ZOL A;  4WFB V;  2F23 A;  4DV3 B;  2Q68 A;  3JCZ A;  5B3S B;  4MSW C;  1GN2 A;  5KHI A;  5BY1 A;  3ZRX A;  3HKC B;  3AG3 C;  4X88 A;  1GRJ A;  4FZ1 A;  4AQY O;  4DK1 A;  3RYH B;  1BS3 A;  1HR0 B;  1VQP V;  2VQE B;  3E35 A;  2BTO A;  4AQY B;  1V55 C;  2C2A A;  3IGA C;  4GT1 A;  4LF8 B;  5IDJ A;  2YSU B;  2Q69 A;  4R6Z A;  1EBO A;  5LMN B;  1PP9 H;  4I55 A;  4PJ0 Z;  5KMG B;  1KEC A;  2GTS A;  2PUS A;  1OV9 A;  2QTO A;  3E2E A;  3JD4 A;  3APQ A;  3JSN A;  1VQN V;  3X2Q B;  4I7Z B;  2ZNJ A;  1XNQ O;  2JS3 A;  5CA1 B;  3SYA A;  2N05 A;  5CBF A;  1OCR C;  3JYC A;  1P84 F;  4I0X A;  3JD3 A;  2BSK A;  4CS2 A;  1ZL8 A;  1XNQ B;  3UKM A;  4JI3 O;  2EJ7 A;  2YI9 A;  4U7N A;  1B06 A;  3F5T A;  4NKG B;  5JJJ B;  4FLT A;  1OCO C;  3OE7 G;  3E86 A;  3VQV A;  3VQX A;  4JI3 B;  5LGN A;  1GTO A;  2OIG A;  2WPD G;  5EBL C;  4P9P A;  5J2U A;  1ZTE A;  2ARH A;  4I9W A;  2P22 C;  3HKD A;  1LR1 A;  2OCC C;  5EIB C;  1TVK A;  3B8N A;  4DYL A;  1ZSP A;  5IY5 C;  3ZN0 A;  1W59 A;  2GTA A;  5JCO A;  3RW0 A;  2WAM A;  3OMN B;  4DV1 O;  4KHP O;  2LQT A;  1VP7 A;  3PJS K;  1KKD A;  1IXM A;  1SKV A;  2KQX A;  1Q90 D;  1EZV H;  4KHP B;  4X1K A;  3G6E V;  3B8M A;  1I08 A;  3G71 V;  3UM7 A;  2ETN A;  2R9I A;  3WB1 A;  3OMI B;  2CAZ C;  3ABU A;  4UFZ A;  1KD1 W;  2P67 A;  5H6R A;  4I4T B;  4JYY A;  4ZIB A;  4LH7 A;  2HHH O;  4DUY O;  1IBL O;  1FOU A;  3LSS A;  2EJR A;  2A06 H;  4Q6G A;  4PA3 A;  2AHY A;  4QJF B;  2O57 A;  4Q20 A;  4UV9 A;  2FKX A;  4DW0 A;  1QNM A;  2BE3 A;  1HW7 A;  5LA6 A;  4JTD B;  3QO8 A;  2UUA O;  2VQF O;  4HZ3 A;  2LGQ A;  3JSL A;  2Q9L A;  1PM9 A;  3VBB A;  2EIJ B;  3JAK A;  1AJN A;  2XAF A;  1K34 A;  1OHH G;  1URF A;  1IX9 A;  5IJ0 B;  3UO3 A;  2IW5 A;  4WFA V;  1ZX3 A;  2UUB O;  1M57 B;  1N32 B;  4FLZ A;  1GK9 A;  3KKY A;  3SYP A;  3GB7 C;  2JJ2 G;  3K3W A;  2JDI G;  4MVQ A;  5EIB D;  3A8T A;  4I55 B;  2OTL V;  3E8G A;  1Q6H A;  1XMQ B;  4XDK A;  1H2L A;  3B2E E;  1AI6 A;  4X66 B;  1SZT A;  2YIC A;  2DW4 A;  3B4S A;  4B3S O;  4FFK A;  3L71 H;  4RO2 A;  3OW2 U;  3F7Y C;  2EZO A;  3ZHS A;  5IYZ A;  4KFM A;  1VMG A;  4TT3 G;  1KUQ A;  4LFC B;  3A0H Z;  4MVZ A;  1SF9 A;  4O4J A;  3CCV V;  5IT9 N;  1AI5 A;  4J41 A;  3UO2 A;  4MW8 A;  3K9A A;  3AG1 B;  4LF5 O;  1QVG U;  1BHB A;  2NNU A;  1G8M