1PL4A

Crystal structure of human mnsod y166f mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
198
structure length
198
Chain Sequence
KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Amino acid substitution at the dimeric interface of human manganese superoxide dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 77
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1pl4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1pl4A02
3IC9A 1N0JA 1AVMA 1QNMA 3K9SA 3AK3A 1MMMA 1KKCA 3LSUA 3RN4A 1MSDA 1JR9A 1IX9A 3QVNA 1WB7A 2RCVA 1XUQA 2ADQB 1P7GA 2CE4A 3C3SA 3AK1A 4JZGA 1N0NA 1AR4A 1EM1A 4JYYA 1ZSPA 2QKCA 4FFKA 2QKAA 3C3TA 4YIPA 1Y67A 1LUVA 1PM9A 1GN4A 1PL4A 4JZ2A 1IDSA 3CEIA 2GDSA 2ADPA 3DC5A 1EN5A 1ZLZA 1GN3A 3EVKA 1I08A 1GN6A 1SZXA 3AK2A 1IXBA 1MNGA 1ZUQA 1AP6A 1MA1A 1AP5A 4E4EA 3OT7A 1I0HA 1VARA 3BFRA 4F6EA 1XREA 1B06A 1XDCA 1WB8A 4GUNA 1AR5A 1XILA 3MDSA 1BS3A 4X9QA 3KKYA 1BSMA 1D5NA 1ZTEA 4C7UA 4BR6A 4YIOA 1BT8A 1VEWA 5AG2A 1EN6A 2AW9A 5A9GA 2CDYA 1JA8A 1LUWA 3DC6A 1EN4A 1GN2A 3TJTA 2P4KA
chains in the Genus database with same CATH superfamily
4WFHA 3QG5A 2JJ2G 3ABUA 2HLDG 5LHHA 1EBOA 1PNLA 3T2MA 5B1AC 4CC5A 1K4CC 4WFFA 3WG7B 3DSQA 4PDLA 4J80A 4NVPA 4MTGA 1FS0G 1U97A 2WLHA 3VQXA 5KLVH 2LFSA 1P7GA 4X1KB 3TK1A 1R6KA 5IWAB 1LR1A 3FB6C 5GTIZ 1JNBA 2IJJA 1IBKO 4YJ3B 4AHCA 2E75B 3RYFB 3SJQC 2IH1C 3ZHUA 3D36C 3JAWB 3BEHA 1XL4A 4FLXA 1U96A 2BTOA 2YC0A 5BR8B 3O9OA 4MTOA 1N32B 3RVYA 1I08A 1O9HA 4CS2A 4AQYO 1WN7A 1K34A 1WAZA 3BA8A 4O4LA 4WFBV 4FFBB 3CRQA 4QPKA 3E8FA 2KSDA 4DV7B 4TV8B 4FZ1A 1JQ0A 4B3SB 4I4TB 3K5OA 4YY3B 4O4JB 5FPRA 1I94O 3KKYA 4LF9O 4H37A 4C7UA 3T1YB 1EZVH 1GM8A 4H13B 1QHTA 2QWOB 1JX9A 2RNBA 4FVMA 1JA8A 1ZAUA 2N05A 1YDXA 4NYKA 4MVZA 3G6EV 4BAYA 4YJ2A 3M99B 3QNEA 1TUBA 2F43G 2IJHA 4X1KA 3MD0A 4GZRB 2LW7A 1F7YA 3OFNG 4YJ3A 1XBLA 2HP8A 1YEWA 1NKDA 5IYDO 4JV5O 3JAWA 4DR2B 4HNAB 1J95A 4JGSA 4MW3A 1VQ5V 2YXHA 1XMQO 3EFFK 2EJ7A 5JJNB 1JOYA 4KHPB 3P32A 2DN9A 5BR8O 3ZEDA 4TWKA 1CP9A 4DR6B 3B2EE 1Y67A 4ABMA 3LSQA 5F2VO 2OT5A 2H94A 1JJOA 4WFEA 1S3JA 3K9AA 1S77D 3FX7A 1S76D 1Y4MA 4UCOA 4G28B 4DV6B 2B1IA 1GN6A 3FYIB 4XBFA 4I4TA 1IJGA 3QO5A 3GVMA 4P9OA 1QBZA 4O4JA 4Z2WA 2ZE7A 1M1KW 1YXBA 1QQCA 4O4HB 4B3SO 1VQKV 2AGAA 3BFRA 3CP1A 1NJIW 5C93A 2LO1A 3L75H 3A0BZ 5LYJA 1SQGA 1RFYA 5GONB 1B06A 1WP7A 3CB2A 3T1YO 3P30A 1PV0A 1YTFB 1VQOV 5A2QN 4HZ3A 2EZPA 1QR9A 2A06H 3MDSA 3UKMA 2FMLA 3SPGA 3WB0A 2M6YA 5LP6B 2AW9A 1K9MW 2EIKC 2ETNA 2LW1A 4PHZA 4HNAA 2GHYA 1HNZO 5L3FA 4PI2A 4PA6A 2AHZA 4JTAB 4GX2A 2HEPA 4HYOA 2WLLB 4LWSB 4RQFA 1KP2A 4X65B 3AK3A 4GKJB 3BHPA 4D7SA 2HHHB 1MSDA 1PP9H 2FKXA 3SPCA 2BSKB 2B5UA 3Q4HB 4JI5B 1YCIA 4DR6O 4DXWA 1ZL8B 1H2KA 3ML0A 3B09A 4LC1A 3G6BA 1EM1A 3OM3B 1XEQA 2F23A 1XMOB 3UO3A 1M9NA 3DGEA 4O4HA 1Q6IA 2AXTZ 5KAIZ 1RSOA 5GONA 1QU7A 3N2KB 1QVGU 5LHIA 2B1GA 4JI3O 4QGPA 1I7FA 4K35A 3JSNA 3CRAA 1SZXA 4O2BA 3CMEV 2E76B 1MNGA 2BTQB 1VF5B 1ZUQA 4G27B 4GKKB 2ARHA 2HFEC 5LGTA 1S5HC 4MVOA 3H1LH 3ZRWA 2JGDA 5LP6A 2YUAA 4W4LA 4WCEV 2VRZA 3LNNA 3OMIB 3I5DA 3X2QC 4U3JB 2KQXA 4RUFA 2PY5A 2Q4PA 4JI6O 5IYCO 2QSAA 3KCYA 2XAQA 3OMNB 3ZRSA 4ZIBA 4LWSA 3L73H 4BR6A 2E5LB 4HAMA 1NVPD 4MVSA 4CH4A 3BABA 1ROPA 2EINC 2P90A 3KZIZ 4DV2O 3ZHVA 1Z5VA 1ZWIC 1AB3A 1UPGA 3F7VC 2BSKA 1ZL8A 4X65O 2PZSA 4JAUA 1GM9A 2CTQA 1MABG 2WA4A 4DV5B 3B40A 4IGGA 4JI5O 3HKEB 2NLJC 1FXKB 2OTLV 3OAAG 3CRRA 3JD3A 4K3AA 3HKDB 5L3EA 4Z1VA 1XMOO 3N2KA 3SR2C 3HKCB 2YI9A 2ZM6O 4DV4O 2E74B 2ZE5A 3FB8C 4FLYA 1R1BA 3RYHB 4X62B 4OX9O 2BTQA 3OUFA 5HFLA 1AJPA 1Y74B 1DTOA 4TV9B 1AJNA 4NTWA 4G2KA 4WFAV 2PI4A 2ZQMA 1KP3A 5KHGA 1KECA 4AI8A 4R50A 4JI8O 4GKKO 3E8BA 4QPJA 3CWBH 1VQMV 1L1FA 4U3JA 2QTOA 1ZLZA 2A9HA 4EFBA 2HJDA 3AK2A 5H9CA 3ZN0A 5EBWC 1VQ7V 4K0KO 1NR1A 3OT7A 4X64O 3L70H 2Q8VA 1DLBA 2Q5ZA 4F6EA 1HR0B 3ZX6A 1SQXH 4I55A 2UU9O 4I7ZB 4TSFG 5KX5B 2ATKC 3H9VA 5J2UB 1AI7A 4X66B 1BQ0A 2X6BA 4X8AA 2AZ2A 4JAAA 4MW8A 1NU1H 4MVMA 2EX3A 3JATA 5B3SB 3VQYA 5KA5A 2X7RB 3CSXA 1IBLB 3HKEA 1FXKA 2JS3A 4W4KA 5CBGA 4DR4B 3F5TA 1EFRG 1J5EO 5B5EZ 2CGNA 2ZIOA 3HKCA 5CA0B 2KB1A 5LBQA 1GRJA 3JASB 