1PL4A

Crystal structure of human mnsod y166f mutant
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
198
structure length
198
Chain Sequence
b'KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYFLQYKNVRPDYLKAIWNVINWENVTERYMACKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Amino acid substitution at the dimeric interface of human manganese superoxide dismutase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 77
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2003-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1pl4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1pl4A02
2ADQB 1MSDA 1WB7A 1GN3A 1XREA 4YIPA 3CEIA 5A9GA 4JZ2A 3TJTA 2CDYA 1LUWA 1N0JA 1JA8A 2QKAA 1EN4A 4JZGA 2GDSA 1IXBA 4GUNA 3DC5A 2P4KA 2AW9A 1I0HA 3EVKA 1BT8A 1XUQA 3KKYA 1ZUQA 1VEWA 1IDSA 1WB8A 4C7UA 2QKCA 3LSUA 1EN5A 1AVMA 1SZXA 1D5NA 3OT7A 1ZTEA 1EM1A 1VARA 3QVNA 1EN6A 3AK2A 1PL4A 3MDSA 1AP6A 2ADPA 1ZSPA 3IC9A 1MA1A 1GN2A 1BS3A 4FFKA 1MMMA 1XDCA 1PM9A 1BSMA 1B06A 1I08A 3C3TA 3AK1A 1GN6A 3BFRA 1IX9A 1P7GA 3DC6A 1KKCA 1N0NA 3RN4A 1AP5A 1QNMA 4E4EA 4YIOA 3K9SA 4JYYA 1Y67A 1LUVA 1AR4A 1GN4A 1AR5A 3C3SA 4F6EA 4BR6A 4X9QA 1JR9A 1XILA 3AK3A 1MNGA 2CE4A 5AG2A 1ZLZA 2RCVA
chains in the Genus database with same CATH superfamily
2DMXA 2Z0AA 4JYCA 4EEQA 2ZXWC 1AB3A 1KQSU 1GN3A 1U97A 3E8BA 1CXZB 4FZ0A 4UCOA 2R72A 3VOUA 4O4JA 5E79Z 4WFGA 1I0HA 2OTJV 1R3IC 1YVWA 3AG2C 1GM7A 1IDSA 1M56B 1P7BA 1XMOO 1HWYA 2EX3A 4IYIA 4LFCB 3KCXA 1B04A 2CGOA 4LP8A 4IHJB 4R6ZA 2PUSA 2NLJC 2UU9O 3CYOA 1GKFA 3FAVB 3RYCA 3EHBB 4G2KA 5KLVH 3H1LH 3CCSV 2UUBB 3SYCA 1BS3A 1Q86W 4JI1O 3RYIB 5IYBO 1QR8A 1PM9A 1WA8B 1NU1H 4G27B 4H37A 3ZN0A 4FFBB 3SPHA 3CCEV 1SESA 1JNBA 1XQ8A 4MVQA 4NB5A 4QIWF 3OMIB 1KKCA 2Q73A 4WFFA 2GTSA 5KX5A 1K97A 4W4KA 4E4EA 1VQ7V 4YIOA 1QVFU 4FMTA 1FXVA 4DR4B 4DR6O 4ZOLB 1YZBA 1Q6UA 2IJHA 1SQBH 3C3SA 5DECA 4LNUA 1M56C 1JR9A 2OIGA 4O4IB 4GX2A 1QLNA 2HVJC 4JI8B 2ZCEA 1S5HC 3CE2A 2UXBB 3RYFB 5EC1C 4B3TO 1S5LZ 4LR3A 1QQCA 2ZNJA 2XUMA 4FM0A 4N23A 4DR5B 3ZRWB 4X65B 3I5DA 1M90W 3VQYA 3JAKA 3Q4HB 1D5AA 4NXNO 3BA9A 3SJBC 4LF4B 2AW9A 4DV0B 4FLZA 4UCTA 3JCZA 2QWOB 5K1PA 3SPJA 