4JZ2A

Crystal structure of co ion substituted sod2 from clostridium difficile
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
202
structure length
202
Chain Sequence
NNKFKVKPLPYAYDALEPYIDKETMKLHHDKHYQAYVDKLNAALEKYPELYNYSLCELLQNLDSLPKDIATTVRNNAGGAYNHKFFFDIMTPEKTIPSESLKEAIDRDFGSFEKFKQEFQKSALDVFGSGWAWLVATKDGKLSIMTTPNQDSPVSKNLTPIIGLDVWEHAYYLKYQNRRNEYIDNWFNVVNWNGALENYKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Crystal structure of Co ion substituted SOD2 from Clostridium difficile
rcsb
source organism Clostridium difficile
total genus 71
structure length 202
sequence length 202
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2013-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4jz2A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4jz2A02
1GN6A 1IXBA 1B06A 3AK2A 1AR5A 1SZXA 2RCVA 2ADPA 1MNGA 1ZUQA 3C3TA 1EN4A 4JZ2A 1IX9A 3OT7A 3MDSA 3TJTA 2P4KA 1MA1A 1PM9A 1PL4A 1XREA 1IDSA 1VARA 1GN3A 1KKCA 1EN5A 1JR9A 1MMMA 1BS3A 1I08A 1I0HA 3KKYA 1LUVA 1N0JA 1XDCA 4YIOA 1EN6A 3IC9A 1XILA 1ZSPA 4GUNA 3DC6A 4C7UA 4X9QA 1GN2A 3LSUA 1AR4A 5AG2A 4FFKA 1AVMA 1GN4A 2GDSA 3EVKA 5A9GA 1VEWA 1Y67A 4JYYA 3AK3A 3RN4A 1BT8A 1XUQA 1ZLZA 4F6EA 3CEIA 1D5NA 1AP6A 3AK1A 4E4EA 4YIPA 2QKCA 2QKAA 2ADQB 3DC5A 1WB8A 3QVNA 3K9SA 1JA8A 4BR6A 1MSDA 1ZTEA 2CDYA 3C3SA 1QNMA 2AW9A 1WB7A 1EM1A 1BSMA 1P7GA 1N0NA 3BFRA 4JZGA 2CE4A 1LUWA 1AP5A
chains in the Genus database with same CATH superfamily
5EBWC 1GN6A 2OTLV 3H01A 4IIJB 2R72A 3LSQA 4PA9A 1MNGA 1JCHA 4YJ2B 1B3QA 4OGQB 4JI1B 1EN4A 1ZX3A 1VF7A 2GUZA 3AG3C 4X89A 3JD1A 1MOFA 2WSSG 1K3EA 4LC1A 1GMGA 3IJ4A 1EN5A 1I08A 3JATA 2HHHO 3JASA 2GBOA 2WPDG 3ABMC 1QHTA 2YEVB 3ETQA 4TT3G 4H13B 4NR1A 1N33B 1RFYA 2LJ2A 4GT1A 3HR0A 5JCOA 3DGEA 4X64B 4LNUB 2E75B 1VQKV 1F7YA 4LF7O 3CRQA 4L8JA 1R6KA 1ROPA 3RYCB 2FL4A 4J10A 4EFBA 2EIMC 4X1YA 3AG1B 3CC7V 1IZ3A 1Y76A 3IC7A 4ZIBA 2F66C 4FLUA 1R6NA 2PI4A 5B1OA 2Z5UA 3ETEA 1BCCH 3BAAA 4EFEA 4JV5O 3K5OA 1TUEB 2JGUA 2Y4TA 2DYSB 1YITV 3SR2C 4H44B 3CE2A 5BR8B 3TXSA 4UVBA 3K59A 4DR4O 1QLEB 1H2SB 4DV3O 4ICGA 2EBOA 3VQYA 1M9NA 3LDEA 5J2TB 1J5EB 4TV9A 2WLNA 1SZXA 1US6A 2P67A 2WLIB 2KG7A 1AB3A 3D3QA 1Q8IA 5H6QA 4B3MB 5B1AB 4LFBO 1X4TA 2OT5A 3TJTA 1AJQA 1MA1A 3CS5A 3E86A 4DV7B 1GM8A 3FB5C 2DWDC 3D8CA 1NJIW 1E1RG 5LP6C 1ZAUA 2N05A 1V54C 3C90A 4DW0A 4U7OA 2F93B 3ZRVA 5LA6A 4QGPA 4DR6O 3SPHA 4B3RB 1BS3A 3P3NA 1FYJA 3KKYA 5GTIZ 3ASOB 4J41A 1LUVA 2UUBO 1XDCA 3UQ8A 5DM6V 2E5LO 1XILA 5FNVA 3FAVB 2YC0A 5JQGA 2LW7A 2DMXA 3LSUA 3I55V 3ETGA 4NXMO 3T1YO 5J2UB 3FX7A 1K34A 1F4NA 2HR3A 3RYHB 3K04A 3T1HO 2JS3A 4E2LA 2VS0A 4K8ZA 5EYPB 2EILC 3CMAV 4JI7B 5IE9A 4JI5O 3RYIA 1I94O 4J42A 2UU9O 4CZZA 3L74H 2X0LA 2YDEA 1PP9H 4UCOA 2XNDG 1Q90D 2BSKA 2VQEB 3K9SA 5K1XA 4I0XA 2Q7EA 1YI2V 5JVDA 3CCSV 1H2GA 3D3IA 3SYOA 2ZNJA 2QTOA 4JF3A 4DV0O 1THZA 2ZR2A 1SQXH 1NTMH 1WLEA 4IIJA 2HFEC 2IH1C 1VP7A 4YJ2A 4CC5A 4HYOA 3MHHC 4U3FH 1BZKA 2WAMA 5FLXN 1IXMA 2PY5A 1IBMO 1GKFA 4PI2A 2ILMA 4ZOLB 4DR2O 2PI5A 1OCZB 4CBCA 4RUFA 2QM8A 3OEHG 2F95B 2XAJA 2ZDIC 1VQLV 3HKBB 4JI6O 2P22C 5LBQA 2OYQA 4WFGA 1HNWB 2EIJB 3STZC 4DR5B 1VF5B 4TWKA 4PI0A 2ZE7A 2KSDA 3SYPA 4LF6O 1K5QA 3RBZA 3OR7C 2ZT9B 4AQYB 1FAFA 4G28B 2WLLB 2YSUB 4BAYA 1N8RW 1OCOC 5LYJB 3LUTB 4KP4A 2H94A 5EBLC 2UUAO 1PPJH 1D5AA 3OMNB 1W0KG 1AJPA 4B3TB 1SF9A 2IJHA 4J9ZB 3S3WA 3WB1A 1Y4MA 3CWBH 3I56V 2ZIOA 4FLYA 3OGIB 1XHZA 2YI8A 2JDIG 4JI3O 5KHGA 2ZM6O 1G8MA 4IGGA 1XNQB 3K0GA 3QO5A 2JJ1G 1I5XA 1JA8A 2KKWA 3D36C 5LL6Y 3C3SA 2EILB 4NYKA 1YSCA 1Y74B 5IY5C 1SERA 1QVGU 4F6RA 2YI9A 3A8TA 4DYLA 4DR7B 3UT5B 3H1KH 5J2TA 3H1LH 1WP7A 2LFSA 1CXZB 3BFRA 4JZGA 3CD6V 4O4HA 2Q67A 3BA8A 4JAAA 2WLIA 2JEXA 2JVDA 3FFQA 3JALA 4WFEA 1ZUQA 3FKSG 4LFCO 3C3TA 3UCSC 2HG5C 3OM3B 3E22B 4X66B 4GKJO 4JI8O 4ZHQB 3O65A 1GAXA 2RQ6A 5CB4B 4ZKIA 2AGAA 3SPIA 3VOUA 2G38A 1R3LC 4WCEV 2XAFA 3FAVA 4D6TH 3TXQA 1X59A 2ZXWC 4RQFA 1KP3A 3QF7A 1IURA 2R70A 4CS3A 3RYHA 3CRMA 1B04A 1ZL8B 4YJ3A 4JI0O 1R3KC 2Y48A 1N34O 4LF9O 1Y67A 5LHGA 3X2QB 1JFFB 1F23A 3E8BA 3AK1A 3ICXA 4D7SA 1OCOB 1DGSA 2Q9LA 4PDRA 1OV9A 3DC5A 4WFAV 4PA3A 1EZJA 4JYAB 1DK1A 3JAKB 2AW9A 4QNHB 2CH7B 4N23A 