3OTOO 3G67A 3CCQV 3G80A 4PDMA 3BVOA 3OW2U 3K5LA 1XNQB 4JYCA 5TISZ 1VF6A 5JJJB 1Y74A 4TV9A 5H5NA 4JI7B 2OCCB 5H6RA 2P67A 1R3KC 1V55C 2QDOA 3RN4A 4DRXB 4H44B 1VIBA 4JI4B 1XNRB 1YHQV 1FJGO 2VQFB 3AG3B 3CCJV 1HWYA 2HR3A 3LUTB 4JZGA 2QA4V 1ZSPA 4DV1O 1M56B 1WLEA 2X6AA 2DE0X 1IXMA 3ZMTA 3FAVB 4D6TH 4X20B 1K73W 2WAMA 1YJNV 3SYOA 2WPDG 1VMGA 2EBOA 4CH3A 2BE3A 3DC5A 5KX5A 3K59A 2Y4UA 4F6RB 4NTYA 3T1CA 2IBZH 4EB6B 3CC4V 3EHBB 1Z2GA 1NT2B 2Q68A 1AP5A 3ZMSA 5HFMA 4FZ0A 5K1XA 2Q0OC 3CRCA 1Q43A 3QF7A 4FMTA 3CMAV 5IY5C 4U7NA 4KP4A 3ASOC 1NQTA 1OHHG 4QNHB 1IBKB 4CS4A 4FLUA 2UUBO 2L6LA 2DOSA 1KYOF 1CPYA 3ZRXA 1KC8W 5EIBD 3T1HO 3ABLB 2Q7EA 4DRXA 4WBNA 3S3XA 1F23A 1JJ2U 3W7UA 1YF2A 3TCUA 1PL0A 1R73A 2E3CA 1N0JA 4LH6A 4LF7O 1GKFA 3UM7A 4O4IB 4MS2A 2UXCB 1Q82W 1JVMA 1SRYA 1K5SA 5FL7G 3RYIB 2DWDC 3K9SA 3APOA 1HP8A 2UUCO 4J7JA 4X20A 1YIJV 5IE9A 1VQPV 2CH7B 2CUGA 4I9WA 3RYCB 1I94B 4B3RO 2ILMA 4F6RA 4LF9B 2X6CA 4EB6A 2P6JA 2A0LA 3E83A 3K5NA 4X1YB 2CTPA 3CXCU 1KUQA 3ZS8C 5BMVB 5E79Z 4P2ZA 4BW5A 4JYAO 4DR7O 1LUVA 4I50B 3K06A 4R7CA 1PL4A 3CEIA 4LF8O 3AG4C 4Z1MG 3EXAA 3G4SV 1RM1C 1WNSA 3BCCH 3A2FA 1E79G 5CBFA 4JV5B 2W6IG 2ZINA 4ZKIA 2JGUA 2V1DA 3PJSK 4JYBA 3I55V 1MZEA 1DGSA 3ABTA 1XMQB 2Y48A 1M57C 4RAIA 2Y0PA 1QVFU 1H2LA 2IW5A 1Y76B 4B08A 4F4LA 3N2GB 4B7KA 1NBMG 1P7BA 3ZMUA 4B3TO 3NR7A 3OE7G 2DYSC 1G6UA 1AR5A 1QLEC 2K9PA 2QGNA 1W2BU 1BS3A 4L8JA 2WSSG 1XQ8A 1IVSA 3OUSA 1US6A 1BCCH 4TQFA 3RYIA 1PPJH 2Z3YA 1H2MA 3ETDA 3ZRVA 2CGOA 2CH7A 2UXCO 3RYCA 5LHGA 1B04A 3FFQA 2MW2B 1SA0B 1FXKC 2EIMC 2VS0A 4DYLA 4X1YA 4BW9A 4J11A 3J7AU 2YSUB 1TA8A 2HKOA 3I56V 5BMVA 5CA3A 4FIPC 3K58A 2DWEC 5CB4B 2M7WA 2PI5A 5C8YB 4NKGB 3J81N 2ADQB 2WLKA 3ASNC 5EC2C 3ZIAG 1RPOA 4QJFB 3LNMB 1WP8A 2EIJB 2NR5A 2D2CB 2UXXA 1B6QA 2QKCA 1SERA 4FFKA 4JPRA 3BA9A 1HNZB 5DECA 1GM7A 4BIUA 4UV9A 2ITDC 1SQFA 5ITZB 4KXRA 3RYFA 4ZHQB 2WLNA 2GDSA 4EEQA 1Y76A 4WF9V 3N2GA 3E35A 1FFTB 1K7DA 1GN3A 2EILC 1OCRB 3ZCCA 1BHBA 3OEHG 4OXSA 2XAGA 4J7KA 3UQ8A 1MA1A 3A0RA 1TVKB 2WLJA 1XHXA 2F1MA 2X0LA 1OJHA 5JH7B 3VQVA 4FFBA 5LMUO 1VQ4V 2JEXA 4TQDA 5EIBC 4KL1A 1QLNA 2IJKA 4TV8A 1SA0A 4PDVA 3FB5C 4DUYO 2OCHA 2OIEA 2W0FC 4JI3B 5AG2A 5CMUA 1G4YB 4DV0O 3CC7V 2XHBA 4MSWC 5C8YA 3CD6V 3OR6C 5EZYB 5KAFZ 2Y69B 3MHHC 3B4SA 1IZ3A 1S5JA 5BXZA 3SGIA 2ZR2A 2YICA 3ABKC 3AG3C 1NH2B 3B8NA 4JI6B 4PELA 5ITZA 2P4VA 4QE9A 5FNVB 4ZHQA 2RCVA 3AG1C 5LA6B 2KG7B 1L8DA 4DK1A 2A7WA 4UUJC 3S3WA 4DV2B 1KB9F 1OCCB 1RP3B 2XOKG 2BCCH 2GSMB 5B1BC 2LGQA 1GAXA 2H3OA 2AZ0A 3K03A 5KHJA 3GWOA 3K79A 4FK5C 3AG2B 1KD1W 3E2EA 4EFEA 4JI1O 3KCXA 4LFCO 5J9PC 2LFRA 1HNXO 2UXBB 2ZM6B 2UXDO 4DV4B 1MOFA 2GTSA 2GUZB 3IGAC 4OX9B 3TXQA 2YS8A 2ZKOA 4IIJB 2DMXA 1HDJA 4XDLA 5EZYA 4DV3O 3CCRV 2LGWA 1HNWO 2G38A 1D5NA 2DYRC 4JI8B 1BQZA 1OCOB 2WLMA 3H1JH 3LDEA 3ZMZA 3N27A 1IBMB 1WPBA 3CE2A 5KA6A 1FFXB 4K0KB 1M4UA 5LA6A 1R3IC 2KG7A 4X64B 4MTXA 2RMKB 2FTKA 2WLLA 2UU9B 2YEVB 1K97A 1Z5WA 1YTFD 1MMMA 2VWKA 2W0XA 2Q0AA 1BZKA 3JCZA 4FLZA 3Q4HA 1D2DA 3H01A 2PF4E 3JD0A 1GK9A 4JYYA 1H8HG 2A79B 2A3QA 3WB2A 3C3TA 4IT5A 1J5EB 2BOBC 1SS3A 2JDIG 2IU0A 3WG7C 1YVWA 3OTOB 2F4VO 1K4DC 1SESA 5EBMC 1IDSA 2GUZA 4UVBA 2VQEB 3GWKC 1HW7A 3RGBA 2UXBO 1YJ9V 3CHXA 1CXZB 1IXBA 1P84F 2F66C 2OWOA 1M5IA 2N74A 4PA3A 1I0HA 1BL8A 1FJGB 1OCZB 2IH3C 5EYPB 2Q67A 4IYIA 2PUSA 1XDCA 4ZOLB 2QWNB 2P7TC 1AROP 4DV1B 5GTHZ 1FFXA 2OYQA 1EZJA 2QM4A 3ZJZA 3RW0A 4UCVA 1XILA 3CYOA 5L3BA 1IBMO 5L3DA 3UT5B 4FLWA 1G8MA 4GLXA 2QJ1A 4TT3G 5D5PA 4FPPA 1M90W 3RBZA 2WA3A 4N23A 2YEVA 1VEWA 1S72V 1KU9A 5CBHA 2PYLA 4CZZA 5FLXN 5A9GA 2ZE8A 3L72H 2N04A 4MT8A 1NTMH 2YIBA 4UVCA 4D7TA 3LSSA 5EC1C 3IC9A 2OTJV 1N33O 4B3MO 4LFAO 2JIZG 3BAAA 1YZBA 4OGQB 1KBHA 5JJEB 2UUBB 4LF6O 1N4CA 1SKVA 5LOVB 3HKDA 2AHYA 3G71V 2F95B 3QVNA 2Q69A 3P3NA 2EULA 4XDKA 3T1HB 2XT9A 3SJAC 2VQEO 3RYHA 1FYJA 3JARB 4CS3A 5FPOA 2YDEA 3U11A 3SPHA 1KMIZ 1Q6HA 5LMNO 5EYPA 2IU3A 1JMKC 4JI0B 4JASA 4LF7B 4NXMO 1XOUA 5JCOA 3K5MA 5D5QA 1BMFG 5L3CA 2HJFC 2UUCB 3E22B 3UT5A 3K04A 4E4EA 4B3RB 2Q9LA 3OTFA 2JEUA 1SZTA 2YI8A 3J80N 1L0NH 3C90A 4LFBO 1THZA 3HKBB 1N36O 4DR3O 3BRCA 2R70A 5J2UA 2EIKB 4JYAB 