3ICXA 4UB6Z 1HNZB 3ZJZA 1K7DA 1SZXA 1XNRB 1SETA 3VQWA 4X88A 1VQNV 3CCLV 3JCUZ 5BMVA 2ZE8A 3IC7A 3QG5A 1N32O 3S3XA 2WLHA 4TQDA 5J2UA 1XDCA 2WLJA 2Q67A 1BSMA 3HKEB 3BAAA 4ZHQA 2QWRB 2UUCO 2CTPA 1WP8A 3WG7B 3H01A 3CCVV 2KKWA 2CK3G 2NR5A 3APOA 5C8YB 4HNAA 4XBFA 4UCVA 2Q7HA 4MTGA 4GCZA 4K8XA 2RNBA 4X1YA 1DF5A 4PA4A 4KHPB 3LDCA 1MABG 1AR5A 1NR1A 4K0KB 2Y48A 1F7YA 2LP7A 1NQTA 4O2BA 2UXNA 1RSOB 4GKJB 4YJ2B 3CRCA 4I0XB 4X62O 1XILA 2HKOA 3JSNA 4LFBB 1YEWA 3D36C 4ZIBA 4CH4A 2HLDG 4WFEA 2WSSG 3OR6C 4DV3B 2JEUA 1OCZB 3QTCA 3ZMUA 2JGDB 2JS3A 4OGQB 1N36O 1EZVH 3O65A 4CC5A 1FD9A 1XREA 2IBZH 4ABMA 3RWRD 4KUMA 5H5NA 4DV4O 3K0GA 3W7SA 1IBMB 2DW4A 3T1CA 3CX5F 1OV9A 2E74B 1Y66A 3K5LA 2BOCC 1O9HA 5ITZB 3P3PA 2QTSA 3K5MA 3BEHA 4MTXA 4UCRA 3ABUA 4UVAA 3ZHSA 2AGAA 5LXTB 1YJWV 4RAIA 1QHTA 1W0KG 2V1DA 4AQYB 3UT5A 5KAIZ 5LMUO 4F4LA 5B66Z 1K3EA 4H33A 4Q20A 4LF7O 1COWG 1FXKA 1MA1A 2EIKB 3BPZA 1GN2A 4MVMA 1FFXB 3FKSG 4TT3G 4NXMB 1OCZC 3AG1C 3BVOA 4U3JB 1F4NA 3J81N 3C3TA 2IU3A 1R1BA 2WLKA 1IX9A 1AROP 4TV9B 3ZRSA 1M93A 3CXCU 3T1YO 4JTCB 1QBZA 5CMUA 1I7FA 2UXDB 2ITDC 2E5LB 3J7AU 1HDJA 2ZIOA 2WLNA 3FB8C 3SPCA 1IBKB 3JAMN 2H94A 4B7EA 4DW1A 1NH2D 3OEHG 4YHHB 4RQFA 1S77D 2VS0A 1KYOF 4PELA 3HKDB 1IXMA 5AG2A 1ZLZA 5EYPA 2JVDA 3CMAV 4LF5O 1YJNV 5LP6A 3B4SA 2EIKC 2IJIA 3MHSC 4FLXA 1GO3F 5LA6A 3GVMA 1VQPV 1V54B 4HYOA 1BL8A 1LUWA 1ZL8A 1WAZA 1XI1A 2PGGA 2PF4E 2XAHA 4D7SA 4AILC 4TOIA 2M7WA 1XMQO 3LUTB 4JI2B 2BTOA 1VF6A 2QKCA 3JASA 3JALB 4I4TB 1K5QA 3SYPA 2KG7A 2ZDIC 4DO2A 3K08A 1YF2A 3JAWB 3ASOB 3OE7G 1E79G 1KMIZ 3AK2A 2RN9A 5CA0A 5CBGA 4LFAO 4H0LB 3FD9A 1BZKA 4MVUA 4DV7O 2Y0PA 1OCOB 2Q6AA 4GKKB 3OD4A 4I50A 3CPWU 5KUKA 1SA0B 1NTZH 2LO1A 1ROPA 4O4LB 5IE9A 1I94O 4DV5B 1UJWB 1B06A 2FL4A 1J5EO 1JJOA 2XAFA 3BFRA 2P6JA 3KZIZ 4YJ3B 3ZHRA 2CTQA 3L71H 3WB2A 3ZMSA 3RN4A 2N04A 3JARA 4LF6O 1MG1A 1OHHG 1AR4A 1Y76A 4F6RA 1K9MW 3A2FA 5LHGA 3SGIA 4OPAA 3A0HZ 3UKMA 2YXHA 1SQGA 3FB6C 4O2AA 2P5OA 3CJHB 5BXZA 2WLLB 2E75B 5F2VO 1OJHA 3ASOC 4PHZA 2HP8A 4DW0A 2YXLA 4MW3A 3JATA 4NTXA 2PY5A 4ZBMA 5IJ9A 5KHKA 4JI3O 3R65A 4ZI7A 4B3SO 1N33B 4GLXA 1SC5B 3K03A 2DQ0A 4B08A 4MVOA 2HHHO 1P4RA 3X2QC 3OTOB 1EFRG 2RJZA 4WFBV 