2PGGA 3A0HZ 1XOUA 3JD3A 4PDMA 3SGIA 1FJGB 5FPOA 1J95A 2A9HA 1S5JA 2A06H 1IBKB 5HFLA 2XOKG 1YVWA 2NN4A 1R3JC 3NR7A 3AG4B 3ZRXA 4ZOLA 1XL6A 5CA0B 1PV0A 3ZN0A 4DV5B 2LGQA 3N2KA 3CSXA 5A2QN 5E1AC 3HKBA 2B5UA 5IYCO 1K8AW 4HZ3A 1B6QA 3ZHRA 1I0HA 5KHHA 3U10A 2YIBA 4IYHA 1BHBA 2W0XA 1K73W 1HP8A 2LO1A 3A0RA 2WLLA 4BIZA 1H2NA 1GH6A 2RNBA 4MTOA 1MG1A 1OCRC 4DR1B 1FS0G 4DR3O 1XMOB 3SJCC 1RM1C 1YXBA 2EULA 3Q4HB 1VQOV 5CBFA 4GKKB 2GTAA 1RPOA 1CP9A 3AEIA 2QWNB 4O4LB 2ZXWB 2P7TC 4ASUG 3OAAG 1ZLZA 3ZS8C 3HKDA 3SYQA 2CK3G 4D7TA 4E4EA 1BMFG 2F1MA 2XHBA 3OTFA 4MVZA 4NTYA 5KX5B 1N33O 5ITZB 2ITCC 2ARHA 4MTXA 4RAIA 2YIBD 4H37A 1MSDA 1E1QG 1LNQA 3UO2A 3UT5A 1D2DA 1EM1A 3W7WA 4FIPC 2BTQB 3GB7C 4X64O 4LFAB 4GX2A 2LQTA 3N27A 4JAVA 5CA1B 1A32A 1HDJA 2DOSA 3M99B 1ZWIC 2LP7A 4DRXB 2NLJC 3L9DA 3RWRD 1FXVA 2Q0OC 3ABTA 4R6ZA 1Y6XA 2IJJA 2Q0AA 2OCCC 4YY3B 2N04A 2DQ3A 4JYBA 4ZHQA 4GX1A 5CN0A 5LXTA 3L70H 1V55C 5LHIA 1OCCC 4J7ZA 2Q7HA 4L87A 1KC8W 2Q7GA 3WFVA 5BR8O 3STLC 3SPGA 1KECA 3ABUA 3WB0A 1L0LH 4X20B 3ZHQA 2BTOA 3KCXA 1FXKA 4UB8Z 4X8AA 1N0JA 3LNMB 2A79B 1J5EO 1YJWV 4MVMA 3K03A 1ZSPA 1FKAO 1JJOA 3WG7B 3OE7G 4B3MO 3CJHB 2UXXA 2QWPB 2Y0IA 1ZL8A 4DV7O 1XI1A 2XAGA 5JH7B 3RYFB 4LBEC 3NXSA 2Q4PA 1S72V 1P4RA 1JFFA 1Y66A 2IM9A 2JS5A 1HNZB 3DTUB 4B3RO 3O9OA 3HPLC 1SQGA 1RSOA 4FM0A 1VMGA 5IJ0B 4OX9B 4O4IA 1NR1A 3J7AU 3OW2U 1WB8A 2DYRB 3QNEA 1N32B 1VQ8V 1VF6C 2CH7A 1YEWA 2F43G 4BW5A 2A0LA 3W7TA 2X6AA 1TUBA 3VQVA 4QJFB 2DE0X 1P7GA 5B1BC 2Y69B 2OWOA 3FD9A 1JPXA 3GVMA 4JI7O 1HNXB 3HKCB 4CC6A 4WFHA 2RCVA 3R65A 4PDVA 4CS2A 3CRRA 2QDOA 1RP3B 5EIBD 4LF5B 1BL8A 5E79Z 3HKEA 3B4SA 2PYLA 4X1KA 5EBMC 3FB6C 1NVPB 2AHZA 3ASNC 4I5SA 4UV8A 1M56C 1RPRA 2EIKB 3SJQC 4ABMA 2F4VO 1E79G 5LMNB 3CC2V 3VQXA 2QWOB 5IDJA 1WNSA 4MVQA 2UXBB 5D5PA 5LOVB 1VQ7V 1AROP 1JOYA 4YIOA 3B2EE 2K9PA 1V55B 4O2AB 4GYCB 3CMEV 2QWRB 3K79A 1NTKH 3DC6A 4NB5A 4TQDA 4NTXA 4UCVA 1JNBA 2CTQA 2O57A 1Q5OA 1BHAA 1SA0B 1FD9A 4AHCA 4O4LA 1S5LZ 1SQVH 2B1GA 3AG3B 4IHJB 4JYYA 1Z5WA 1BE3H 3LDDA 1QLNA 4FMTA 2QR4A 3ZRWA 4F6EA 5K1PA 2GTSA 1NZ6A 4O4JB 2HHHB 1HNWO 1EFRG 4DR5O 4WF9V 5ITZA 2DJVA 4HNAA 4JTAB 5KHKA 1SQQH 1KKDA 4TSFG 4W4LA 3SJAC 4EEQA 1JMKC 3ABMB 1NS1A 2YIDA 1N36B 1QR8A 2CUGA 2DWEC 2V7QG 5IJ9B 2L6LA 4FLXA 2BTQA 1WB7A 1V9PA 5CA1A 4K3AA 4RWUA 1XNRO 3H1HH 3BRCA 4DRXA 1I7FA 4DK0A 2QEXV 1F51A 3FB8C 3DXRB 1COWG 3K3WA 2ZR3A 5H6RA 3G6EV 2CTPA 3FB7C 4FK5C 4B3TO 4NXNO 2ZE6A 4FM1A 3APOA 5GONA 1VQ9V 4H0LB 1DTOA 1XNQO 3K57A 1TAEA 4JI2B 2EIMB 4DXWA 3JD4A 4XDJA 3TK1A 1NR7A 3FYEB 3SYCA 2WA3A 4X20A 4UCRA 4DV6B 3G4SV 5LGTA 4DR7O 3GWOA 2JEUA 4X65B 3AG7A 2QM4A 1Q6IA 4F4LA 2Q68A 4J7KA 3OR6C 5FPRA 1Q7YW 1H5WA 4FFBB 3CPWU 3KDRA 5IT9N 1Q6HA 4Z1VA 3GWKC 4P30A 4JI4B 3ABKC 3K58A 2IH3C 4LFBB 4X66O 5KUKA 5AG2A 3ZMZA 4JTDB 2MK3A 2YEVA 5DN6G 3S3XA 4DUZB 1YCIA 3P32A 2QTSA 5LP6B 1YHQV 3CCMV 1V54B 1UPGA 3M8AA 4JTCB 2QKAA 5B3SC 1QVFU 4LNUA 1H38A 1G4YB 4LR3A 3RW0A 1L1FA 3JSLA 4BR6A 2K1EA 3OD4A 4R50A 3RYCA 5KA6A 2Q5ZA 1KUQA 2ZINA 4MT8A 4MTGA 2JJ2G 5L3DA 3HKCA 2IBZH 4JGSA 1IXBA 4FLWA 4X62B 1G1XB 3P3PA 2UU9B 2JGDB 3KG2A 4TUYB 4I9QA 5JCOC 4X1IB 3MDSA 4P2ZA 4KXRA 1K4DC 3ZIAG 2DW4A 1PL4A 4JYAO 4LWSB 4H33A 2HKOA 1VARA 4UV9A 4DV2O 1KKCA 3F5WC 3JAWB 4B7KA 4B3SB 4WFFA 3B8NA 4UXNA 4O2AA 1FJGO 1SKVA 1BGYH 3VQWA 4RO2A 5LMUB 2B1IA 1GN2A 3B40A 4GLXA 1K9MW 1IBMB 1SA0A 4OPAA 1S0VA 4J9YB 1GN4A 2A7WA 3TGUH 2QSAA 4DV5O 5JWPA 5IYZB 5L3GA 4G2KA 2QM7A 2GV9A 1UJWB 3R66A 5KMGB 4CH6A 1NVPD 1MABG 3ZRSA 3F7YC 5J2UA 4PA7A 3CCLV 4MVUA 2QKCA 4DW1A 2ADQB 4GX5A 3H1JH 4LF6B 2RDCA 5LGNA 2E76B 1VQNV 4DR1O 5EYPA 2X6CA 3ZMUA 1K33A 4JPRA 4BWAA 1XMOO 3K5MA 2GUZB 2XAQA 4FM2A 1W59A 2UUAB 4UUJC 1XEQA 4P9OA 3K0DA 3MAQA 3RT3C 2RMKB 1KP2A 2KQXA 5LGUA 1GO3F 1FXHA 3G71V 2WLHA 2AZ0A 1KBHA 3JATB 4JI3B 3THOA 4R7CA 1IX9A 3JASB 1K5SA 4FVMA 1H8EG 1Q3EA 4DUYB 1JX9A 1HR0B 4J11A 4X88A 4I4TB 3ZMSA 3BY6A 3N2GB 1QR9A 3CC4V 4K8XA 2HP8A 4FFBA 5CBHA 4KL1A 5JJEB 4KUMA 5IY5B 5DECA 2E3CA 4LF8B 1MZFA 4MS2A 4U3JB 5EC2C 2N74A 4LF4B 3ETDA 4JI8B 1K7DA 1NH2B 1K4CC 3T1CA 3L75H 2GDSA 4I55B 1BQZA 3WB2A 5A9GA 4K0KB 5LP6A 3QO8A 4I50B 3OMAB 1YJNV 5LYJA 1NKDA 4JI1O 1AI7A 2H8PC 1QU7A 