A;  2CTR A;  1DK1 A;  1L1F A;  4FMT A;  3OT7 A;  2V7Q G;  3ABM C;  2Q0O C;  1H2M A;  2HJF C;  2HP8 A;  5FPO A;  1O9H A;  5JWP A;  4LCU C;  4EB6 A;  2Q73 A;  4B7E A;  5EZY B;  3CRR A;  4DR2 B;  1IXB A;  4JTA B;  4MW3 A;  3T2M A;  1SQG A;  4H13 B;  5LHH A;  5K1P A;  1WPX A;  4J7Z A;  3CSX A;  3KCX A;  2JS5 A;  4MTG A;  2ZT9 B;  1XOU A;  3DTU B;  4OPA A;  1K92 A;  2ZE8 A;  3RVZ A;  4QIW F;  1AJP A;  2UUC O;  4ABM A;  1G4Y B;  2P06 A;  2AZ0 A;  4RUE A;  4O2A B;  4UCU A;  1VF5 B;  1FXK C;  1H2N A;  2JGD A;  1PD3 A;  4XBF A;  2ZIM A;  4RQF A;  4DV7 B;  3BA9 A;  4JV5 O;  1W0K G;  1I5Y A;  2GUZ A;  2PI4 A;  2YDE A;  2Y48 A;  2DWE C;  4JI8 B;  2P5O A;  3E22 A;  3BHP A;  1EFR G;  3ZHQ A;  2CH7 A;  5EBM C;  3C90 A;  1VQO V;  1XMO O;  3QNE A;  4H33 A;  3OTF A;  4B3R O;  5JJN B;  3QF7 A;  3JAK B;  4X89 A;  4F4L A;  1R3L C;  2ZXW B;  3SR2 C;  4O4H B;  4P2Z A;  2EIN B;  3DXR B;  2FB5 A;  2E75 B;  2GHY A;  1AI7 A;  2DYR B;  2N74 A;  1S5H C;  3BAA A;  5JJE B;  5DEC A;  4DV2 O;  4X62 B;  5FPR A;  2JK5 C;  1QHT A;  5GTI Z;  1VQ9 V;  2JEU A;  1FFX A;  4XDJ A;  2UXN A;  2GDS A;  3SJB C;  1P7B A;  1WN7 A;  2EBO A;  1L0N H;  5D5P A;  2F4V B;  2Q7H A;  3Q4H B;  2ZR2 A;  4O4J B;  5L3E A;  2ZQM A;  4X65 B;  4F6E A;  4NYK A;  3K5M A;  3L74 H;  2ZE7 A;  3K9S A;  3OGC C;  2CGO A;  1O9G A;  4MVU A;  3G4S V;  1QLN A;  3AG2 B;  2ODM A;  5C93 A;  3U10 A;  1HNX O;  2QWP B;  1R3I C;  4EB6 B;  3CC2 V;  1VQ6 V;  4GX0 A;  1N8R W;  1U97 A;  3WU2 Z;  4LNU B;  1HNX B;  5HFL A;  4PA7 A;  1XRE A;  1SQX H;  2Y0I A;  4UB8 Z;  4B3T B;  1Y76 A;  4IIJ B;  2P90 A;  1Y67 A;  3OD4 A;  1LUV A;  4IHJ B;  2HLD G;  2WA3 A;  1IZ3 A;  3RYI A;  2YUA A;  3HKB B;  2AHZ A;  2XT9 A;  4MS2 A;  5BZB A;  1HDJ A;  1ZLZ A;  2X6B A;  4DRX B;  1LNQ A;  3OUS A;  3ZHV A;  4D7S A;  4YIP A;  2JGD B;  3OTO O;  3RWR D;  4X1Y B;  2DOS A;  2WLI A;  1DF5 A;  2UXC O;  1E1Q G;  2GUZ B;  4Z2W A;  4GUN A;  1AR5 A;  4GCZ A;  1CXZ B;  4TV9 A;  2UXD O;  1YHQ V;  4XDL A;  2CH7 B;  1V54 C;  3JCU Z;  3AG4 B;  4B7K A;  5ITZ B;  1KKC A;  2Y69 B;  2UXD B;  2L6L A;  4L8J A;  4WF9 V;  4G28 B;  4B3M B;  1V55 B;  4HAM A;  4DV6 O;  4LP8 A;  4MTO A;  1COW G;  3THO A;  3CHX A;  3QVN A;  4LBE C;  5KLV H;  1WP7 A;  1WLE A;  3DC5 A;  1S72 V;  2CTW A;  2RN9 A;  3CXH F;  3RFR A;  3K08 