3IGAC 4L87A 4JI4O 3CRMA 1NI8A 2EINB 4PA3A 3OTFA 1Q7YW 1JA8A 4IL6Z 1Y74A 4U7NA 3E22B 5LOVA 3ETDA 2ZE6A 1AR1B 3T4DA 1VEWA 4GX1A 4JYAB 1H2GA 3B09A 5LGNA 1EN5A 2HJFC 1RPOA 2YDEA 4LBEC 4BIOA 3AG4B 2QKSA 2FYUH 4FZ1A 1GH6A 4N21A 5B3SB 1OCCB 1G4YB 4BWAA 2BOBC 3F5WC 4JV5O 2P90A 5JQGB 3EFFK 3N27A 3RYHB 5CB4B 1AI5A 3N2KA 1H2LA 2GSMB 3ZCCA 3MAQA 3ZHUA 3AG3B 5LMNB 1X4TA 1BQZA 2GUZA 1JFFA 4IIJB 1FJGB 1Q3EA 1KUQA 1GM9A 3LSSA 3QNEA 5JJNB 4UCUA 3I56V 1CEZA 4MW8A 5GTIZ 4JI6B 1YCIA 3A0RA 5CA1A 1H2SB 4FPPA 1V55B 1PNMA 3N2GA 2IU0A 2QWPB 4J11A 2EULA 1AI6A 1MZFA 1K92A 4DR7O 5B3SC 2GTAA 1WLEA 2B1IA 3G71V 1Y6XA 2P4VA 3E2EA 4JASA 2YIAA 4BIUA 4OX9O 1IZ3A 2HJDA 2B1GA 4O4JB 3K59A 4JI7O 4YY3O 3AG3C 3K5NA 3KKYA 1NZ6A 3NR7A 3WB1A 1SS3A 4DXWA 1WJZA 3B8NA 5LYJB 3OT7A 1B3QA 3OGIB 4X64O 3ZBHA 1LNQA 1EBOA 4PJ0Z 2V7QG 2C2AA 1V55C 3JD1A 2PI4A 1MMMA 4JAUA 3G6EV 2YI8A 1NR7A 3T1YB 2QSAA 1PL0A 2HG5C 4O4HA 1Q82W 3AK1A 4B3MB 1Q5OA 4DUZO 2X0LA 5J9PC 1W2BU 2ZD9A 5KA6A 3K06A 2BSKA 4UFZA 1NH2B 1N0NA 4NVPA 5KX5B 1AP5A 3CXHF 2WAMA 4DV2B 2Q5ZA 1KP2A 5LBQA 2R9RB 5CBFA 4TWKA 2W6JG 2D2CB 4PA9A 4UB8Z 1YHQV 4HBNA 3A0BZ 4X1KB 3ABKB 4H44B 3H1IH 3EXAA 4UXNA 3O9OA 1SERA 3TGUH 4JI0B 1NS1A 3CRAA 2ZQMA 1KC8W 1KECA 3UO2A 3B2EE 1TVKB 5EC2C 1HNXO 1XL6A 2DWEC 4J7JA 4LH7A 1TUBB 1R3JC 1THZA 3T1HB 3CSXA 3W7WA 3H1JH 2ZKOA 3BCCH 4IT5A 3CCQV 2MW2B 2PYJA 4DR2O 1XMQB 1M4UA 3L74H 5IT9N 4ASUG 2QM4A 1ORQC 1IBLO 1KBHA 3E86A 1EN4A 3FAVA 2XAQA 3U11A 1K34A 3IJ4A 5KAFZ 1YI2V 4J9ZB 1BT8A 5JVDB 3RYIA 1DK1A 1WA8A 2VRZA 3L75H 4PDMA 3SJCC 4FFBA 3ABTA 2JS5A 1VARA 3ABKC 3LDEA 1JMKC 3K57A 1I94B 5JCOC 1P49A 2QJ1A 4QJFB 5J2TB 1HR0O 5EBMC 1H8EG 1HNWO 5J2UB 3J80N 1P84F 3K04A 3ZMTA 4ZOLA 3H1HH 1N34B 3ZX6A 1I08A 1VP7A 4ZHQB 4MSWC 3JD2A 4DR3O 3OW2U 1Q81W 4O4IA 2ZE7A 4UV9A 5HFMA 5B1OA 2UUAO 4HNAB 2ZM6B 1JCHA 3KG2A 4DR1O 1ZX3A 4FLUA 3RYFA 4PA7A 2QE7G 2WPDG 1OZ0A 2YUAA 1XBLA 4F6EA 1Q90D 3CD6V 4TSFG 3ZRWA 5B1AC 3VBBA 1TGOA 1H2NA 5EZYA 3VQVA 3ABLB 2YIBD 2R9AA 1K4DC 1VMGA 3D36A 1MZEA 3RVYA 3CEIA 4LH6A 2YS8A 2HVKC 3CB2A 3TJTA 3SDLA 1D2DA 1K73W 3BHPA 5B5EZ 4LF8O 1Z5WA 1T5EA 3CC4V 3OAAG 5KMGA 4DV1B 2YSUB 5H6RA 4Q6GA 1MOFA 3AG1B 3SJAC 4B3RO 1K4CC 