2WWWA 3DXRB 4DR7B 3ETGA 4MVRA 1P49A 4EKWA 5GW7A 4X9QA 3WU2Z 1MZFA 3R66A 4I0XB 1UJWB 4UXNA 1P4RA 4LF8B 5EK0A 1URFA 4A5UB 1Q5OA 4YHHO 2HG5C 5LOVA 4NXNO 1VQLV 4AILC 4UVAA 3TGUH 3JD2A 4JF3A 5CA0A 2CK3G 2V7QG 3JASA 3W7XA 2OIGA 3B77A 5LP6C 1X59A 2QWQB 2ZDIA 1DF4A 4B3TB 2ZCEA 3VOUA 2XAJA 1S0VA 4UFZA 5LXTB 1IX9A 4ICGA 1R3JC 4RWUA 2L35A 3CS5A 1XI1A 4MVQA 3ZN1A 3HR0A 3BPZA 3GB7C 3E22A 3SJBC 3TETA 4JI0O 1K3EA 5H2FZ 4R6ZA 2B9ZA 2QKSA 2ZR3A 3FAVA 4H33A 3L9DA 1K8AW 2Y0IA 4PA9A 2RQ6A 3HKBA 1YI2V 2H8PC 3OMAB 2YXLA 3KDRA 3APQA 3X2QB 2Q7HA 2QTSA 3NXSA 5J2TB 4I0XA 2JK5C 1QCEA 3HPLC 4UB8Z 2HVJC 3HB3B 2GTAA 1MSWD 3CRMA 1Q3EA 2PTMA 4GCZA 1AI5A 5LL6Y 2JVDA 2ODMA 3KG2A 2NNUA 2ZXWB 3CJHB 1FXHA 4JTDB 2P5OA 3JD1A 3E89A 4NR1A 3CC2V 4IHJB 5IJ0B 1H2SB 3MAQA 3ETEA 5LXTA 2EZOA 4X1IB 1YITV 4YJ2B 1BGYH 3DC6A 1K5QA 1GN2A 4PJ0Z 2P4KA 1TUBB 3T4ZA 1Q6UA 5LMUB 4DUZO 1E1QG 4GX1A 3F5WC 2UUAB 4FM1A 4O4IA 3JAKB 4ZI7B 1H5WA 2R72A 3W7WA 5B1NA 1KKCA 1H2NA 1TGOA 2BOCC 3E8GA 1S5LZ 2ZNJA 4DUYB 2Y4TA 1X4TA 1B3QA 1LNQA 4DR1O 2XASA 3AK1A 4DV0B 3O65A 1VQ8V 2MK3A 5J2TA 2QKAA 3AEIA 2UXNA 3SPIA 4I50A 4JI2O 4JZ2A 3TXSA 1JPXA 2XAHA 5CA1B 5JQGB 2NN4A 1R3LC 1EN5A 1BHAA 4X88A 1VF6C 2YIAA 4L87A 1N34B 3CJHA 4MVUA 1OCZC 3SPJA 3CCSV 4PA4A 3BY6A 4IHJA 5IJ0A 4LF4O 3M7MX 5K1PA 3CCVV 5LYJB 4TUYB 4WFGA 1NTKH 5JCOC 3UO2A 3ZMVA 2DJVA 3D8CA 4X1IA 3STLC 4PI0A 3T4DA 4DW1A 4GUNA 3FKSG 1FKAO 4FLVA 1YJWV 2CAZC 3JAKA 4ZI7A 5B1OA 3D3QA 2CTWA 5IWAO 2W6JG 4JI1B 2UUAO 1PD3A 4DW0A 4LFCB 2Z5UA 1PNKA 2ZD9A 1HNXB 1V55B 4ASUG 5B3SC 1IURA 1K33A 5KUKA 2QM8A 1F51A 2UXDB 5KHKA 4TOIA 1BE3H 1N32O 1QNMA 5IJ9B 4LCUC 2RJZA 5DN6G 4BWAA 3OEEG 3LSUA 4DV3B 3UCSC 1JR9A 3QO7A 1PNMA 2EJRA 2ZIMA 5CA1A 4CBCA 5CB4A 5BZBA 5JQGA 4RQEA 1HNWB 1XUQA 2XUMA 2ZDIC 1T5EA 4RUEA 4OPHA 4DO2A 4FM2A 4DV7O 2OCCC 4U7OA 1N34O 4YY3O 1RSOB 2PYJA 1H38A 4UB6Z 5KHHA 4TUYA 3IJ4A 5E1AC 1GN4A 3OGIB 1VQNV 1W59A 4BIOA 2ADPA 5IY5B 2WLIB 4X89A 4ZBMA 4O2BB 1NVPB 3EVKA 1M56C 1V54B 3CXHF 3OR7C 3ASOB 4J41A 2PGGA 2Q6AA 3FYEB 3SYAA 1TUEB 1TVKA 3ZRWB 2JGDB 4GX5A 5JH7A 3L71H 4MTFA 5BY1A 3QO8A 3CCLV 4BIZA 2ZNIA 1H2GA 3IAYA 4DR2O 5L3GA 2F4VB 4Q20A 1G1XB 1Q90D 2QWRB 1ZTEA 5IJ9A 4YIOA 1M93A 4IL6Z 2HVKC 5IYZB 1VQ6V 1FOUA 1ORQC 2XNDG 4KHPO 1R6TA 4NTXA 1XL6A 3W7SA 4LBEC 3ABMB 1W0KG 2R9AA 3LDDA 2F93B 2ZE6A 1I5XA 4LP8A 3ABLC 3JCUZ 4DV6O 3M8AA 4K8XA 1FAFA 4R8CA 4JAVA 1SETA 1V9PA 1Y6XA 5FNVA 3CPWU 1SF9A 5B1AB 1ZX3A 2WLIA 2DW4A 2CE4A 3JALB 3CX5F 3C3SA 4JTCB 3AG4B 2Q73A 2Z0AA 1KKDA 1N0NA 1AR4A 1RM1B 3SJCC 2XTAA 4PA7A 2QM7A 2JRIA 3A0HZ 2XAFA 3AG7A 3VBBA 3SYQA 3PN1A 4YIPA 3SDLA 4FM0A 4NB5A 4O2AB 2D3OW 2GV9A 3SYPA 4FLTA 1AI6A 1GMGA 1N33B 4B3MB 1M57B 1NH2D 4LFAB 5IT9N 3CCUV 3LDCA 3R65A 4LF6B 2ZT9B 1PKXA 2JJ1G 2DYSB 3K0GA 4LNUB 1QLEB 4DR5B 1VARA 1NZ6A 3MHSC 2QE7G 4J9YB 5IYZA 4QE7A 2ZXWC 4I55B 3F7YC 3OGCC 4PD4F 5KMGB 4LF5B 3ETQA 1VQ9V 3ZBHA 3FD9A 4GKJO 4IIJA 1OZ0A 3OD4A 2HHHO 3JATB 2P06A 5LMNB 1F4NA 1BSMA 4YXWG 1OV9A 2EIMB 2RDCA 2GBOA 1BT8A 1D5AA 1GO3F 1Y66A 4NXMB 1SQQH 1EN6A 3JD4A 2JS5A 1FXVA 2R9IA 4B7EA 1COWG 1ENVA 3B8MA 3K08A 1VP7A 4Q6GA 1AR1B 4CC6A 3JALA 3RFRA 1AVMA 4LFBB 4PDRA 2KKWA 3ASNB 4PV1B 3ZHQA 1N36B 1N8RW 2CTRA 4DR3B 3U10A 1QR8A 4GYCB 1WJZA 5JWPA 3ZHTA 4K8ZA 4O2AA 2Q7GA 3SYCA 5H6QA 2FYUH 2DQ3A 1WB7A 1WA8B 4N21A 1AI4A 3E8HA 3D36A 5DEDA 4YHHB 1I5YA 2LQTA 1Q8IA 2DQ0A 3JAMN 2EILB 4LNUA 5KUMA 4NXNB 3FB7C 3ZHSA 5LGNA 2VWJA 4CH6A 5KMGA 2E5LO 2EIJC 4J9ZB 4DR5O 4GX0A 1JCHA 2FL4A 1JFFB 1GH6A 1NR7A 2P22C 1SQPH 3U0ZA 1AP6A 4LF5O 1YSCA 2YIBD 5IYBO 4J10A 1SQBH 5LGUA 5EBLC 4QIWF 4DV5O 1Q86W 1XREA 3A8TA 1OCRC 3E86A 1VF7A 1WPXA 4ZOLA 1UFIA 4U3FH 1WB8A 3IFXA 3W7TA 2V4DA 5KHIA 4CH5A 4H0LB 2ITCC 1KQSU 1CEZA 4XDJA 1R6NA 4FJCC 4P9PA 4X62O 4UCUA 5DM6V 5IDJA 3CCMV 1SQVH 4WBNB 3WFVA 1F4MA 4RO2A 1MG1A 1W0JG 3ABKB 1WA8A 3ICXA 2O57A 3K57A 2C2AA 2IM9A 1FD9A 5JVDB 3AG1B 1FPOA 4E2LA 2QR4A 5B66Z 3CCEV 2Y69C 1A32A 2RN9A 3IC7A 2LJ2A 4KUMA 5B1BB 3K3WA 2IJIA 1HR0O 1L0LH 1JFFA 1NS1A 3H1KH 4UCTA 3VQWA 2QEXV 3H1IH 2YIDA 3JARA 4X66O 4OPAA 3QTCA 1XHZA 3WB1A 1PM9A 1NTZH 1K92A 4J7ZA 2R9RB 1V54C 1TAEA 4DUZB 1IBLO 3RWRD 2K1EA 5CN0A 1AJQA 1OCCC 3K0DA 4DR4O 4LR3A 1E1RG 4J42A 1AILA 3JYCA 3STZC 4I5SA 4UV8A 4GT1A 4DR1B 3DTUB 2DYRB 1SC5B 1XNQO 4AQYB 3AG2C 4I9QA 3L74H 2LP7A 4UCSA 4JI7O 2QWPB 1NI8A 4HBNA 4UCRA 3DXRA 3ZHRA 5JVDA 4JI4O 4JI2B 1XNRO 1O9GA 1Q7YW 2VQFO 4O4LB 4LH7A 4IYHA 4P30A 3ABMC 3THOA 4KFMA 3RVZA 1GTOA 1DK1A 2CDYA 1LUWA 2FB5A 3P3PA 1Q81W 3JSLA 3H1HH 1EN4A 2YXYA 3D3IA 3TJTA 1H8EG 2EINB 1RPRA 4LF4B 1DF5A 4DK0A 3RT3C 1OCOC