A;  1S76 D;  2Q0A A;  1JJO A;  4OXS A;  2XUM A;  4DR7 B;  1OCR B;  4CC6 A;  1FJG B;  5CA1 A;  4DR1 O;  4JZG A;  2E5L O;  2P6J A;  1JJ2 U;  4A5U B;  1ORQ C;  5JQG A;  2Y0P A;  4PDV A;  1YZB A;  4DR1 B;  1FS0 G;  1BGY H;  2E5L B;  1ROP A;  2YXY A;  4JYA O;  4IGG A;  3SPI A;  2Y4U A;  3OUF A;  1I94 O;  1DTO A;  4R7C A;  4BIZ A;  3JAT A;  2ZM6 O;  3KCY A;  3N2G A;  4YHH O;  4JYA B;  1JR9 A;  1SA0 A;  2DYS C;  1VF6 A;  3PN1 A;  1I94 B;  4DR3 O;  3ZRW A;  3FKS G;  2OCC B;  2ZM6 B;  4CH4 A;  4PHZ A;  5CBH A;  4GKK O;  2FYU H;  4ZI7 A;  4U7O A;  1J95 A;  1RFY A;  3A0R A;  1R6N A;  5LP6 A;  4DR3 B;  1BMF G;  1R1B A;  2LW7 A;  3H1J H;  1K5S A;  1JOY A;  1GN4 A;  3SPH A;  3JAM N;  2JEX A;  5TIS Z;  1S0V A;  4DV5 B;  3CEI A;  3TJT A;  2RNB A;  2WLL B;  4FVM A;  2OIE A;  4JZ2 A;  2FL4 A;  5LGU A;  2OTJ V;  3CC4 V;  4P9O A;  2W6I G;  4BWA A;  4FK5 C;  2XTA A;  4JI5 O;  4LC1 A;  1H2S B;  5KA6 A;  3FX7 A;  4IYH A;  3W7W A;  2OT5 A;  1M56 C;  2WLI B;  3RGB A;  4LF4 O;  2QSA A;  2P4V A;  4LF9 O;  2IU0 A;  1QLE C;  2Y4T A;  4TV9 B;  1GKF A;  1FPO A;  2WWW A;  3JD1 A;  4LF4 B;  2IJH A;  3G80 A;  4LF9 B;  1YCI A;  2CTP A;  3T1C A;  2WLN A;  4DR5 O;  1NH2 D;  1BCC H;  1N4C A;  5KX5 A;  3SJA C;  1N34 O;  1M4U A;  2DJV A;  3JAS A;  4J11 A;  2VWJ A;  2JVD A;  5IJ0 A;  1XUQ A;  3K0G A;  2DQ0 A;  4DR5 B;  5EYP B;  5K1X A;  3ASN B;  1GM9 A;  4EFB A;  4MVM A;  1Y74 B;  3OR6 C;  4UV8 A;  3ZBH A;  2CK3 G;  1EN6 A;  4FJC C;  1WA8 A;  4FIP C;  3CME V;  1YJN V;  5KHK A;  3APO A;  1BQZ A;  2PZS A;  4FZ0 A;  4FLX A;  5JQG B;  4JAV A;  2ADQ B;  1M9N A;  3TGU H;  2WSS G;  3CCQ V;  4D6T H;  3SPC A;  2EIL C;  3VQY A;  3JAT B;  4LFA O;  1NR1 A;  3N2G B;  4MVS A;  5EBW C;  1SA0 B;  5B1B C;  2JRI A;  3H1I H;  4PD4 F;  4LFA B;  2IJJ A;  2LFS A;  4MVO A;  3ZRW B;  2DWD C;  3TET A;  5EZY A;  4ZI7 B;  3OEE G;  1NVP B;  5LP6 B;  2ADP A;  2PY5 A;  2ITC C;  1K4D C;  3P3P A;  3SYO A;  5A2Q N;  3K0D A;  4X1I A;  5H9C A;  1SET A;  3OEH G;  2W0F C;  4JYB A;  4FPP A;  4DV1 B;  1SQQ H;  3O65 A;  5FL7 G;  4I9Q A;  1Q7Y W;  4O4L B;  4GYC B;  5BMV B;  3TK1 A;  1YXB A;  3DSQ A;  4B08 A;  4NB5 A;  4AHC A;  1ZUQ A;  2F1M A;  3ABK B;  4O2A A;  3B77 A;  3WG7 C;  2YID A;  1YTF D;  2YIB D;  4QE9 A;  5B1N A;  1W2B U;  3K59 A;  1VAR A;  2HHH B;  