1XUQA 1YJ9V 1WB8A 4NTWA 5FPOA 2L6LA 2N74A 3HKEA 1UPGA 5JH7B 2X6CA 3HKCA 3CCMV 4NTYA 4JPRA 1AI7A 3UT5B 2Y4TA 2Q4PA 2F4VB 3OMAB 2QR4A 3MDSA 2HFEC 3ASNB 3JYCA 2ZE5A 1DLBA 4JTAB 4LWSB 4DUYB 1VQ5V 3I55V 2XOKG 2VQEB 2WLIB 1U96A 3RT3C 3ZHTA 5IWAB 3HB3B 1XNQO 3GWOA 2D3OW 3ABLC 2CH7B 4EB6A 4YJ2A 1V9PA 4CS2A 4I0XA 2VWKA 4TV8B 3PN1A 1Z2GA 2MK3A 1SF9A 1M9NA 3JD3A 2O57A 1Q6HA 1FS0G 2JRIA 2JGDA 4JAAA 1JJ2U 4QNHB 4GT1A 5GONB 1GRJA 2HEPA 2YEVB 4DR7B 2EZOA 2B9ZA 2PZSA 4JI5B 1GK9A 4RQEA 1K33A 1H8HG 1YXBA 5ITZA 2H8PC 2R70A 2LQTA 2Q9LA 3ASNC 5KHIA 3D8CA 3L73H 1PPJH 2EBOA 2ADQB 3G6BA 3SR2C 4I5SA 5IJ0B 4JI7B 2UXCB 4D6TH 4QPKA 4J7ZA 4JZ2A 4IYHA 1FAFA 2XAJA 5IYZB 4MVZA 1N0JA 4PV1B 2QKAA 4UVBA 2E76B 1E1QG 4LFCO 3DGEA 4XDKA 2BTQB 1FFXA 2E3CA 2BE3A 3B8MA 5GTHZ 4U3JA 1F4MA 1S76D 3JASB 5GW7A 2OCCC 1VQ6V 2G38A 2M6YA 1R73A 2UUBO 2LGWA 5B1NA 3SPGA 1XMOB 3FX7A 2ADPA 4X89A 2GHYA 4DUZB 1US6A 2YIDA 2Q69A 5H2FZ 2PI5A 1DF4A 2Q7GA 4P2ZA 3DTUB 2P7TC 5DM6V 2ATKC 3HKBB 2UU9B 1RM1C 1R3LC 5TISZ 4P30A 2AZ0A 5D5QA 1N4CA 4P9OA 4JI1B 2RQ6A 2IW5A 4I55B 4DR4O 1YIJV 4FLWA 1HP8A 3HKDA 4LF9O 3M8AA 5L3BA 4WFAV 1YITV 3JARB 3CWBH 4QPJA 2Q8VA 2LGQA 3X2QB 5FLXN 4F6RB 4X20B 5EK0A 1E1RG 3UO3A 4JI8O 4AHCA 2Y4UA 1H5WA 4I9QA 3STZC 1VF6C 4X8AA 3ZHQA 4CC6A 4DR6B 2UXBO 4Z1VA 5LGUA 1VQOV 2OWOA 4WBNB 4DR2B 5L3EA 4KL1A 1QR9A 1H2KA 4R50A 4HZ3A 5LGTA 4MTOA 3WB0A 3QO7A 1VF7A 4DR5O 4ZI7B 2ILMA 1VQKV 1Z5VA 3SYOA 3JALA 4I4TA 2ZIMA 4JYBA 4Z1MG 4LF4O 4P9PA 4BW9A 4FLVA 4B3TB 4DV0O 4IGGA 3ML0A 4J9YB 4R7CA 1Y74B 1RPRA 2GDSA 3C90A 1IXBA 1HNZO 1XNRO 3K5OA 3EVKA 1SA0A 4O4LA 1ZUQA 5FNVB 4BAYA 1HR0B 4G28B 1AVMA 1K8AW 4NXNB 1HNWB 3QVNA 4YJ3A 4FK5C 3E35A 4U7OA 4PI0A 1AP6A 4OXSA 3T2MA 4X1IB 3QF7A 3W7UA 2YI9A 3RVZA 1BQ0A 1N32B 3P3NA 4PDLA 4NR1A 4FJCC 3ETEA 3CJHA 1L0NH 2OCHA 2WLLA 4KHPO 4BIZA 3H9VA 4K0KO 2UUCB 5FPRA 4GKJO 4U3FH 4LFBO 2KQXA 3ABMC 3DXRA 2DN9A 1L1FA 3SPIA 2P22C 4DRXA 1IURA 4DV3O 2LW7A 4EFBA 3L72H 3SJQC 1BHAA 3HPLC 2CE4A 4RUEA 2EZPA 1RP3B 3ZRVA 2F23A 2A9HA 4X62B 3CCJV 2YICA 4GX5A 1IBMO 3ZEDA 4EKWA 1NT2B 4B3RB 4JAVA 5D5PA 1CP9A 4I9WA 4J41A 2LJ2A 1GMGA 1N36B 3FB7C 3T4ZA 2XHBA 4JZGA 2F1MA 4GUNA 3BABA 1M5IA 4QE9A 1WPBA 