chains in the Genus database with same CATH topology
3IC9A 1N0JA 1AVMA 1QNMA 3K9SA 3AK3A 1MMMA 1KKCA 3LSUA 3RN4A 1MSDA 1JR9A 1IX9A 3QVNA 1WB7A 2RCVA 1XUQA 2ADQB 1P7GA 2CE4A 3C3SA 3AK1A 4JZGA 1N0NA 1AR4A 1EM1A 4JYYA 1ZSPA 2QKCA 4FFKA 2QKAA 3C3TA 4YIPA 1Y67A 1LUVA 1PM9A 1GN4A 1PL4A 4JZ2A 1IDSA 3CEIA 2GDSA 2ADPA 3DC5A 1EN5A 1ZLZA 1GN3A 3EVKA 1I08A 1GN6A 1SZXA 3KDRA 3AK2A 1IXBA 1MNGA 1ZUQA 1AP6A 1MA1A 1AP5A 4E4EA 3OT7A 1I0HA 1VARA 3BFRA 4F6EA 1XREA 1B06A 1XDCA 1WB8A 4GUNA 1AR5A 1XILA 3MDSA 1BS3A 4X9QA 3KKYA 1BSMA 1D5NA 1ZTEA 4C7UA 4BR6A 4YIOA 1BT8A 1VEWA 5AG2A 1EN6A 2AW9A 5A9GA 2CDYA 1JA8A 1LUWA 3DC6A 1EN4A 1GN2A 3TJTA 2P4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IC9 A;  1N0J A;  1AVM A;  1QNM A;  3K9S A;  3AK3 A;  1MMM A;  1KKC A;  3LSU A;  3RN4 A;  1MSD A;  1JR9 A;  1IX9 A;  3QVN A;  1WB7 A;  2RCV A;  1XUQ A;  2ADQ B;  1P7G A;  2CE4 A;  3C3S A;  3AK1 A;  4JZG A;  1N0N A;  1AR4 A;  1EM1 A;  4JYY A;  1ZSP A;  2QKC A;  4FFK A;  2QKA A;  3C3T A;  4YIP A;  1Y67 A;  1LUV A;  1PM9 A;  1GN4 A;  1PL4 A;  4JZ2 A;  1IDS A;  3CEI A;  2GDS A;  2ADP A;  3DC5 A;  1EN5 A;  1ZLZ A;  1GN3 A;  3EVK A;  1I08 A;  1GN6 A;  1SZX A;  3AK2 A;  1IXB A;  1MNG A;  1ZUQ A;  1AP6 A;  1MA1 A;  1AP5 A;  4E4E A;  3OT7 A;  1I0H A;  1VAR A;  3BFR A;  4F6E A;  1XRE A;  1B06 A;  1XDC A;  1WB8 A;  4GUN A;  1AR5 A;  1XIL A;  3MDS A;  1BS3 A;  4X9Q A;  3KKY A;  1BSM A;  1D5N A;  1ZTE A;  4C7U A;  4BR6 A;  4YIO A;  1BT8 A;  1VEW A;  5AG2 A;  1EN6 A;  2AW9 A;  5A9G A;  2CDY A;  1JA8 A;  1LUW A;  3DC6 A;  1EN4 A;  1GN2 A;  3TJT A;  2P4K A; 
#chains in the Genus database with same CATH topology
 4WFH A;  3QG5 A;  2JJ2 G;  3ABU A;  2HLD G;  5LHH A;  1EBO A;  1PNL A;  3T2M A;  5B1A C;  4CC5 A;  1K4C C;  4WFF A;  3WG7 B;  3DSQ A;  4PDL A;  4J80 A;  4NVP A;  4MTG A;  1FS0 G;  1U97 A;  2WLH A;  3VQX A;  5KLV H;  2LFS A;  1P7G A;  4X1K B;  3TK1 A;  1R6K A;  5IWA B;  1LR1 A;  3FB6 C;  5GTI Z;  1JNB A;  2IJJ A;  1IBK O;  4YJ3 B;  4AHC A;  2E75 B;  3RYF B;  3SJQ C;  2IH1 C;  3ZHU A;  3D36 C;  3JAW B;  3BEH A;  1XL4 A;  4FLX A;  1U96 A;  2BTO A;  2YC0 A;  5BR8 B;  3O9O A;  4MTO A;  1N32 B;  3RVY A;  1I08 A;  1O9H A;  4CS2 A;  4AQY O;  1WN7 A;  1K34 A;  1WAZ A;  3BA8 A;  4O4L A;  4WFB V;  4FFB B;  3CRQ A;  4QPK A;  3E8F A;  2KSD A;  4DV7 B;  4TV8 B;  4FZ1 A;  1JQ0 A;  4B3S B;  4I4T B;  3K5O A;  4YY3 B;  4O4J B;  5FPR A;  1I94 O;  3KKY A;  4LF9 O;  4H37 A;  4C7U A;  3T1Y B;  1EZV H;  1GM8 A;  4H13 B;  1QHT A;  2QWO B;  1JX9 A;  2RNB A;  4FVM A;  1JA8 A;  1ZAU A;  2N05 A;  1YDX A;  4NYK A;  4MVZ A;  3G6E V;  4BAY A;  4YJ2 A;  3M99 B;  3QNE A;  1TUB A;  2F43 G;  2IJH A;  4X1K A;  3MD0 A;  4GZR B;  2LW7 A;  1F7Y A;  3OFN G;  4YJ3 A;  1XBL A;  2HP8 A;  1YEW A;  1NKD A;  5IYD O;  4JV5 O;  3JAW A;  4DR2 B;  4HNA B;  1J95 A;  4JGS A;  4MW3 A;  1VQ5 V;  2YXH A;  1XMQ O;  3EFF K;  2EJ7 A;  5JJN B;  1JOY A;  4KHP B;  3P32 A;  2DN9 A;  5BR8 O;  3ZED A;  4TWK A;  1CP9 A;  4DR6 B;  3B2E E;  1Y67 A;  4ABM A;  3LSQ A;  5F2V O;  2OT5 A;  2H94 A;  1JJO A;  4WFE A;  1S3J A;  3K9A A;  1S77 D;  3FX7 A;  1S76 D;  1Y4M A;  4UCO A;  4G28 B;  4DV6 B;  2B1I A;  1GN6 A;  3FYI B;  4XBF A;  4I4T A;  1IJG A;  3QO5 A;  3GVM A;  4P9O A;  1QBZ A;  4O4J A;  4Z2W A;  2ZE7 A;  1M1K W;  1YXB A;  1QQC A;  4O4H B;  4B3S O;  1VQK V;  2AGA A;  3BFR A;  3CP1 A;  1NJI W;  5C93 A;  2LO1 A;  3L75 H;  3A0B Z;  5LYJ A;  1SQG A;  1RFY A;  5GON B;  1B06 A;  1WP7 A;  3CB2 A;  3T1Y O;  3P30 A;  1PV0 A;  1YTF B;  1VQO V;  5A2Q N;  4HZ3 A;  2EZP A;  1QR9 A;  2A06 H;  3MDS A;  3UKM A;  2FML A;  3SPG A;  3WB0 A;  2M6Y A;  5LP6 B;  2AW9 A;  