1XMQB 3U0ZA 1NT2B 3U11A 3OEEG 4TV9B 1KMIZ 1AILA 3JARB 4RQEA 3CXCU 1U96A 3RVZA 2CDYA 2KG7B 1M57C 2UXDB 4WFBV 4ZBMA 3LDCA 3TETA 4XDLA 1PNLA 1M1KW 3AG2C 2WLJA 1AI5A 1N34B 2ZQMA 2H3OA 4P9PA 2JGDA 1HNZO 1B06A 2M6YA 2P6JA 3OUFA 4TUYA 1W0JG 1EBOA 4JASA 2LW1A 3A0BZ 4X1IA 2CGNA 1WN7A 1Y74A 3H1IH 4OX9O 1LR1A 4YHHB 4UVAA 3RGBA 2ZNIA 1HW7A 2P4KA 4AILC 4UFZA 3CRAA 1TVKB 3K5LA 1AI4A 5C8YB 1N32O 1URFA 3E8GA 3BABA 3UKMA 1IBLB 1WJZA 1XREA 5JQGB 4FZ1A 2VWKA 2Y0PA 4DV4B 1HWYA 4Q20A 3TCUA 5EZYB 3CCJV 4A5UB 2GHYA 1FFXB 2AZ2A 2QKSA 4I9WA 2OTJV 2NR5A 3E22A 4U7NA 2DYSC 1GTOA 1T5EA 1VQ5V 4DO2A 1K92A 1HNXO 2UUCB 3RYIB 2XASA 4C7UA 5BMVB 4G27B 4WBNB 3CCUV 5CB4A 2FMLA 3E2EA 1L8DA 3UO3A 4LP8A 4GX0A 1YIJV 4FZ0A 5IYZA 5B1NA 3SYAA 1WPXA 3K9AA 5KMGA 1GM9A 1DF5A 1TGOA 5B1AC 1WP8A 3RN4A 1M5IA 3W7XA 5IWAB 1VIBA 2UXBO 2ZDIA 2DN9A 3JCUZ 5B5EZ 4DV1B 1YDXA 4YIPA 1KYOF 2RN9A 2C2AA 1KU9A 1GK9A 5EK0A 4KHPB 4CH3A 2EX3A 3ASOC 2WLKA 1QNMA 4DR3B 1R73A 5CMUA 1SS3A 1BSMA 1P7BA 4BIUA 1OCRB 5F2VO 1SZTA 4BIOA 2YXYA 1LUWA 1RM1B 1XL4A 2QWQB 4J80A 1JVMA 2QGNA 2D2CB 1H2LA 1M57B 3JAKA 3CCEV 3T2MA 1KQSU 4MSWC 1SESA 3CCQV 5J9PC 2A3QA 1SQPH 3HB3B 4ZI7B 2QE7G 3AG2B 1PKXA 3OTOB 5CA3A 4I4TA 1PM9A 2HVKC 4PA6A 2VQFB 1N36O 2AXTZ 2YIAA 3N2GA 2BOBC 5EC1C 1GN3A 2HVJC 3LNNA 3B77A 3D36A 1WAZA 2ATKC 2UXCB 2R9RB 3CX5F 2EINC 1I5YA 3KZIZ 3E35A 3CB2A 4TOIA 5CA0A 2YUAA 3IC9A 3BA9A 4U3JA 2VQEO 4B7EA 3SDLA 5C93A 1WA8B 1FPOA 3MD0A 1AR4A 4I55A 5GW7A 3FYIB 2PF4E 2GSMB 4JI2O 2OCCB 1XHXA 4PDLA 3EVKA 3J80N 2Z0AA 4I50A 3DSQA 4CS4A 1OJHA 4EKWA 2WLMA 4DV6O 1OCCB 2F23A 1MSWD 1AP6A 4F6RB 3M7MX 1OCZC 4X65O 1IJGA 4IT5A 1H2MA 3Q4HA 3JARA 4O4HB 4JI4O 3JCZA 3QVNA 3CHXA 4Z1MG 2Q6AA 2EIJC 3JALB 4IYIA 2BE3A 3F5TA 2VRZA 5GTHZ 5KHJA 1Z5VA 1NH2D 3CXHF 3ABLC 3PJSK 5KX5A 4DUZO 5TISZ 4MVSA 4GZRB 3ML0A 3JAMN 4AQYO 1YJ9V 1FOUA 5KAFZ 1TVKA 3A2FA 5C8YA 2AHYA 1O9HA 1DF4A 4LF7B 5EZYA 1FFXA 1O9GA 3ZMTA 3APQA 3ZHUA 2W6IG 2UXNA 3I5DA 1M93A 1DLBA 4W4KA 1JQ0A 3ZBHA 5L3BA 3ZCCA 4MTFA 4DK1A 1R3IC 4KFMA 2VWJA 1GRJA 3BVOA 2LGWA 4YJ3B 2JRIA 1SETA 1EN6A 1H8HG 1CEZA 4LCUC 5BMVA 4WBNA 4X62O 4JV5B 1PNKA 1NQTA 5B1BB 2EZPA 4CH4A 2B9ZA 4OXSA 5BZBA 3CP1A 1S5HC 1TA8A 2XAHA 3ZJZA 4FFKA 2EINB 3JD2A 2R9AA 3RFRA 1KB9F 4DR4B 3VBBA 4DV3B 2ETNA 4PV1B 2F4VB 2R9IA 1H2KA 1M4UA 4B3SO 2P5OA 4OPHA 2OCHA 2OIEA 3WU2Z 3P30A 3CJHA 3ASNB 1M56B 3ZHVA 1Q43A 4TQFA 5JH7A 3CRCA 3RYFA 4NVPA 5LMUO 3QTCA 4J7JA 4JYCA 4HAMA 3B09A 3CYOA 2IJIA 2X6BA 1OHHG 2QA4V 1FXKC 4DR6B 2CAZC 5KAIZ 5CBGA 5IJ0A 2D3OW 3N2KB 2UUBB 3EFFK 3UM7A 1QBZA 3E8FA 2Y4UA 3EHBB 2E5LB 1VQMV 1MZEA 1NBMG 3ZEDA 1NTZH 5L3FA 4UCTA 4JZ2A 4ZI7A 4NXMB 3BEHA 3T1YB 4QPKA 3MHSC 3OMIB 3X2QC 1P84F 4TV8B 5EIBC 3ABLB 3E83A 1Q6UA 3T1HB 4EB6B 4JI5B 1XNRB 3QO7A 1I94B 2ZD9A 3L71H 3J81N 1KD1W 2P06A 4NXNB 1YTFB 1PNMA 2X7RB 1WA8A 4FLZA 3T4ZA 4NKGB 1AR1B 3BPZA 3HKDB 1BQ0A 2YICA 1GM7A 4LH7A 4N21A 5H9CA 2ZCEA 1AVMA 4FPPA 1ENVA 4PJ0Z 5LOVA 4DUYO 1Z2GA 2JK5C 3W7UA 1HR0O 4DV0B 3IFXA 4UB6Z 2P4VA 3H9VA 3AG4C 5LHHA 2KB1A 4PELA 1IBKO 2XUMA 4O2BB 2WA4A 3KCYA 4K35A 3F7VC 4DR2B 2OIGA 1YF2A 4LF8O 1AI6A 4IHJA 1AJNA 1ZTEA 2CTRA 4LF4O 4I7ZB 2W6JG 2ODMA 3CCVV 5B66Z 3E89A 3SPCA 4O4JA 1SRYA 3ZN1A 4JI6B 3ZMVA 3ABKB 5LXTB 5H5NA 3JSNA 3PN1A 1QCEA 1K97A 1N0NA 2CE4A 5HFMA 2WWWA 4K0KO 3SJBC 4YXWG 2Q69A 4PD4F 1JJ2U 2Q73A 5DEDA 5IJ9A 3ZHTA 1FXKB 3OFNG 4QE7A 1XMQO 1VQPV 4FJCC 3DXRA 4GKKO 1EZVH 1UFIA 1G6UA 2FYUH 2UXDO 1IDSA 3JD0A 1VF6A 5B3SB 5L3CA 4HBNA 2M7WA 5KUMA 4IL6Z 1Q81W 4MVOA 1IVSA 2QJ1A 2EJRA 3G67A 2L35A 2ZM6B 1L0NH 4UCUA 4XDKA 4BW9A 4JAUA 2XTAA 4RUEA 1CPYA 1RSOB 3JYCA 1PD3A 1XBLA 1OZ0A 4YHHO 3LSSA 2JIZG 3K08A 1PL0A 4O4IB 2PTMA 1VQ6V 1XQ8A 4LFAO 2HLDG 4PHZA 1IBLO 1VEWA 3OUSA 4DV4O 1Q82W 2EJ7A 5KHIA 4DV2B 4AI8A 1F4MA 3OGCC 1XUQA 3G6BA 1R6TA 4LFCB 1TUBB 4GCZA 4YY3O 5BXZA 2IW5A 4Q6GA 4X1YB 4GKJB 3ZHSA 1Y76B 5KA5A 2Q8VA 1NU1H 2LFRA 2UUCO 3W7SA 1U97A 5H2FZ 4QIWF 2YS8A 2BOCC 2W0FC 3HKEB 3G80A 4QPJA 2E74B 4X1KB 5BY1A 5KLVH 4Z2WA 3L72H 3EXAA 3WG7C 5D5QA 1S76D 3T4DA 2PYJA 3AK2A 2IJKA 1R1BA 1AR5A 5L3EA 5IWAO 2ADPA 3SPJA 4DV1O 2ITDC 1Q86W 2HEPA 3OT7A 2HJFC 2RJZA 2FKXA 4TV8A 1N4CA 1YZBA 3BHPA 2V4DA 4R8CA 1QQCA 4EB6A 4JI0B 