1J95A 4DV4B 1KU9A 3E89A 2OIEA 3MHHC 4AQYO 4CS4A 4GZRB 1R3KC 1BHBA 4CBCA 5DEDA 5JQGA 2YIBA 1VQMV 1JQ0A 3RYHA 5CB4A 1N8RW 1WPXA 2A3QA 3JD4A 3G4SV 3JD0A 1KKDA 1NTMH 4MVSA 5A2QN 4NXMO 2Q7EA 2QA4V 4IIJA 3R66A 3F5TA 5IYCO 3S3WA 2Y0IA 5LMUB 3QO8A 2JGUA 2DYSB 5E1AC 4O4HB 3E8GA 4LF7B 2AXTZ 5EIBC 4DK0A 3QO5A 3AEIA 1SQPH 2UXDO 2E5LO 1IBKO 2Y69C 3RYCB 4TUYA 5KHJA 1Y67A 2VWJA 2ETNA 3BA8A 4YHHO 2ARHA 3HR0A 1L8DA 2FKXA 1JOYA 3OFNG 2ZT9B 4KFMA 4CZZA 1FYJA 2N05A 4X66O 1XHZA 5FL7G 5L3CA 5L3GA 3OR7C 2ZINA 2F95B 2DJVA 1RFYA 1MSDA 2A7WA 3TK1A 4EFEA 2WWWA 5LYJA 2P67A 2IJKA 4LNUB 4LF5B 1G1XB 2DYSC 3H1KH 1S72V 2ODMA 4PD4F 4JI2O 1F23A 5IY5B 1W0JG 1I5YA 1K5SA 3JSLA 1YTFB 1PNLA 5L3FA 2YC0A 3LSUA 3CRRA 2Z5UA 2WA3A 3IAYA 3CCUV 1ZTEA 4GKKO 5L3DA 3PJSK 2PTMA 2WLMA 4IHJA 1R6KA 4RWUA 4L8JA 5H6QA 1GTOA 4AI8A 3JAKB 4DV5O 2RMKB 4K35A 3IC9A 1XOUA 1BMFG 1NKDA 4LFAB 4X1KA 4LF9B 1OCRB 2EIJB 3ZMVA 5JWPA 4CS3A 4DV7B 1VF5B 2W6IG 2X6BA 5JCOA 3P32A 2L35A 1GN6A 5B1AB 4TQFA 2R9IA 5EBLC 2HR3A 1SQFA 1S3JA 4ZKIA 1BGYH 1TVKA 2LFSA 4MS2A 2DWDC 5BMVB 1J5EB 4K3AA 2NNUA 2QM8A 4FLTA 3ETQA 3STLC 1TUBA 1QNMA 1VQLV 5JJEB 4JTDB 2UXXA 3FYIB 3K9SA 1VQ9V 3AG7A 1CPYA 5IY5C 1WP7A 3B40A 3FB5C 1QCEA 4LF6B 3F7VC 4XDLA 4WCEV 2B5UA 4QGPA 4FLYA 4J7KA 2Q0AA 3D3IA 1N33O 3CC7V 4MTFA 5CA3A 5BR8O 2JK5C 4J10A 3OTOO 5JVDA 5EZYB 3A8TA 1Q43A 4X1YB 1WB7A 5KHHA 3WU2Z 5BY1A 4O2BB 4FIPC 1FOUA 1OCRC 2EIJC 3G80A 5JJJB 4JI3B 1DTOA 3K9AA 3E8FA 4B3SB 4E2LA 2OYQA 4JYAO 5J2TA 1ZAUA 3Q4HA 5KMGB 2HHHB 2Q0OC 3LDDA 4JI4B 1NVPB 2AHZA 2QWNB 2F43G 3WFVA 2ZNIA 4B7KA 3HKCB 4LC1A 5CBHA 1ZSPA 1G6UA 4OPHA 5EIBD 3LNMB 3M99B 5H9CA 5KHGA 2KSDA 5LMNO 3E83A 4EB6B 4QE7A 1FJGO 5LL6Y 4JV5B 1PP9H 4J80A 5LHIA 4A5UB 5C8YA 4JI6O 1FXKB 2K9PA 5DN6G 4MVRA 3DSQA 1QLEB 1G8MA 2A79B 2JJ1G 1RSOA 4BW5A 2KB1A 3RGBA 4BR6A 4FM1A 4Z2WA 1JPXA 1M1KW 2XAGA 3OEEG 3OM3B 5EBWC 3APQA 3WG7C 3LNNA 1FXHA 3U10A 3L70H 4W4LA 2X6AA 4DYLA 4DV6O 2OCCB 3TCUA 1GM8A 2VQFO 1JVMA 3L9DA 5JH7A 2GV9A 5C93A 1BE3H 3K58A 4UV8A 2H3OA 1IVSA 3CHXA 3RW0A 3W7TA 1S5JA 1XHXA 4LWSA 2P4KA 1R6TA 2WLIA 5EYPB 1KB9F 4OX9B 3TETA 4JGSA 1RM1B 2DQ3A 5KA5A 4C7UA 5LP6B 1FXKC 2CH7A 4YY3B 1D5NA 3CRQA 2AZ2A 5LXTA 