1K9M W;  2EIK C;  2ETN A;  2LW1 A;  4PHZ A;  4HNA A;  2GHY A;  1HNZ O;  5L3F A;  4PI2 A;  4PA6 A;  2AHZ A;  4JTA B;  4GX2 A;  2HEP A;  4HYO A;  2WLL B;  4LWS B;  4RQF A;  1KP2 A;  4X65 B;  3AK3 A;  4GKJ B;  3BHP A;  4D7S A;  2HHH B;  1MSD A;  1PP9 H;  2FKX A;  3SPC A;  2BSK B;  2B5U A;  3Q4H B;  4JI5 B;  1YCI A;  4DR6 O;  4DXW A;  1ZL8 B;  1H2K A;  3ML0 A;  3B09 A;  4LC1 A;  3G6B A;  1EM1 A;  3OM3 B;  1XEQ A;  2F23 A;  1XMO B;  3UO3 A;  1M9N A;  3DGE A;  4O4H A;  1Q6I A;  2AXT Z;  5KAI Z;  1RSO A;  5GON A;  1QU7 A;  3N2K B;  1QVG U;  5LHI A;  2B1G A;  4JI3 O;  4QGP A;  1I7F A;  4K35 A;  3JSN A;  3CRA A;  1SZX A;  4O2B A;  3CME V;  2E76 B;  1MNG A;  2BTQ B;  1VF5 B;  1ZUQ A;  4G27 B;  4GKK B;  2ARH A;  2HFE C;  5LGT A;  1S5H C;  4MVO A;  3H1L H;  3ZRW A;  2JGD A;  5LP6 A;  2YUA A;  4W4L A;  4WCE V;  2VRZ A;  3LNN A;  3OMI B;  3I5D A;  3X2Q C;  4U3J B;  2KQX A;  4RUF A;  2PY5 A;  2Q4P A;  4JI6 O;  5IYC O;  2QSA A;  3KCY A;  2XAQ A;  3OMN B;  3ZRS A;  4ZIB A;  4LWS A;  3L73 H;  4BR6 A;  2E5L B;  4HAM A;  1NVP D;  4MVS A;  4CH4 A;  3BAB A;  1ROP A;  2EIN C;  2P90 A;  3KZI Z;  4DV2 O;  3ZHV A;  1Z5V A;  1ZWI C;  1AB3 A;  1UPG A;  3F7V C;  2BSK A;  1ZL8 A;  4X65 O;  2PZS A;  4JAU A;  1GM9 A;  2CTQ A;  1MAB G;  2WA4 A;  4DV5 B;  3B40 A;  4IGG A;  4JI5 O;  3HKE B;  2NLJ C;  1FXK B;  2OTL V;  3OAA G;  3CRR A;  3JD3 A;  4K3A A;  3HKD B;  5L3E A;  4Z1V A;  1XMO O;  3N2K A;  3SR2 C;  3HKC B;  2YI9 A;  2ZM6 O;  4DV4 O;  2E74 B;  2ZE5 A;  3FB8 C;  4FLY A;  1R1B A;  3RYH B;  4X62 B;  4OX9 O;  2BTQ A;  3OUF A;  5HFL A;  1AJP A;  1Y74 B;  1DTO A;  4TV9 B;  1AJN A;  4NTW A;  4G2K A;  4WFA V;  2PI4 A;  2ZQM A;  1KP3 A;  5KHG A;  1KEC A;  4AI8 A;  4R50 A;  4JI8 O;  4GKK O;  3E8B A;  4QPJ A;  3CWB H;  1VQM V;  1L1F A;  4U3J A;  2QTO A;  1ZLZ A;  2A9H A;  4EFB A;  2HJD A;  3AK2 A;  5H9C A;  3ZN0 A;  5EBW C;  1VQ7 V;  4K0K O;  1NR1 A;  3OT7 A;  4X64 O;  3L70 H;  2Q8V A;  1DLB A;  2Q5Z A;  4F6E A;  1HR0 B;  3ZX6 A;  1SQX H;  4I55 A;  2UU9 O;  4I7Z B;  4TSF G;  5KX5 B;  2ATK C;  3H9V A;  5J2U B;  1AI7 A;  4X66 B;  1BQ0 A;  2X6B A;  4X8A A;  2AZ2 A;  4JAA A;  4MW8 A;  1NU1 H;  4MVM A;  2EX3 A;  3JAT A;  5B3S B;  3VQY A;  5KA5 A;  2X7R B;  3CSX A;  1IBL B;  3HKE A;  1FXK A;  2JS3 A;  4W4K A;  5CBG A;  4DR4 B;  3F5T A;  1EFR G;  1J5E O;  5B5E Z;  2CGN A;  2ZIO A;  3HKC A;  5CA0 B;  2KB1 A;  5LBQ A;  1GRJ A;  3JAS B;  3OTO O;  3G67 A;  3CCQ V;  3G80 A;  4PDM A;  3BVO A;  3OW2 U;  3K5L A;  1XNQ B;  4JYC A;  5TIS Z;  1VF6 A;  5JJJ B;  1Y74 A;  4TV9 A;  5H5N A;  4JI7 B;  2OCC B;  5H6R A;  2P67 A;  1R3K C;  1V55 C;  2QDO A;  3RN4 A;  4DRX B;  4H44 B;  1VIB A;  4JI4 B;  1XNR B;  1YHQ V;  1FJG O;  2VQF B;  3AG3 B;  3CCJ V;  1HWY A;  2HR3 A;  3LUT B;  4JZG A;  2QA4 V;  1ZSP A;  4DV1 O;  1M56 B;  1WLE A;  2X6A A;  2DE0 X;  1IXM A;  3ZMT A;  3FAV B;  4D6T H;  4X20 B;  1K73 W;  2WAM A;  1YJN V;  3SYO A;  2WPD G;  1VMG A;  2EBO A;  4CH3 A;  2BE3 A;  3DC5 A;  5KX5 A;  3K59 A;  2Y4U A;  4F6R B;  4NTY A;  3T1C A;  2IBZ H;  4EB6 B;  3CC4 V;  3EHB B;  1Z2G A;  1NT2 B;  2Q68 A;  1AP5 A;  3ZMS A;  5HFM A;  4FZ0 A;  5K1X A;  2Q0O C;  3CRC A;  1Q43 A;  3QF7 A;  4FMT A;  3CMA V;  5IY5 C;  4U7N A;  4KP4 A;  3ASO C;  1NQT A;  1OHH G;  4QNH B;  1IBK B;  4CS4 A;  4FLU A;  2UUB O;  2L6L A;  2DOS A;  1KYO F;  1CPY A;  3ZRX A;  1KC8 W;  5EIB D;  3T1H O;  3ABL B;  2Q7E A;  4DRX A;  4WBN A;  3S3X A;  1F23 A;  1JJ2 U;  3W7U A;  1YF2 A;  3TCU A;  1PL0 A;  1R73 A;  2E3C A;  1N0J A;  4LH6 A;  4LF7 O;  1GKF A;  3UM7 A;  4O4I B;  4MS2 A;  2UXC B;  1Q82 W;  1JVM A;  1SRY A;  1K5S A;  5FL7 G;  3RYI B;  2DWD C;  3K9S A;  3APO A;  1HP8 A;  2UUC O;  4J7J A;  4X20 A;  1YIJ V;  5IE9 A;  1VQP V;  2CH7 B;  2CUG A;  4I9W A;  3RYC B;  1I94 B;  4B3R O;  2ILM A;  4F6R A;  4LF9 B;  2X6C A;  4EB6 A;  2P6J A;  2A0L A;  3E83 A;  3K5N A;  4X1Y B;  2CTP A;  3CXC U;  1KUQ A;  3ZS8 C;  5BMV B;  5E79 Z;  4P2Z A;  4BW5 A;  4JYA O;  4DR7 O;  1LUV A;  4I50 B;  3K06 A;  4R7C A;  1PL4 A;  3CEI A;  4LF8 O;  3AG4 C;  4Z1M G;  3EXA