4KHPO 2BCCH 2ZE8A 2FTKA 4LF9B 3BCCH 4MW8A 3L73H 1P49A 2EZOA 1JR9A 1MMMA 3IAYA 2DYRC 5LA6B 3K5NA 3IGAC 1M90W 2PUSA 5JJNB 2HJDA 1S3JA 1SQBH 2YXHA 4LWSA 1NI8A 4GUNA 2ZIMA 3ZRWB 2V1DA 4X9QA 5FNVB 1VQ4V 1S77D 3AG1C 3JAWA 2Y69C 1SQFA 2MW2B 3QG5A 2NNUA 4FLVA 4XBFA 4HNAB 3E8HA 1FFTB 3OTOO 5IYBO 4FLTA 2VQFO 4UCSA 1WPBA 3CCRV 3K06A 4LH6A 4NTWA 4MVRA 3AK3A 1BT8A 4O2BA 2UXCO 3CEIA 1D5NA 2ZE5A 3B8MA 5JJJB 1QLEC 4MW3A 4CH5A 4B08A 4PA4A 2FB5A 2EIKC 5IYDO 4LF5O 2Z3YA 2XT9A 1ORQC 2IU0A 2DQ0A 2CTWA 2BSKB 2P90A 2IU3A 5FL7G 2YXLA 4UVCA 1YTFD 4QE9A 2PZSA 5GONB 4I0XB 5LMNO 5JVDB 1W2BU 3ZX6A 2ZKOA 2CGOA 1SC5B 3RVYA 1AP5A
chains in the Genus database with same CATH topology
1GN6A 1IXBA 1B06A 3AK2A 1AR5A 1SZXA 2RCVA 2ADPA 1MNGA 1ZUQA 3C3TA 1EN4A 4JZ2A 1IX9A 3OT7A 3MDSA 3TJTA 2P4KA 1MA1A 1PM9A 1PL4A 1XREA 1IDSA 1VARA 1GN3A 1KKCA 1EN5A 1JR9A 1MMMA 1BS3A 1I08A 1I0HA 3KKYA 1LUVA 1N0JA 1XDCA 4YIOA 1EN6A 3KDRA 3IC9A 1XILA 1ZSPA 4GUNA 3DC6A 4C7UA 4X9QA 1GN2A 3LSUA 1AR4A 5AG2A 4FFKA 1AVMA 1GN4A 2GDSA 3EVKA 5A9GA 1VEWA 1Y67A 4JYYA 3AK3A 3RN4A 1BT8A 1XUQA 1ZLZA 4F6EA 3CEIA 1D5NA 1AP6A 3AK1A 4E4EA 4YIPA 2QKCA 2QKAA 2ADQB 3DC5A 1WB8A 3QVNA 3K9SA 1JA8A 4BR6A 1MSDA 1ZTEA 2CDYA 3C3SA 1QNMA 2AW9A 1WB7A 1EM1A 1BSMA 1P7GA 1N0NA 3BFRA 4JZGA 2CE4A 1LUWA 1AP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GN6 A;  1IXB A;  1B06 A;  3AK2 A;  1AR5 A;  1SZX A;  2RCV A;  2ADP A;  1MNG A;  1ZUQ A;  3C3T A;  1EN4 A;  4JZ2 A;  1IX9 A;  3OT7 A;  3MDS A;  3TJT A;  2P4K A;  1MA1 A;  1PM9 A;  1PL4 A;  1XRE A;  1IDS A;  1VAR A;  1GN3 A;  1KKC A;  1EN5 A;  1JR9 A;  1MMM A;  1BS3 A;  1I08 A;  1I0H A;  3KKY A;  1LUV A;  1N0J A;  1XDC A;  4YIO A;  1EN6 A;  3IC9 A;  1XIL A;  1ZSP A;  4GUN A;  3DC6 A;  4C7U A;  4X9Q A;  1GN2 A;  3LSU A;  1AR4 A;  5AG2 A;  4FFK A;  1AVM A;  1GN4 A;  2GDS A;  3EVK A;  5A9G A;  1VEW A;  1Y67 A;  4JYY A;  3AK3 A;  3RN4 A;  1BT8 A;  1XUQ A;  1ZLZ A;  4F6E A;  3CEI A;  1D5N A;  1AP6 A;  3AK1 A;  4E4E A;  4YIP A;  2QKC A;  2QKA A;  2ADQ B;  3DC5 A;  1WB8 A;  3QVN A;  3K9S A;  1JA8 A;  4BR6 A;  1MSD A;  1ZTE A;  2CDY A;  3C3S A;  1QNM A;  2AW9 A;  1WB7 A;  1EM1 A;  1BSM A;  1P7G A;  1N0N A;  3BFR A;  4JZG A;  2CE4 A;  1LUW A;  1AP5 A; 
#chains in the Genus database with same CATH topology
 5EBW C;  1GN6 A;  2OTL V;  3H01 A;  4IIJ B;  2R72 A;  3LSQ A;  4PA9 A;  1MNG A;  1JCH A;  4YJ2 B;  1B3Q A;  4OGQ B;  4JI1 B;  1EN4 A;  1ZX3 A;  1VF7 A;  2GUZ A;  3AG3 C;  4X89 A;  3JD1 A;  1MOF A;  2WSS G;  1K3E A;  4LC1 A;  1GMG A;  3IJ4 A;  1EN5 A;  1I08 A;  3JAT A;  2HHH O;  3JAS A;  2GBO A;  2WPD G;  3ABM C;  1QHT A;  2YEV B;  3ETQ A;  4TT3 G;  4H13 B;  4NR1 A;  1N33 B;  1RFY A;  2LJ2 A;  4GT1 A;  3HR0 A;  5JCO A;  3DGE A;  4X64 B;  4LNU B;  2E75 B;  1VQK V;  1F7Y A;  4LF7 O;  3CRQ A;  4L8J A;  1R6K A;  1ROP A;  3RYC B;  2FL4 A;  4J10 A;  4EFB A;  2EIM C;  4X1Y A;  3AG1 B;  3CC7 V;  1IZ3 A;  1Y76 A;  3IC7 A;  4ZIB A;  2F66 C;  4FLU A;  1R6N A;  2PI4 A;  5B1O A;  2Z5U A;  3ETE A;  1BCC H;  3BAA A;  4EFE A;  4JV5 O;  3K5O A;  1TUE B;  2JGU A;  2Y4T A;  2DYS B;  1YIT V;  3SR2 C;  4H44 B;  3CE2 A;  5BR8 B;  3TXS A;  4UVB A;  3K59 A;  4DR4 O;  1QLE B;  1H2S B;  4DV3 O;  4ICG A;  2EBO A;  3VQY A;  1M9N A;  3LDE A;  5J2T B;  1J5E B;  4TV9 A;  2WLN A;  1SZX A;  1US6 A;  2P67 A;  2WLI B;  2KG7 A;  1AB3 A;  3D3Q A;  1Q8I A;  5H6Q A;  4B3M B;  5B1A B;  4LFB O;  1X4T A;  2OT5 A;  3TJT A;  1AJQ A;  1MA1 A;  3CS5 A;  3E86 A;  4DV7 B;  1GM8 A;  3FB5 C;  2DWD C;  3D8C A;  1NJI W;  1E1R G;  5LP6 C;  1ZAU A;  2N05 A;  1V54 C;  3C90 A;  4DW0 A;  4U7O A;  2F93 B;  3ZRV A;  5LA6 A;  4QGP A;  4DR6 O;  3SPH A;  4B3R B;  1BS3 A;  3P3N A;  1FYJ A;  3KKY A;  5GTI Z;  3ASO B;  4J41 A;  1LUV A;  2UUB O;  1XDC A;  3UQ8 A;  5DM6 V;  2E5L O;  1XIL A;  5FNV A;  3FAV B;  2YC0 A;  5JQG A;  2LW7 A;  2DMX A;  3LSU A;  3I55 V;  3ETG A;  4NXM O;  3T1Y O;  5J2U B;  3FX7 A;  1K34 A;  1F4N A;  2HR3 A;  3RYH B;  3K04 A;  3T1H O;  2JS3 A;  4E2L A;  2VS0 A;  4K8Z A;  5EYP B;  2EIL C;  3CMA V;  4JI7 B;  5IE9 A;  4JI5 O;  3RYI A;  1I94 O;  4J42 A;  2UU9 O;  4CZZ A;  