1QLEC 1EM1A 1YSCA 4TV8A 1EN6A 5LA6B 2DE0X 2IH3C 4FVMA 1SRYA 1ZL8B 2Z3YA 4J42A 3RFRA 2A06H 3GWKC 3FFQA 3G67A 3RBZA 4B3MO 1FPOA 3OUSA 3CC2V 4FFKA 4X64B 1BCCH 2FB5A 5LHHA 5GONA 4JF3A 3K0DA 2YEVA 4UVCA 1AILA 4NYKA 1Y4MA 3LSQA 4DV2O 1M57B 2KG7B 3ZRXA 4K8ZA 1AI4A 1O9GA 4TV9A 3DC6A 3TXQA 3ZMZA 2AHYA 5CA0B 3KCYA 3GB7C 4I50B 1SKVA 1YTFD 4JYYA 4X66B 1LUVA 4RUFA 2FTKA 4JI0O 1TA8A 2ZDIA 1YDXA 5IJ0A 1KD1W 1WNSA 4YXWG 5K1XA 3T1HO 5LP6C 1SQXH 1XEQA 5IYZA 3D3QA 2QEXV 2EJ7A 2GBOA 5CN0A 3TXSA 2OTLV 2BTQA 3UCSC 1AJPA 2RCVA 1I5XA 1HNXB 1Y76B 2XT9A 4YIPA 1H2MA 5A9GA 1XL4A 4O2AB 1R6NA 3UQ8A 1M57C 2XNDG 1NBMG 4GYCB 5IYDO 1WN7A 2QGNA 3CP1A 3JATB 1IBLB 5IJ9B 2IJJA 3HKBA 4X65O 3JAWA 4I55A 4NKGB 1PKXA 1PL4A 1AJNA 2X7RB 1N34O 2JIZG 1V54C 1TUEB 2ITCC 4UUJC 3K3WA 5LOVB 3ABMB 2CUGA 2QM7A 5KUMA 3B77A 1PD3A 4PI2A 4WF9V 2ZR2A 1NTKH 4X20A 2CTWA 4KP4A 4PDVA 1ENVA 2ZM6O 3E8HA 1JX9A 4CH5A 3CMEV 4WBNA 3CS5A 2RDCA 3SYAA 4DR3B 1FKAO 2Q68A 1NVPD 2WA4A 1OCOC 2DOSA 2JDIG 3DXRB 2EILB 2UUAB 3KDRA 5BR8B 4DR1B 3THOA 1LR1A 1B6QA 4DRXB 1MSWD 2JEXA 4X9QA 3N2KB 1IJGA 1HW7A 1SQVH 3ZIAG 4LCUC 1AJQA 4I7ZB 2DYRB 4D7TA 1MNGA 2GUZB 1JFFB 1FFTB 3IFXA 2EJRA 1VQ4V 1PV0A 5FNVA 2CGNA 5B1BB 2CAZC 3OMNB 4H13B 3NXSA 2OT5A 1L0LH 4DV1O 1QU7A 2XASA 1H38A 4R8CA 5BZBA 3BRCA 5CA1B 1ZWIC 1DGSA 2CDYA 4PA6A 4X1IA 1TAEA 3N2GB 4MT8A 3E22A 2F93B 3DC5A 2QTOA 4HAMA 3BY6A 2F4VO 2QWQB 5IDJA 4LF8B 1Q8IA 2EIMB 4DUYO 3FYEB 4CH6A 2QDOA 1SQQH 3P30A 1QVGU 2VQEO 1VIBA 4ICGA 4FM2A 2EILC 5HFLA 1UFIA 1URFA 2Y69B 2LFRA 4GX0A 5IWAO 2XTAA 3ZN1A 1F51A 1W59A 2IM9A 2EINC 1PNKA 1Q6IA 2ZXWB 2ZR3A 2DYRC 4WFHA 2K1EA 3M7MX 1A32A 3MD0A 3ETGA 2NN4A 1NJIW 3K79A 2V4DA 4CH3A 4PDRA 5B1BC 1KP3A 2A0LA 2PYLA 1S0VA 2F66C 1P7GA 2FMLA 1XNQB 2YXYA 3AG4C 3AG2B 4TUYB 2P06A 1SZTA 1OCCC 3VQXA 4JI5O 2CTRA 1GN4A 3U0ZA 3ZHVA 2JJ2G 1EZJA 2W0FC 2LW1A 3CCRV 4DV6B 4DK1A 4XDJA 2EIMC 3UM7A 2VQFB 3OUFA 3OGCC 1X59A 3AK3A 2BCCH 2W0XA 2BSKB 3F7YC 4UCSA 2UXCO 3W7XA 1VQ8V 1GAXA 3SYQA 2IH1C 3ZS8C 4KXRA 4RO2A
chains in the Genus database with same CATH topology