A;  3G4S V;  1RM1 C;  1WNS A;  3BCC H;  3A2F A;  1E79 G;  5CBF A;  4JV5 B;  2W6I G;  2ZIN A;  4ZKI A;  2JGU A;  2V1D A;  3PJS K;  4JYB A;  3I55 V;  1MZE A;  1DGS A;  3ABT A;  1XMQ B;  2Y48 A;  1M57 C;  4RAI A;  2Y0P A;  1QVF U;  1H2L A;  2IW5 A;  1Y76 B;  4B08 A;  4F4L A;  3N2G B;  4B7K A;  1NBM G;  1P7B A;  3ZMU A;  4B3T O;  3NR7 A;  3OE7 G;  2DYS C;  1G6U A;  1AR5 A;  1QLE C;  2K9P A;  2QGN A;  1W2B U;  1BS3 A;  4L8J A;  2WSS G;  1XQ8 A;  1IVS A;  3OUS A;  1US6 A;  1BCC H;  4TQF A;  3RYI A;  1PPJ H;  2Z3Y A;  1H2M A;  3ETD A;  3ZRV A;  2CGO A;  2CH7 A;  2UXC O;  3RYC A;  5LHG A;  1B04 A;  3FFQ A;  2MW2 B;  1SA0 B;  1FXK C;  2EIM C;  2VS0 A;  4DYL A;  4X1Y A;  4BW9 A;  4J11 A;  3J7A U;  2YSU B;  1TA8 A;  2HKO A;  3I56 V;  5BMV A;  5CA3 A;  4FIP C;  3K58 A;  2DWE C;  5CB4 B;  2M7W A;  2PI5 A;  5C8Y B;  4NKG B;  3J81 N;  2ADQ B;  2WLK A;  3ASN C;  5EC2 C;  3ZIA G;  1RPO A;  4QJF B;  3LNM B;  1WP8 A;  2EIJ B;  2NR5 A;  2D2C B;  2UXX A;  1B6Q A;  2QKC A;  1SER A;  4FFK A;  4JPR A;  3BA9 A;  1HNZ B;  5DEC A;  1GM7 A;  4BIU A;  4UV9 A;  2ITD C;  1SQF A;  5ITZ B;  4KXR A;  3RYF A;  4ZHQ B;  2WLN A;  2GDS A;  4EEQ A;  1Y76 A;  4WF9 V;  3N2G A;  3E35 A;  1FFT B;  1K7D A;  1GN3 A;  2EIL C;  1OCR B;  3ZCC A;  1BHB A;  3OEH G;  4OXS A;  2XAG A;  4J7K A;  3UQ8 A;  1MA1 A;  3A0R A;  1TVK B;  2WLJ A;  1XHX A;  2F1M A;  2X0L A;  1OJH A;  5JH7 B;  3VQV A;  4FFB A;  5LMU O;  1VQ4 V;  2JEX A;  4TQD A;  5EIB C;  4KL1 A;  1QLN A;  2IJK A;  4TV8 A;  1SA0 A;  4PDV A;  3FB5 C;  4DUY O;  2OCH A;  2OIE A;  2W0F C;  4JI3 B;  5AG2 A;  5CMU A;  1G4Y B;  4DV0 O;  3CC7 V;  2XHB A;  4MSW C;  5C8Y A;  3CD6 V;  3OR6 C;  5EZY B;  5KAF Z;  2Y69 B;  3MHH C;  3B4S A;  1IZ3 A;  1S5J A;  5BXZ A;  3SGI A;  2ZR2 A;  2YIC A;  3ABK C;  3AG3 C;  1NH2 B;  3B8N A;  4JI6 B;  4PEL A;  5ITZ A;  2P4V A;  4QE9 A;  5FNV B;  4ZHQ A;  2RCV A;  3AG1 C;  5LA6 B;  2KG7 B;  1L8D A;  4DK1 A;  2A7W A;  4UUJ C;  3S3W A;  4DV2 B;  1KB9 F;  1OCC B;  1RP3 B;  2XOK G;  2BCC H;  2GSM B;  5B1B C;  2LGQ A;  1GAX A;  2H3O A;  2AZ0 A;  3K03 A;  5KHJ A;  3GWO A;  3K79 A;  4FK5 C;  3AG2 B;  1KD1 W;  3E2E A;  4EFE A;  4JI1 O;  3KCX A;  4LFC O;  5J9P C;  2LFR A;  1HNX O;  2UXB B;  2ZM6 B;  2UXD O;  4DV4 B;  1MOF A;  2GTS A;  2GUZ B;  3IGA C;  4OX9 B;  3TXQ A;  2YS8 A;  2ZKO A;  4IIJ B;  2DMX A;  1HDJ A;  4XDL A;  5EZY A;  4DV3 O;  3CCR V;  2LGW A;  1HNW O;  2G38 A;  1D5N A;  2DYR C;  4JI8 B;  1BQZ A;  1OCO B;  2WLM A;  3H1J H;  3LDE A;  3ZMZ A;  3N27 A;  1IBM B;  1WPB A;  3CE2 A;  5KA6 A;  1FFX B;  4K0K B;  1M4U A;  5LA6 A;  1R3I C;  2KG7 A;  4X64 B;  4MTX A;  2RMK B;  2FTK A;  2WLL A;  2UU9 B;  2YEV B;  1K97 A;  1Z5W A;  1YTF D;  1MMM A;  2VWK A;  2W0X A;  2Q0A A;  1BZK A;  3JCZ A;  4FLZ A;  3Q4H A;  1D2D A;  3H01 A;  2PF4 E;  3JD0 A;  1GK9 A;  4JYY A;  1H8H G;  2A79 B;  2A3Q A;  3WB2 A;  3C3T A;  4IT5 A;  1J5E B;  2BOB C;  1SS3 A;  2JDI G;  2IU0 A;  3WG7 C;  1YVW A;  3OTO B;  2F4V O;  1K4D C;  1SES A;  5EBM C;  1IDS A;  2GUZ A;  4UVB A;  2VQE B;  3GWK C;  1HW7 A;  3RGB A;  2UXB O;  1YJ9 V;  3CHX A;  1CXZ B;  1IXB A;  1P84 F;  2F66 C;  2OWO A;  1M5I A;  2N74 A;  4PA3 A;  1I0H A;  1BL8 A;  1FJG B;  1OCZ B;  2IH3 C;  5EYP B;  2Q67 A;  4IYI A;  2PUS A;  1XDC A;  4ZOL B;  2QWN B;  2P7T C;  1ARO P;  4DV1 B;  5GTH Z;  1FFX A;  2OYQ A;  1EZJ A;  2QM4 A;  3ZJZ A;  3RW0 A;  4UCV A;  1XIL A;  3CYO A;  5L3B A;  1IBM O;  5L3D A;  3UT5 B;  4FLW A;  1G8M A;  4GLX A;  2QJ1 A;  4TT3 G;  5D5P A;  4FPP A;  1M90 W;  3RBZ A;  2WA3 A;  4N23 A;  2YEV A;  1VEW A;  1S72 V;  1KU9 A;  5CBH A;  2PYL A;  4CZZ A;  5FLX N;  5A9G A;  2ZE8 A;  3L72 H;  2N04 A;  4MT8 A;  1NTM H;  2YIB A;  4UVC A;  4D7T A;  3LSS A;  5EC1 C;  3IC9 A;  2OTJ V;  1N33 O;  4B3M O;  4LFA O;  2JIZ G;  3BAA A;  1YZB A;  4OGQ B;  1KBH A;  5JJE B;  2UUB B;  4LF6 O;  1N4C A;  1SKV A;  5LOV B;  3HKD A;  2AHY A;  3G71 V;  2F95 B;  3QVN A;  2Q69 A;  3P3N A;  2EUL A;  4XDK A;  3T1H B;  2XT9 A;  3SJA C;  2VQE O;  3RYH A;  1FYJ A;  3JAR B;  4CS3 A;  5FPO A;  2YDE A;  3U11 A;  