3L74 H;  2X0L A;  2YDE A;  1PP9 H;  4UCO A;  2XND G;  1Q90 D;  2BSK A;  2VQE B;  3K9S A;  5K1X A;  4I0X A;  2Q7E A;  1YI2 V;  5JVD A;  3CCS V;  1H2G A;  3D3I A;  3SYO A;  2ZNJ A;  2QTO A;  4JF3 A;  4DV0 O;  1THZ A;  2ZR2 A;  1SQX H;  1NTM H;  1WLE A;  4IIJ A;  2HFE C;  2IH1 C;  1VP7 A;  4YJ2 A;  4CC5 A;  4HYO A;  3MHH C;  4U3F H;  1BZK A;  2WAM A;  5FLX N;  1IXM A;  2PY5 A;  1IBM O;  1GKF A;  4PI2 A;  2ILM A;  4ZOL B;  4DR2 O;  2PI5 A;  1OCZ B;  4CBC A;  4RUF A;  2QM8 A;  3OEH G;  2F95 B;  2XAJ A;  2ZDI C;  1VQL V;  3HKB B;  4JI6 O;  2P22 C;  5LBQ A;  2OYQ A;  4WFG A;  1HNW B;  2EIJ B;  3STZ C;  4DR5 B;  1VF5 B;  4TWK A;  4PI0 A;  2ZE7 A;  2KSD A;  3SYP A;  4LF6 O;  1K5Q A;  3RBZ A;  3OR7 C;  2ZT9 B;  4AQY B;  1FAF A;  4G28 B;  2WLL B;  2YSU B;  4BAY A;  1N8R W;  1OCO C;  5LYJ B;  3LUT B;  4KP4 A;  2H94 A;  5EBL C;  2UUA O;  1PPJ H;  1D5A A;  3OMN B;  1W0K G;  1AJP A;  4B3T B;  1SF9 A;  2IJH A;  4J9Z B;  3S3W A;  3WB1 A;  1Y4M A;  3CWB H;  3I56 V;  2ZIO A;  4FLY A;  3OGI B;  1XHZ A;  2YI8 A;  2JDI G;  4JI3 O;  5KHG A;  2ZM6 O;  1G8M A;  4IGG A;  1XNQ B;  3K0G A;  3QO5 A;  2JJ1 G;  1I5X A;  1JA8 A;  2KKW A;  3D36 C;  5LL6 Y;  3C3S A;  2EIL B;  4NYK A;  1YSC A;  1Y74 B;  5IY5 C;  1SER A;  1QVG U;  4F6R A;  2YI9 A;  3A8T A;  4DYL A;  4DR7 B;  3UT5 B;  3H1K H;  5J2T A;  3H1L H;  1WP7 A;  2LFS A;  1CXZ B;  3BFR A;  4JZG A;  3CD6 V;  4O4H A;  2Q67 A;  3BA8 A;  4JAA A;  2WLI A;  2JEX A;  2JVD A;  3FFQ A;  3JAL A;  4WFE A;  1ZUQ A;  3FKS G;  4LFC O;  3C3T A;  3UCS C;  2HG5 C;  3OM3 B;  3E22 B;  4X66 B;  4GKJ O;  4JI8 O;  4ZHQ B;  3O65 A;  1GAX A;  2RQ6 A;  5CB4 B;  4ZKI A;  2AGA A;  3SPI A;  3VOU A;  2G38 A;  1R3L C;  4WCE V;  2XAF A;  3FAV A;  4D6T H;  3TXQ A;  1X59 A;  2ZXW C;  4RQF A;  1KP3 A;  3QF7 A;  1IUR A;  2R70 A;  4CS3 A;  3RYH A;  3CRM A;  1B04 A;  1ZL8 B;  4YJ3 A;  4JI0 O;  1R3K C;  2Y48 A;  1N34 O;  4LF9 O;  1Y67 A;  5LHG A;  3X2Q B;  1JFF B;  1F23 A;  3E8B A;  3AK1 A;  3ICX A;  4D7S A;  1OCO B;  1DGS A;  2Q9L A;  4PDR A;  1OV9 A;  3DC5 A;  4WFA V;  4PA3 A;  1EZJ A;  4JYA B;  1DK1 A;  3JAK B;  2AW9 A;  4QNH B;  2CH7 B;  4N23 A;  2PGG A;  3A0H Z;  1XOU A;  3JD3 A;  4PDM A;  3SGI A;  1FJG B;  5FPO A;  1J95 A;  2A9H A;  1S5J A;  2A06 H;  1IBK B;  5HFL A;  2XOK G;  1YVW A;  2NN4 A;  1R3J C;  3NR7 A;  3AG4 B;  3ZRX A;  4ZOL A;  1XL6 A;  5CA0 B;  1PV0 A;  3ZN0 A;  4DV5 B;  2LGQ A;  3N2K A;  3CSX A;  5A2Q N;  5E1A C;  3HKB A;  2B5U A;  5IYC O;  1K8A W;  4HZ3 A;  1B6Q A;  3ZHR A;  1I0H A;  5KHH A;  3U10 A;  2YIB A;  4IYH A;  1BHB A;  2W0X A;  1K73 W;  1HP8 A;  2LO1 A;  3A0R A;  2WLL A;  4BIZ A;  1H2N A;  1GH6 A;  2RNB A;  4MTO A;  1MG1 A;  1OCR C;  4DR1 B;  1FS0 G;  4DR3 O;  1XMO B;  3SJC C;  1RM1 C;  1YXB A;  2EUL A;  3Q4H B;  1VQO V;  5CBF A;  4GKK B;  2GTA A;  1RPO A;  1CP9 A;  3AEI A;  2QWN B;  4O4L B;  2ZXW B;  2P7T C;  4ASU G;  3OAA G;  1ZLZ A;  3ZS8 C;  3HKD A;  3SYQ A;  2CK3 G;  4D7T A;  4E4E A;  1BMF G;  2F1M A;  2XHB A;  3OTF A;  4MVZ A;  4NTY A;  5KX5 B;  1N33 O;  5ITZ B;  2ITC C;  2ARH A;  4MTX A;  4RAI A;  2YIB D;  4H37 A;  1MSD A;  1E1Q G;  1LNQ A;  3UO2 A;  3UT5 A;  1D2D A;  1EM1 A;  3W7W A;  4FIP C;  2BTQ B;  3GB7 C;  4X64 O;  4LFA B;  4GX2 A;  2LQT A;  3N27 A;  4JAV A;  5CA1 B;  1A32 A;  1HDJ A;  2DOS A;  3M99 B;  1ZWI C;  2LP7 A;  4DRX B;  2NLJ C;  3L9D A;  3RWR D;  1FXV A;  2Q0O C;  3ABT A;  4R6Z A;  1Y6X A;  2IJJ A;  2Q0A A;  2OCC C;  4YY3 B;  2N04 A;  2DQ3 A;  4JYB A;  4ZHQ A;  4GX1 A;  5CN0 A;  5LXT A;  3L70 H;  1V55 C;  5LHI A;  1OCC C;  4J7Z A;  2Q7H A;  4L87 A;  1KC8 W;  2Q7G A;  3WFV A;  5BR8 O;  3STL C;  3SPG A;  1KEC A;  3ABU A;  3WB0 A;  1L0L H;  4X20 B;  3ZHQ A;  2BTO A;  3KCX A;  1FXK A;  4UB8 Z;  4X8A A;  1N0J A;  3LNM B;  2A79 B;  1J5E O;  1YJW V;  4MVM A;  3K03 A;  1ZSP A;  1FKA O;  1JJO A;  3WG7 B;  3OE7 G;  4B3M O;  3CJH B;  2UXX A;  2QWP B;  2Y0I A;  1ZL8 A;  4DV7 O;  1XI1 A;  2XAG A;  5JH7 B;  3RYF B;  4LBE C;  3NXS A;  2Q4P A;  1S72 V;  1P4R A;  1JFF A;  1Y66 A;  2IM9 A;  2JS5 A;  1HNZ B;  3DTU B;  4B3R O;  3O9O A;  3HPL C;  1SQG A;  1RSO A;  