2ADQB 1MSDA 1WB7A 1GN3A 1XREA 4YIPA 3CEIA 5A9GA 4JZ2A 3TJTA 2CDYA 1LUWA 1N0JA 1JA8A 2QKAA 1EN4A 4JZGA 2GDSA 1IXBA 4GUNA 3DC5A 2P4KA 2AW9A 1I0HA 3EVKA 1BT8A 1XUQA 3KKYA 1ZUQA 1VEWA 1IDSA 1WB8A 4C7UA 2QKCA 3LSUA 1EN5A 1AVMA 1SZXA 1D5NA 3OT7A 1ZTEA 1EM1A 1VARA 3QVNA 1EN6A 3AK2A 1PL4A 3MDSA 1AP6A 2ADPA 1ZSPA 3IC9A 1MA1A 1GN2A 1BS3A 4FFKA 1MMMA 1XDCA 1PM9A 1BSMA 1B06A 1I08A 3C3TA 3AK1A 1GN6A 3BFRA 1IX9A 1P7GA 3DC6A 1KKCA 1N0NA 3RN4A 1AP5A 1QNMA 4E4EA 4YIOA 3K9SA 4JYYA 1Y67A 1LUVA 1AR4A 1GN4A 1AR5A 3KDRA 3C3SA 4F6EA 4BR6A 4X9QA 1JR9A 1XILA 3AK3A 1MNGA 2CE4A 5AG2A 1ZLZA 2RCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADQ B;  1MSD A;  1WB7 A;  1GN3 A;  1XRE A;  4YIP A;  3CEI A;  5A9G A;  4JZ2 A;  3TJT A;  2CDY A;  1LUW A;  1N0J A;  1JA8 A;  2QKA A;  1EN4 A;  4JZG A;  2GDS A;  1IXB A;  4GUN A;  3DC5 A;  2P4K A;  2AW9 A;  1I0H A;  3EVK A;  1BT8 A;  1XUQ A;  3KKY A;  1ZUQ A;  1VEW A;  1IDS A;  1WB8 A;  4C7U A;  2QKC A;  3LSU A;  1EN5 A;  1AVM A;  1SZX A;  1D5N A;  3OT7 A;  1ZTE A;  1EM1 A;  1VAR A;  3QVN A;  1EN6 A;  3AK2 A;  1PL4 A;  3MDS A;  1AP6 A;  2ADP A;  1ZSP A;  3IC9 A;  1MA1 A;  1GN2 A;  1BS3 A;  4FFK A;  1MMM A;  1XDC A;  1PM9 A;  1BSM A;  1B06 A;  1I08 A;  3C3T A;  3AK1 A;  1GN6 A;  3BFR A;  1IX9 A;  1P7G A;  3DC6 A;  1KKC A;  1N0N A;  3RN4 A;  1AP5 A;  1QNM A;  4E4E A;  4YIO A;  3K9S A;  4JYY A;  1Y67 A;  1LUV A;  1AR4 A;  1GN4 A;  1AR5 A;  3C3S A;  4F6E A;  4BR6 A;  4X9Q A;  1JR9 A;  1XIL A;  3AK3 A;  1MNG A;  2CE4 A;  5AG2 A;  1ZLZ A;  2RCV A; 
#chains in the Genus database with same CATH topology
 2DMX A;  2Z0A A;  4JYC A;  4EEQ A;  2ZXW C;  1AB3 A;  1KQS U;  1GN3 A;  1U97 A;  3E8B A;  1CXZ B;  4FZ0 A;  4UCO A;  2R72 A;  3VOU A;  4O4J A;  5E79 Z;  4WFG A;  1I0H A;  2OTJ V;  1R3I C;  1YVW A;  3AG2 C;  1GM7 A;  1IDS A;  1M56 B;  1P7B A;  1XMO O;  1HWY A;  2EX3 A;  4IYI A;  4LFC B;  3KCX A;  1B04 A;  2CGO A;  4LP8 A;  4IHJ B;  4R6Z A;  2PUS A;  2NLJ C;  2UU9 O;  3CYO A;  1GKF A;  3FAV B;  3RYC A;  3EHB B;  4G2K A;  5KLV H;  3H1L H;  3CCS V;  2UUB B;  3SYC A;  1BS3 A;  1Q86 W;  4JI1 O;  3RYI B;  5IYB O;  1QR8 A;  1PM9 A;  1WA8 B;  1NU1 H;  4G27 B;  4H37 A;  3ZN0 A;  4FFB B;  3SPH A;  3CCE V;  1SES A;  1JNB A;  1XQ8 A;  4MVQ A;  4NB5 A;  4QIW F;  3OMI