4DUY B;  2AZ2 A;  1OCZ C;  1IBL B;  1BSM A;  4PDR A;  3D3I A;  1R3K C;  1Y6X A;  3I56 V;  3DGE A;  3RT3 C;  3ASO C;  3B09 A;  4W4L A;  2EIM C;  3CX5 F;  4JAA A;  2QKA A;  5KUM A;  3H01 A;  4O2B A;  2PGG A;  5KX5 B;  3JAS B;  1YI2 V;  5CA3 A;  2IBZ H;  4O4H A;  3BEH A;  2UU9 O;  2UUA B;  1GMG A;  3DXR A;  2VQF B;  1F7Y A;  4UVA A;  5EC1 C;  4NXM O;  1KYO F;  2GSM B;  1BZK A;  2UUB B;  3QTC A;  5AG2 A;  2QJ1 A;  2RCV A;  2H8P C;  1U96 A;  4H0L B;  3MHH C;  2IU3 A;  5C8Y B;  2Q8V A;  3CWB H;  4NXM B;  1H5W A;  1YSC A;  4X8A A;  1GN6 A;  1LUW A;  2QM8 A;  2BCC H;  1WA8 B;  3J7A U;  1UPG A;  3Q4H A;  4PV1 B;  4TQF A;  3O9O A;  3CPW U;  4X64 O;  4LWS A;  4GX2 A;  4B3S B;  1MAB G;  2A9H A;  3T4Z A;  3B40 A;  1AB3 A;  4WFH A;  4X64 B;  4MTF A;  5LBQ A;  3CCJ V;  4GLX A;  4MTX A;  1JCH A;  2EIK C;  4E2L A;  3CCU V;  3STL C;  4PA6 A;  2LFR A;  4IT5 A;  4LF5 B;  4H44 B;  1AI4 A;  2WLH A;  3J81 N;  4G2K A;  4TV8 B;  1RM1 C;  2BOB C;  4LNU A;  4X1I B;  2M6Y A;  3SYC A;  2ZIO A;  1NTZ H;  1QBZ A;  4IIJ A;  2A7W A;  5KAF Z;  2RQ6 A;  1PNM A;  4DW1 A;  4DUZ O;  1PL0 A;  4UVC A;  5EK0 A;  3EXA A;  4IHJ A;  4QE7 A;  3HKB A;  1VEW A;  5J9P C;  1GH6 A;  1XNR O;  1K8A W;  4DRX A;  2KSD A;  4JAU A;  4RAI A;  2R72 A;  5F2V O;  3CXC U;  4X1Y A;  3D36 C; 
#chains in the Genus database with same CATH homology
 1ZSP A;  4YIP A;  3BFR A;  1GN3 A;  3AK2 A;  1GN4 A;  3MDS A;  5AG2 A;  3AK1 A;  2RCV A;  3DC6 A;  1PL4 A;  4C7U A;  1P7G A;  4X9Q A;  4GUN A;  1AR5 A;  3EVK A;  3CEI A;  1XIL A;  3TJT A;  1GN6 A;  1GN2 A;  1LUW A;  4JZ2 A;  1I08 A;  1KKC A;  3OT7 A;  1MA1 A;  1EN5 A;  2GDS A;  3RN4 A;  4E4E A;  1MSD A;  1BT8 A;  3IC9 A;  5A9G A;  2CDY A;  1N0N A;  2ADP A;  3C3S A;  1BS3 A;  1IXB A;  4JYY A;  3QVN A;  2QKC A;  4F6E A;  3K9S A;  3KDR A;  3DC5 A;  1EN4 A;  1XDC A;  2CE4 A;  1MMM A;  1AP5 A;  1QNM A;  4JZG A;  1JA8 A;  1ZUQ A;  1PM9 A;  4YIO A;  3AK3 A;  1XUQ A;  1EM1 A;  1N0J A;  1IX9 A;  1SZX A;  2P4K A;  3LSU A;  1XRE A;  3KKY A;  1D5N A;  1Y67 A;  1B06 A;  1VAR A;  1BSM A;  1LUV A;  1AP6 A;  1MNG A;  1WB8 A;  4BR6 A;  1JR9 A;  1VEW A;  1EN6 A;  2QKA A;  1AVM A;  3C3T A;  1ZLZ A;  1AR4 A;  1ZTE A;  4FFK A;  1I0H A;  1IDS A;  2AW9 A;  1WB7 A;  2ADQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...