3SPH A;  1KMI Z;  1Q6H A;  5LMN O;  5EYP A;  2IU3 A;  1JMK C;  4JI0 B;  4JAS A;  4LF7 B;  4NXM O;  1XOU A;  5JCO A;  3K5M A;  5D5Q A;  1BMF G;  5L3C A;  2HJF C;  2UUC B;  3E22 B;  3UT5 A;  3K04 A;  4E4E A;  4B3R B;  2Q9L A;  3OTF A;  2JEU A;  1SZT A;  2YI8 A;  3J80 N;  1L0N H;  3C90 A;  4LFB O;  1THZ A;  3HKB B;  1N36 O;  4DR3 O;  3BRC A;  2R70 A;  5J2U A;  2EIK B;  4JYA B;  2WWW A;  3DXR B;  4DR7 B;  3ETG A;  4MVR A;  1P49 A;  4EKW A;  5GW7 A;  4X9Q A;  3WU2 Z;  1MZF A;  3R66 A;  4I0X B;  1UJW B;  4UXN A;  1P4R A;  4LF8 B;  5EK0 A;  1URF A;  4A5U B;  1Q5O A;  4YHH O;  2HG5 C;  5LOV A;  4NXN O;  1VQL V;  4AIL C;  4UVA A;  3TGU H;  3JD2 A;  4JF3 A;  5CA0 A;  2CK3 G;  2V7Q G;  3JAS A;  3W7X A;  2OIG A;  3B77 A;  5LP6 C;  1X59 A;  2QWQ B;  2ZDI A;  1DF4 A;  4B3T B;  2ZCE A;  3VOU A;  2XAJ A;  1S0V A;  4UFZ A;  5LXT B;  1IX9 A;  4ICG A;  1R3J C;  4RWU A;  2L35 A;  3CS5 A;  1XI1 A;  4MVQ A;  3ZN1 A;  3HR0 A;  3BPZ A;  3GB7 C;  3E22 A;  3SJB C;  3TET A;  4JI0 O;  1K3E A;  5H2F Z;  4R6Z A;  2B9Z A;  2QKS A;  2ZR3 A;  3FAV A;  4H33 A;  3L9D A;  1K8A W;  2Y0I A;  4PA9 A;  2RQ6 A;  3HKB A;  1YI2 V;  2H8P C;  3OMA B;  2YXL A;  3KDR A;  3APQ A;  3X2Q B;  2Q7H A;  2QTS A;  3NXS A;  5J2T B;  4I0X A;  2JK5 C;  1QCE A;  3HPL C;  4UB8 Z;  2HVJ C;  3HB3 B;  2GTA A;  1MSW D;  3CRM A;  1Q3E A;  2PTM A;  4GCZ A;  1AI5 A;  5LL6 Y;  2JVD A;  2ODM A;  3KG2 A;  2NNU A;  2ZXW B;  3CJH B;  1FXH A;  4JTD B;  2P5O A;  3JD1 A;  3E89 A;  4NR1 A;  3CC2 V;  4IHJ B;  5IJ0 B;  1H2S B;  3MAQ A;  3ETE A;  5LXT A;  2EZO A;  4X1I B;  1YIT V;  4YJ2 B;  1BGY H;  3DC6 A;  1K5Q A;  1GN2 A;  4PJ0 Z;  2P4K A;  1TUB B;  3T4Z A;  1Q6U A;  5LMU B;  4DUZ O;  1E1Q G;  4GX1 A;  3F5W C;  2UUA B;  4FM1 A;  4O4I A;  3JAK B;  4ZI7 B;  1H5W A;  2R72 A;  3W7W A;  5B1N A;  1KKC A;  1H2N A;  1TGO A;  2BOC C;  3E8G A;  1S5L Z;  2ZNJ A;  4DUY B;  2Y4T A;  1X4T A;  1B3Q A;  1LNQ A;  4DR1 O;  2XAS A;  3AK1 A;  4DV0 B;  3O65 A;  1VQ8 V;  2MK3 A;  5J2T A;  2QKA A;  3AEI A;  2UXN A;  3SPI A;  4I50 A;  4JI2 O;  4JZ2 A;  3TXS A;  1JPX A;  2XAH A;  5CA1 B;  5JQG B;  2NN4 A;  1R3L C;  1EN5 A;  1BHA A;  4X88 A;  1VF6 C;  2YIA A;  4L87 A;  1N34 B;  3CJH A;  4MVU A;  1OCZ C;  3SPJ A;  3CCS V;  4PA4 A;  3BY6 A;  4IHJ A;  5IJ0 A;  4LF4 O;  3M7M X;  5K1P A;  3CCV V;  5LYJ B;  4TUY B;  4WFG A;  1NTK H;  5JCO C;  3UO2 A;  3ZMV A;  2DJV A;  3D8C A;  4X1I A;  3STL C;  4PI0 A;  3T4D A;  4DW1 A;  4GUN A;  3FKS G;  1FKA O;  4FLV A;  1YJW V;  2CAZ C;  3JAK A;  4ZI7 A;  5B1O A;  3D3Q A;  2CTW A;  5IWA O;  2W6J G;  4JI1 B;  2UUA O;  1PD3 A;  4DW0 A;  4LFC B;  2Z5U A;  1PNK A;  2ZD9 A;  1HNX B;  1V55 B;  4ASU G;  5B3S C;  1IUR A;  1K33 A;  5KUK A;  2QM8 A;  1F51 A;  2UXD B;  5KHK A;  4TOI A;  1BE3 H;  1N32 O;  1QNM A;  5IJ9 B;  4LCU C;  2RJZ A;  5DN6 G;  4BWA A;  3OEE G;  3LSU A;  4DV3 B;  3UCS C;  1JR9 A;  3QO7 A;  1PNM A;  2EJR A;  2ZIM A;  5CA1 A;  4CBC A;  5CB4 A;  5BZB A;  5JQG A;  4RQE A;  1HNW B;  1XUQ A;  2XUM A;  2ZDI C;  1T5E A;  4RUE A;  4OPH A;  4DO2 A;  4FM2 A;  4DV7 O;  2OCC C;  4U7O A;  1N34 O;  4YY3 O;  1RSO B;  2PYJ A;  1H38 A;  4UB6 Z;  5KHH A;  4TUY A;  3IJ4 A;  5E1A C;  1GN4 A;  3OGI B;  1VQN V;  1W59 A;  4BIO A;  2ADP A;  5IY5 B;  2WLI B;  4X89 A;  4ZBM A;  4O2B B;  1NVP B;  3EVK A;  1M56 C;  1V54 B;  3CXH F;  3OR7 C;  3ASO B;  4J41 A;  2PGG A;  2Q6A A;  3FYE B;  3SYA A;  1TUE B;  1TVK A;  3ZRW B;  2JGD B;  4GX5 A;  5JH7 A;  3L71 H;  4MTF A;  5BY1 A;  3QO8 A;  3CCL V;  4BIZ A;  2ZNI A;  1H2G A;  3IAY A;  4DR2 O;  5L3G A;  2F4V B;  4Q20 A;  1G1X B;  1Q90 D;  2QWR B;  1ZTE A;  5IJ9 A;  4YIO A;  1M93 A;  4IL6 Z;  2HVK C;  5IYZ B;  1VQ6 V;  1FOU A;  1ORQ C;  2XND G;  4KHP O;  1R6T A;  4NTX A;  1XL6 A;  3W7S A;  4LBE C;  3ABM B;  1W0K G;  2R9A A;  3LDD A;  2F93 B;  2ZE6 A;  1I5X A;  4LP8 A;  3ABL C;  3JCU Z;  4DV6 O;  3M8A A;  4K8X A;  1FAF A;  4R8C A;  4JAV A;  1SET A;  1V9P A;  1Y6X A;  5FNV A;  3CPW U;  1SF9 A;  5B1A B;  1ZX3 A;  2WLI A;  2DW4 A;  2CE4 A;  3JAL B;  3CX5 F;  3C3S A;  4JTC B;  3AG4 B;  