4FM0 A;  1VMG A;  5IJ0 B;  4OX9 B;  4O4I A;  1NR1 A;  3J7A U;  3OW2 U;  1WB8 A;  2DYR B;  3QNE A;  1N32 B;  1VQ8 V;  1VF6 C;  2CH7 A;  1YEW A;  2F43 G;  4BW5 A;  2A0L A;  3W7T A;  2X6A A;  1TUB A;  3VQV A;  4QJF B;  2DE0 X;  1P7G A;  5B1B C;  2Y69 B;  2OWO A;  3FD9 A;  1JPX A;  3GVM A;  4JI7 O;  1HNX B;  3HKC B;  4CC6 A;  4WFH A;  2RCV A;  3R65 A;  4PDV A;  4CS2 A;  3CRR A;  2QDO A;  1RP3 B;  5EIB D;  4LF5 B;  1BL8 A;  5E79 Z;  3HKE A;  3B4S A;  2PYL A;  4X1K A;  5EBM C;  3FB6 C;  1NVP B;  2AHZ A;  3ASN C;  4I5S A;  4UV8 A;  1M56 C;  1RPR A;  2EIK B;  3SJQ C;  4ABM A;  2F4V O;  1E79 G;  5LMN B;  3CC2 V;  3VQX A;  2QWO B;  5IDJ A;  1WNS A;  4MVQ A;  2UXB B;  5D5P A;  5LOV B;  1VQ7 V;  1ARO P;  1JOY A;  4YIO A;  3B2E E;  2K9P A;  1V55 B;  4O2A B;  4GYC B;  3CME V;  2QWR B;  3K79 A;  1NTK H;  3DC6 A;  4NB5 A;  4TQD A;  4NTX A;  4UCV A;  1JNB A;  2CTQ A;  2O57 A;  1Q5O A;  1BHA A;  1SA0 B;  1FD9 A;  4AHC A;  4O4L A;  1S5L Z;  1SQV H;  2B1G A;  3AG3 B;  4IHJ B;  4JYY A;  1Z5W A;  1BE3 H;  3LDD A;  1QLN A;  4FMT A;  2QR4 A;  3ZRW A;  4F6E A;  5K1P A;  2GTS A;  1NZ6 A;  4O4J B;  2HHH B;  1HNW O;  1EFR G;  4DR5 O;  4WF9 V;  5ITZ A;  2DJV A;  4HNA A;  4JTA B;  5KHK A;  1SQQ H;  1KKD A;  4TSF G;  4W4L A;  3SJA C;  4EEQ A;  1JMK C;  3ABM B;  1NS1 A;  2YID A;  1N36 B;  1QR8 A;  2CUG A;  2DWE C;  2V7Q G;  5IJ9 B;  2L6L A;  4FLX A;  2BTQ A;  1WB7 A;  1V9P A;  5CA1 A;  4K3A A;  4RWU A;  1XNR O;  3H1H H;  3BRC A;  4DRX A;  1I7F A;  4DK0 A;  2QEX V;  1F51 A;  3FB8 C;  3DXR B;  1COW G;  3K3W A;  2ZR3 A;  5H6R A;  3G6E V;  2CTP A;  3FB7 C;  4FK5 C;  4B3T O;  4NXN O;  2ZE6 A;  4FM1 A;  3APO A;  5GON A;  1VQ9 V;  4H0L B;  1DTO A;  1XNQ O;  3K57 A;  1TAE A;  4JI2 B;  2EIM B;  4DXW A;  3JD4 A;  4XDJ A;  3TK1 A;  1NR7 A;  3FYE B;  3SYC A;  2WA3 A;  4X20 A;  4UCR A;  4DV6 B;  3G4S V;  5LGT A;  4DR7 O;  3GWO A;  2JEU A;  4X65 B;  3AG7 A;  2QM4 A;  1Q6I A;  4F4L A;  2Q68 A;  4J7K A;  3OR6 C;  5FPR A;  1Q7Y W;  1H5W A;  4FFB B;  3CPW U;  3KDR A;  5IT9 N;  1Q6H A;  4Z1V A;  3GWK C;  4P30 A;  4JI4 B;  3ABK C;  3K58 A;  2IH3 C;  4LFB B;  4X66 O;  5KUK A;  5AG2 A;  3ZMZ A;  4JTD B;  2MK3 A;  2YEV A;  5DN6 G;  3S3X A;  4DUZ B;  1YCI A;  3P32 A;  2QTS A;  5LP6 B;  1YHQ V;  3CCM V;  1V54 B;  1UPG A;  3M8A A;  4JTC B;  2QKA A;  5B3S C;  1QVF U;  4LNU A;  1H38 A;  1G4Y B;  4LR3 A;  3RW0 A;  1L1F A;  3JSL A;  4BR6 A;  2K1E A;  3OD4 A;  4R50 A;  3RYC A;  5KA6 A;  2Q5Z A;  1KUQ A;  2ZIN A;  4MT8 A;  4MTG A;  2JJ2 G;  5L3D A;  3HKC A;  2IBZ H;  4JGS A;  1IXB A;  4FLW A;  4X62 B;  1G1X B;  3P3P A;  2UU9 B;  2JGD B;  3KG2 A;  4TUY B;  4I9Q A;  5JCO C;  4X1I B;  3MDS A;  4P2Z A;  4KXR A;  1K4D C;  3ZIA G;  2DW4 A;  1PL4 A;  4JYA O;  4LWS B;  4H33 A;  2HKO A;  1VAR A;  4UV9 A;  4DV2 O;  1KKC A;  3F5W C;  3JAW B;  4B7K A;  4B3S B;  4WFF A;  3B8N A;  4UXN A;  4O2A A;  1FJG O;  1SKV A;  1BGY H;  3VQW A;  4RO2 A;  5LMU B;  2B1I A;  1GN2 A;  3B40 A;  4GLX A;  1K9M W;  1IBM B;  1SA0 A;  4OPA A;  1S0V A;  4J9Y B;  1GN4 A;  2A7W A;  3TGU H;  2QSA A;  4DV5 O;  5JWP A;  5IYZ B;  5L3G A;  4G2K A;  2QM7 A;  2GV9 A;  1UJW B;  3R66 A;  5KMG B;  4CH6 A;  1NVP D;  1MAB G;  3ZRS A;  3F7Y C;  5J2U A;  4PA7 A;  3CCL V;  4MVU A;  2QKC A;  4DW1 A;  2ADQ B;  4GX5 A;  3H1J H;  4LF6 B;  2RDC A;  5LGN A;  2E76 B;  1VQN V;  4DR1 O;  5EYP A;  2X6C A;  3ZMU A;  1K33 A;  4JPR A;  4BWA A;  1XMO O;  3K5M A;  2GUZ B;  2XAQ A;  4FM2 A;  1W59 A;  2UUA B;  4UUJ C;  1XEQ A;  4P9O A;  3K0D A;  3MAQ A;  3RT3 C;  2RMK B;  1KP2 A;  2KQX A;  5LGU A;  1GO3 F;  1FXH A;  3G71 V;  2WLH A;  2AZ0 A;  1KBH A;  3JAT B;  4JI3 B;  3THO A;  4R7C A;  1IX9 A;  3JAS B;  1K5S A;  4FVM A;  1H8E G;  1Q3E A;  4DUY B;  1JX9 A;  1HR0 B;  4J11 A;  4X88 A;  4I4T B;  3ZMS A;  3BY6 A;  3N2G B;  1QR9 A;  3CC4 V;  4K8X A;  2HP8 A;  4FFB A;  5CBH A;  4KL1 A;  5JJE B;  4KUM A;  5IY5 B;  5DEC A;  2E3C A;  4LF8 B;  1MZF A;  4MS2 A;  4U3J B;  5EC2 C;  2N74 A;  4LF4 B;  3ETD A;  4JI8 B;  1K7D A;  1NH2 B;  1K4C C;  3T1C A;  3L75 H;  2GDS A;  4I55 B;  1BQZ A;  3WB2 A;  5A9G A;  4K0K B;  5LP6 A;  3QO8 A;  4I50 B;  3OMA B;  1YJN V;  5LYJ A;  1NKD A;  4JI1 O;  1AI7 A;  2H8P C;  1QU7 A;  1XMQ B;  3U0Z A;  1NT2 B;  3U11 A;  3OEE G;  4TV9 B;  1KMI Z;  1AIL A;  3JAR B;  4RQE A;  3CXC U;  1U96 A;  3RVZ A;  2CDY A;  2KG7 B;  1M57 C;  2UXD B;  4WFB V;  4ZBM A;  3LDC A;  3TET A;  4XDL A;  1PNL A;  1M1K W;  3AG2 C;  2WLJ A;  1AI5 A;  1N34 B;  2ZQM A;  2H3O A;  4P9P A;  2JGD A;  1HNZ O;  1B06 A;  2M6Y A;  2P6J A;  3OUF A;  4TUY A;  1W0J G;  1EBO A;  4JAS A;  2LW1 A;  3A0B Z;  4X1I A;  2CGN A;  1WN7 A;  1Y74 A;  3H1I H;  4OX9 O;  1LR1 A;  4YHH B;  4UVA A;  3RGB A;  2ZNI A;  1HW7 A;  2P4K A;  4AIL C;  4UFZ A;  3CRA A;  1TVK B;  3K5L A;  1AI4 A;  5C8Y B;  1N32 O;  1URF A;  3E8G A;  3BAB A;  3UKM A;  1IBL B;  1WJZ A;  1XRE A;  5JQG B;  4FZ1 A;  2VWK A;  2Y0P A;  4DV4 B;  1HWY A;  4Q20 A;  3TCU A;  5EZY B;  3CCJ V;  4A5U B;  2GHY A;  1FFX B;  2AZ2 A;  2QKS A;  4I9W A;  2OTJ V;  2NR5 A;  3E22 A;  4U7N A;  2DYS C;  1GTO A;  1T5E A;  1VQ5 V;  4DO2 A;  1K92 A;  1HNX O;  2UUC B;  3RYI B;  2XAS A;  4C7U A;  5BMV B;  4G27 B;  4WBN B;  3CCU V;  5CB4 A;  2FML A;  3E2E A;  1L8D A;  3UO3 A;  4LP8 A;  4GX0 A;  1YIJ V;  4FZ0 A;  5IYZ A;  5B1N A;  3SYA A;  1WPX A;  3K9A A;  5KMG A;  1GM9 A;  1DF5 A;  1TGO A;  5B1A C;  1WP8 A;  3RN4 A;  1M5I A;  3W7X A;  5IWA B;  1VIB A;  2UXB O;  2ZDI A;  2DN9 A;  3JCU Z;  5B5E Z;  4DV1 B;  1YDX A;  4YIP A;  1KYO F;  2RN9 A;  2C2A A;  1KU9 A;  1GK9 A;  5EK0 A;  4KHP B;  4CH3 A;  2EX3 A;  3ASO C;  2WLK A;  1QNM A;  4DR3 B;  1R73 A;  5CMU A;  1SS3 A;  1BSM A;  1P7B A;  4BIU A;  1OCR B;  5F2V O;  1SZT A;  4BIO A;  2YXY A;  1LUW A;  1RM1 B;  1XL4 A;  2QWQ B;  4J80 A;  1JVM A;  2QGN A;  2D2C B;  1H2L A;  1M57 B;  3JAK A;  3CCE V;  3T2M A;  1KQS U;  4MSW C;  1SES A;  3CCQ V;  5J9P C;  2A3Q A;  1SQP H;  3HB3 B;  4ZI7 B;  2QE7 G;  3AG2 B;  1PKX A;  3OTO B;  5CA3 A;  4I4T A;  1PM9 A;  2HVK C;  4PA6 A;  2VQF B;  1N36 O;  2AXT Z;  2YIA A;  3N2G A;  2BOB C;  5EC1 C;  1GN3 A;  2HVJ C;  3LNN A;  3B77 A;  3D36 A;  1WAZ A;  2ATK C;  2UXC B;  2R9R B;  3CX5 F;  2EIN C;  1I5Y A;  3KZI Z;  3E35 A;  3CB2 A;  4TOI A;  5CA0 A;  2YUA A;  3IC9 A;  3BA9 A;  4U3J A;  2VQE O;  4B7E A;  3SDL A;  5C93 A;  1WA8 B;  1FPO A;  3MD0 A;  1AR4 A;  4I55 A;  5GW7 A;  3FYI B;  2PF4 E;  2GSM B;  4JI2 O;  2OCC B;  1XHX A;  4PDL A;  3EVK A;  3J80 N;  2Z0A A;  4I50 A;  3DSQ A;  4CS4 A;  1OJH A;  4EKW A;  2WLM A;  4DV6 O;  1OCC B;  2F23 A;  1MSW D;  1AP6 A;  4F6R B;  3M7M X;  1OCZ C;  4X65 O;  1IJG A;  4IT5 A;  1H2M A;  3Q4H A;  3JAR A;  4O4H B;  4JI4 O;  3JCZ A;  3QVN A;  3CHX A;  4Z1M G;  2Q6A A;  2EIJ C;  3JAL B;  4IYI A;  2BE3 A;  3F5T A;  2VRZ A;  5GTH Z;  5KHJ A;  1Z5V A;  1NH2 D;  3CXH F;  3ABL C;  3PJS K;  5KX5 A;  4DUZ O;  5TIS Z;  4MVS A;  4GZR B;  3ML0 A;  3JAM N;  4AQY O;  1YJ9 V;  1FOU A;  5KAF Z;  1TVK A;  3A2F A;  5C8Y A;  2AHY A;  1O9H A;  1DF4 A;  4LF7 B;  5EZY A;  1FFX A;  1O9G A;  3ZMT A;  3APQ A;  3ZHU A;  2W6I G;  2UXN A;  3I5D A;  1M93 A;  1DLB A;  4W4K A;  1JQ0 A;  3ZBH A;  5L3B A;  3ZCC A;  4MTF A;  4DK1 A;  1R3I C;  4KFM A;  2VWJ A;  1GRJ A;  3BVO A;  2LGW A;  4YJ3 B;  2JRI A;  1SET A;  1EN6 A;  1H8H G;  1CEZ A;  4LCU C;  5BMV A;  4WBN A;  4X62 O;  4JV5 B;  1PNK A;  1NQT A;  5B1B B;  2EZP A;  4CH4 A;  2B9Z A;  4OXS A;  5BZB A;  3CP1 A;  1S5H C;  1TA8 A;  2XAH A;  3ZJZ A;  4FFK A;  2EIN B;  3JD2 A;  2R9A A;  3RFR A;  1KB9 F;  4DR4 B;  3VBB A;  4DV3 B;  2ETN A;  4PV1 B;  2F4V B;  2R9I A;  1H2K A;  1M4U A;  4B3S O;  2P5O A;  4OPH A;  2OCH A;  2OIE A;  3WU2 Z;  3P30 A;  3CJH A;  3ASN B;  1M56 B;  3ZHV A;  1Q43 A;  4TQF A;  5JH7 A;  3CRC A;  3RYF A;  4NVP A;  5LMU O;  3QTC A;  4J7J A;  4JYC A;  4HAM A;  3B09 A;  3CYO A;  2IJI A;  2X6B A;  1OHH G;  2QA4 V;  1FXK C;  4DR6 B;  2CAZ C;  5KAI Z;  5CBG A;  5IJ0 A;  2D3O W;  3N2K B;  2UUB B;  3EFF K;  3UM7 A;  1QBZ A;  3E8F A;  2Y4U A;  3EHB B;  2E5L B;  1VQM V;  1MZE A;  1NBM G;  3ZED A;  1NTZ H;  5L3F A;  4UCT A;  4JZ2 A;  4ZI7 A;  4NXM B;  3BEH A;  3T1Y B;  4QPK A;  3MHS C;  3OMI B;  3X2Q C;  1P84 F;  4TV8 B;  5EIB C;  3ABL B;  3E83 A;  1Q6U