2Q73 A;  2Z0A A;  1KKD A;  1N0N A;  1AR4 A;  1RM1 B;  3SJC C;  2XTA A;  4PA7 A;  2QM7 A;  2JRI A;  3A0H Z;  2XAF A;  3AG7 A;  3VBB A;  3SYQ A;  3PN1 A;  4YIP A;  3SDL A;  4FM0 A;  4NB5 A;  4O2A B;  2D3O W;  2GV9 A;  3SYP A;  4FLT A;  1AI6 A;  1GMG A;  1N33 B;  4B3M B;  1M57 B;  1NH2 D;  4LFA B;  5IT9 N;  3CCU V;  3LDC A;  3R65 A;  4LF6 B;  2ZT9 B;  1PKX A;  2JJ1 G;  2DYS B;  3K0G A;  4LNU B;  1QLE B;  4DR5 B;  1VAR A;  1NZ6 A;  3MHS C;  2QE7 G;  4J9Y B;  5IYZ A;  4QE7 A;  2ZXW C;  4I55 B;  3F7Y C;  3OGC C;  4PD4 F;  5KMG B;  4LF5 B;  3ETQ A;  1VQ9 V;  3ZBH A;  3FD9 A;  4GKJ O;  4IIJ A;  1OZ0 A;  3OD4 A;  2HHH O;  3JAT B;  2P06 A;  5LMN B;  1F4N A;  1BSM A;  4YXW G;  1OV9 A;  2EIM B;  2RDC A;  2GBO A;  1BT8 A;  1D5A A;  1GO3 F;  1Y66 A;  4NXM B;  1SQQ H;  1EN6 A;  3JD4 A;  2JS5 A;  1FXV A;  2R9I A;  4B7E A;  1COW G;  1ENV A;  3B8M A;  3K08 A;  1VP7 A;  4Q6G A;  1AR1 B;  4CC6 A;  3JAL A;  3RFR A;  1AVM A;  4LFB B;  4PDR A;  2KKW A;  3ASN B;  4PV1 B;  3ZHQ A;  1N36 B;  1N8R W;  2CTR A;  4DR3 B;  3U10 A;  1QR8 A;  4GYC B;  1WJZ A;  5JWP A;  3ZHT A;  4K8Z A;  4O2A A;  2Q7G A;  3SYC A;  5H6Q A;  2FYU H;  2DQ3 A;  1WB7 A;  1WA8 B;  4N21 A;  1AI4 A;  3E8H A;  3D36 A;  5DED A;  4YHH B;  1I5Y A;  2LQT A;  1Q8I A;  2DQ0 A;  3JAM N;  2EIL B;  4LNU A;  5KUM A;  4NXN B;  3FB7 C;  3ZHS A;  5LGN A;  2VWJ A;  4CH6 A;  5KMG A;  2E5L O;  2EIJ C;  4J9Z B;  4DR5 O;  4GX0 A;  1JCH A;  2FL4 A;  1JFF B;  1GH6 A;  1NR7 A;  2P22 C;  1SQP H;  3U0Z A;  1AP6 A;  4LF5 O;  1YSC A;  2YIB D;  5IYB O;  4J10 A;  1SQB H;  5LGU A;  5EBL C;  4QIW F;  4DV5 O;  1Q86 W;  1XRE A;  3A8T A;  1OCR C;  3E86 A;  1VF7 A;  1WPX A;  4ZOL A;  1UFI A;  4U3F H;  1WB8 A;  3IFX A;  3W7T A;  2V4D A;  5KHI A;  4CH5 A;  4H0L B;  2ITC C;  1KQS U;  1CEZ A;  4XDJ A;  1R6N A;  4FJC C;  4P9P A;  4X62 O;  4UCU A;  5DM6 V;  5IDJ A;  3CCM V;  1SQV H;  4WBN B;  3WFV A;  1F4M A;  4RO2 A;  1MG1 A;  1W0J G;  3ABK B;  1WA8 A;  3ICX A;  2O57 A;  3K57 A;  2C2A A;  2IM9 A;  1FD9 A;  5JVD B;  3AG1 B;  1FPO A;  4E2L A;  2QR4 A;  5B66 Z;  3CCE V;  2Y69 C;  1A32 A;  2RN9 A;  3IC7 A;  2LJ2 A;  4KUM A;  5B1B B;  3K3W A;  2IJI A;  1HR0 O;  1L0L H;  1JFF A;  1NS1 A;  3H1K H;  4UCT A;  3VQW A;  2QEX V;  3H1I H;  2YID A;  3JAR A;  4X66 O;  4OPA A;  3QTC A;  1XHZ A;  3WB1 A;  1PM9 A;  1NTZ H;  1K92 A;  4J7Z A;  2R9R B;  1V54 C;  1TAE A;  4DUZ B;  1IBL O;  3RWR D;  2K1E A;  5CN0 A;  1AJQ A;  1OCC C;  3K0D A;  4DR4 O;  4LR3 A;  1E1R G;  4J42 A;  1AIL A;  3JYC A;  3STZ C;  4I5S A;  4UV8 A;  4GT1 A;  4DR1 B;  3DTU B;  2DYR B;  1SC5 B;  1XNQ O;  4AQY B;  3AG2 C;  4I9Q A;  3L74 H;  2LP7 A;  4UCS A;  4JI7 O;  2QWP B;  1NI8 A;  4HBN A;  4UCR A;  3DXR A;  3ZHR A;  5JVD A;  4JI4 O;  4JI2 B;  1XNR O;  1O9G A;  1Q7Y W;  2VQF O;  4O4L B;  4LH7 A;  4IYH A;  4P30 A;  3ABM C;  3THO A;  4KFM A;  3RVZ A;  1GTO A;  1DK1 A;  2CDY A;  1LUW A;  2FB5 A;  3P3P A;  1Q81 W;  3JSL A;  3H1H H;  1EN4 A;  2YXY A;  3D3I A;  3TJT A;  1H8E G;  2EIN B;  1RPR A;  4LF4 B;  1DF5 A;  4DK0 A;  3RT3 C;  1OCO C; 
#chains in the Genus database with same CATH homology
 3IC9 A;  1N0J A;  1AVM A;  1QNM A;  3K9S A;  3AK3 A;  1MMM A;  1KKC A;  3LSU A;  3RN4 A;  1MSD A;  1JR9 A;  1IX9 A;  3QVN A;  1WB7 A;  2RCV A;  1XUQ A;  2ADQ B;  1P7G A;  2CE4 A;  3C3S A;  3AK1 A;  4JZG A;  1N0N A;  1AR4 A;  1EM1 A;  4JYY A;  1ZSP A;  2QKC A;  4FFK A;  2QKA A;  3C3T A;  4YIP A;  1Y67 A;  1LUV A;  1PM9 A;  1GN4 A;  1PL4 A;  4JZ2 A;  1IDS A;  3CEI A;  2GDS A;  2ADP A;  3DC5 A;  1EN5 A;  1ZLZ A;  1GN3 A;  3EVK A;  1I08 A;  1GN6 A;  1SZX A;  3KDR A;  3AK2 A;  1IXB A;  1MNG A;  1ZUQ A;  1AP6 A;  1MA1 A;  1AP5 A;  4E4E A;  3OT7 A;  1I0H A;  1VAR A;  3BFR A;  4F6E A;  1XRE A;  1B06 A;  1XDC A;  1WB8 A;  4GUN A;  1AR5 A;  1XIL A;  3MDS A;  1BS3 A;  4X9Q A;  3KKY A;  1BSM A;  1D5N A;  1ZTE A;  4C7U A;  4BR6 A;  4YIO A;  1BT8 A;  1VEW A;  5AG2 A;  1EN6 A;  2AW9 A;  5A9G A;  2CDY A;  1JA8 A;  1LUW A;  3DC6 A;  1EN4 A;  1GN2 A;  3TJT A;  2P4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...