A;  3T1H B;  4EB6 B;  4JI5 B;  1XNR B;  3QO7 A;  1I94 B;  2ZD9 A;  3L71 H;  3J81 N;  1KD1 W;  2P06 A;  4NXN B;  1YTF B;  1PNM A;  2X7R B;  1WA8 A;  4FLZ A;  3T4Z A;  4NKG B;  1AR1 B;  3BPZ A;  3HKD B;  1BQ0 A;  2YIC A;  1GM7 A;  4LH7 A;  4N21 A;  5H9C A;  2ZCE A;  1AVM A;  4FPP A;  1ENV A;  4PJ0 Z;  5LOV A;  4DUY O;  1Z2G A;  2JK5 C;  3W7U A;  1HR0 O;  4DV0 B;  3IFX A;  4UB6 Z;  2P4V A;  3H9V A;  3AG4 C;  5LHH A;  2KB1 A;  4PEL A;  1IBK O;  2XUM A;  4O2B B;  2WA4 A;  3KCY A;  4K35 A;  3F7V C;  4DR2 B;  2OIG A;  1YF2 A;  4LF8 O;  1AI6 A;  4IHJ A;  1AJN A;  1ZTE A;  2CTR A;  4LF4 O;  4I7Z B;  2W6J G;  2ODM A;  3CCV V;  5B66 Z;  3E89 A;  3SPC A;  4O4J A;  1SRY A;  3ZN1 A;  4JI6 B;  3ZMV A;  3ABK B;  5LXT B;  5H5N A;  3JSN A;  3PN1 A;  1QCE A;  1K97 A;  1N0N A;  2CE4 A;  5HFM A;  2WWW A;  4K0K O;  3SJB C;  4YXW G;  2Q69 A;  4PD4 F;  1JJ2 U;  2Q73 A;  5DED A;  5IJ9 A;  3ZHT A;  1FXK B;  3OFN G;  4QE7 A;  1XMQ O;  1VQP V;  4FJC C;  3DXR A;  4GKK O;  1EZV H;  1UFI A;  1G6U A;  2FYU H;  2UXD O;  1IDS A;  3JD0 A;  1VF6 A;  5B3S B;  5L3C A;  4HBN A;  2M7W A;  5KUM A;  4IL6 Z;  1Q81 W;  4MVO A;  1IVS A;  2QJ1 A;  2EJR A;  3G67 A;  2L35 A;  2ZM6 B;  1L0N H;  4UCU A;  4XDK A;  4BW9 A;  4JAU A;  2XTA A;  4RUE A;  1CPY A;  1RSO B;  3JYC A;  1PD3 A;  1XBL A;  1OZ0 A;  4YHH O;  3LSS A;  2JIZ G;  3K08 A;  1PL0 A;  4O4I B;  2PTM A;  1VQ6 V;  1XQ8 A;  4LFA O;  2HLD G;  4PHZ A;  1IBL O;  1VEW A;  3OUS A;  4DV4 O;  1Q82 W;  2EJ7 A;  5KHI A;  4DV2 B;  4AI8 A;  1F4M A;  3OGC C;  1XUQ A;  3G6B A;  1R6T A;  4LFC B;  1TUB B;  4GCZ A;  4YY3 O;  5BXZ A;  2IW5 A;  4Q6G A;  4X1Y B;  4GKJ B;  3ZHS A;  1Y76 B;  5KA5 A;  2Q8V A;  1NU1 H;  2LFR A;  2UUC O;  3W7S A;  1U97 A;  5H2F Z;  4QIW F;  2YS8 A;  2BOC C;  2W0F C;  3HKE B;  3G80 A;  4QPJ A;  2E74 B;  4X1K B;  5BY1 A;  5KLV H;  4Z2W A;  3L72 H;  3EXA A;  3WG7 C;  5D5Q A;  1S76 D;  3T4D A;  2PYJ A;  3AK2 A;  2IJK A;  1R1B A;  1AR5 A;  5L3E A;  5IWA O;  2ADP A;  3SPJ A;  4DV1 O;  2ITD C;  1Q86 W;  2HEP A;  3OT7 A;  2HJF C;  2RJZ A;  2FKX A;  4TV8 A;  1N4C A;  1YZB A;  3BHP A;  2V4D A;  4R8C A;  1QQC A;  4EB6 A;  4JI0 B;  4KHP O;  2BCC H;  2ZE8 A;  2FTK A;  4LF9 B;  3BCC H;  4MW8 A;  3L73 H;  1P49 A;  2EZO A;  1JR9 A;  1MMM A;  3IAY A;  2DYR C;  5LA6 B;  3K5N A;  3IGA C;  1M90 W;  2PUS A;  5JJN B;  2HJD A;  1S3J A;  1SQB H;  2YXH A;  4LWS A;  1NI8 A;  4GUN A;  2ZIM A;  3ZRW B;  2V1D A;  4X9Q A;  5FNV B;  1VQ4 V;  1S77 D;  3AG1 C;  3JAW A;  2Y69 C;  1SQF A;  2MW2 B;  3QG5 A;  2NNU A;  4FLV A;  4XBF A;  4HNA B;  3E8H A;  1FFT B;  3OTO O;  5IYB O;  4FLT A;  2VQF O;  4UCS A;  1WPB A;  3CCR V;  3K06 A;  4LH6 A;  4NTW A;  4MVR A;  3AK3 A;  1BT8 A;  4O2B A;  2UXC O;  3CEI A;  1D5N A;  2ZE5 A;  3B8M A;  5JJJ B;  1QLE C;  4MW3 A;  4CH5 A;  4B08 A;  4PA4 A;  2FB5 A;  2EIK C;  5IYD O;  4LF5 O;  2Z3Y A;  2XT9 A;  1ORQ C;  2IU0 A;  2DQ0 A;  2CTW A;  2BSK B;  2P90 A;  2IU3 A;  5FL7 G;  2YXL A;  4UVC A;  1YTF D;  4QE9 A;  2PZS A;  5GON B;  4I0X B;  5LMN O;  5JVD B;  1W2B U;  3ZX6 A;  2ZKO A;  2CGO A;  1SC5 B;  3RVY A;  1AP5 A; 
#chains in the Genus database with same CATH homology
 1GN6 A;  1IXB A;  1B06 A;  3AK2 A;  1AR5 A;  1SZX A;  2RCV A;  2ADP A;  1MNG A;  1ZUQ A;  3C3T A;  1EN4 A;  4JZ2 A;  1IX9 A;  3OT7 A;  3MDS A;  3TJT A;  2P4K A;  1MA1 A;  1PM9 A;  1PL4 A;  1XRE A;  1IDS A;  1VAR A;  1GN3 A;  1KKC A;  1EN5 A;  1JR9 A;  1MMM A;  1BS3 A;  1I08 A;  1I0H A;  3KKY A;  1LUV A;  1N0J A;  1XDC A;  4YIO A;  1EN6 A;  3KDR A;  3IC9 A;  1XIL A;  1ZSP A;  4GUN A;  3DC6 A;  4C7U A;  4X9Q A;  1GN2 A;  3LSU A;  1AR4 A;  5AG2 A;  4FFK A;  1AVM A;  1GN4 A;  2GDS A;  3EVK A;  5A9G A;  1VEW A;  1Y67 A;  4JYY A;  3AK3 A;  3RN4 A;  1BT8 A;  1XUQ A;  1ZLZ A;  4F6E A;  3CEI A;  1D5N A;  1AP6 A;  3AK1 A;  4E4E A;  4YIP A;  2QKC A;  2QKA A;  2ADQ B;  3DC5 A;  1WB8 A;  3QVN A;  3K9S A;  1JA8 A;  4BR6 A;  1MSD A;  1ZTE A;  2CDY A;  3C3S A;  1QNM A;  2AW9 A;  1WB7 A;  1EM1 A;  1BSM A;  1P7G A;  1N0N A;  3BFR A;  4JZG A;  2CE4 A;  1LUW A;  1AP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...