B;  1KKC A;  2Q73 A;  4WFF A;  2GTS A;  5KX5 A;  1K97 A;  4W4K A;  4E4E A;  1VQ7 V;  4YIO A;  1QVF U;  4FMT A;  1FXV A;  4DR4 B;  4DR6 O;  4ZOL B;  1YZB A;  1Q6U A;  2IJH A;  1SQB H;  3C3S A;  5DEC A;  4LNU A;  1M56 C;  1JR9 A;  2OIG A;  4O4I B;  4GX2 A;  1QLN A;  2HVJ C;  4JI8 B;  2ZCE A;  1S5H C;  3CE2 A;  2UXB B;  3RYF B;  5EC1 C;  4B3T O;  1S5L Z;  4LR3 A;  1QQC A;  2ZNJ A;  2XUM A;  4FM0 A;  4N23 A;  4DR5 B;  3ZRW B;  4X65 B;  3I5D A;  1M90 W;  3VQY A;  3JAK A;  3Q4H B;  1D5A A;  4NXN O;  3BA9 A;  3SJB C;  4LF4 B;  2AW9 A;  4DV0 B;  4FLZ A;  4UCT A;  3JCZ A;  2QWO B;  5K1P A;  3SPJ A;  3ICX A;  4UB6 Z;  1HNZ B;  3ZJZ A;  1K7D A;  1SZX A;  1XNR B;  1SET A;  3VQW A;  4X88 A;  1VQN V;  3CCL V;  3JCU Z;  5BMV A;  2ZE8 A;  3IC7 A;  3QG5 A;  1N32 O;  3S3X A;  2WLH A;  4TQD A;  5J2U A;  1XDC A;  2WLJ A;  2Q67 A;  1BSM A;  3HKE B;  3BAA A;  4ZHQ A;  2QWR B;  2UUC O;  2CTP A;  1WP8 A;  3WG7 B;  3H01 A;  3CCV V;  2KKW A;  2CK3 G;  2NR5 A;  3APO A;  5C8Y B;  4HNA A;  4XBF A;  4UCV A;  2Q7H A;  4MTG A;  4GCZ A;  4K8X A;  2RNB A;  4X1Y A;  1DF5 A;  4PA4 A;  4KHP B;  3LDC A;  1MAB G;  1AR5 A;  1NR1 A;  4K0K B;  2Y48 A;  1F7Y A;  2LP7 A;  1NQT A;  4O2B A;  2UXN A;  1RSO B;  4GKJ B;  4YJ2 B;  3CRC A;  4I0X B;  4X62 O;  1XIL A;  2HKO A;  3JSN A;  4LFB B;  1YEW A;  3D36 C;  4ZIB A;  4CH4 A;  2HLD G;  4WFE A;  2WSS G;  3OR6 C;  4DV3 B;  2JEU A;  1OCZ B;  3QTC A;  3ZMU A;  2JGD B;  2JS3 A;  4OGQ B;  1N36 O;  1EZV H;  3O65 A;  4CC5 A;  1FD9 A;  1XRE A;  2IBZ H;  4ABM A;  3RWR D;  4KUM A;  5H5N A;  4DV4 O;  3K0G A;  3W7S A;  1IBM B;  2DW4 A;  3T1C A;  3CX5 F;  1OV9 A;  2E74 B;  1Y66 A;  3K5L A;  2BOC C;  1O9H A;  5ITZ B;  3P3P A;  2QTS A;  3K5M A;  3BEH A;  4MTX A;  4UCR A;  3ABU A;  4UVA A;  3ZHS A;  2AGA A;  5LXT B;  1YJW V;  4RAI A;  1QHT A;  1W0K G;  2V1D A;  4AQY B;  3UT5 A;  5KAI Z;  5LMU O;  4F4L A;  5B66 Z;  1K3E A;  4H33 A;  4Q20 A;  4LF7 O;  1COW G;  1FXK A;  1MA1 A;  2EIK B;  3BPZ A;  1GN2 A;  4MVM A;  1FFX B;  3FKS G;  4TT3 G;  4NXM B;  1OCZ C;  3AG1 C;  3BVO A;  4U3J B;  1F4N A;  3J81 N;  3C3T A;  2IU3 A;  1R1B A;  2WLK A;  1IX9 A;  1ARO P;  4TV9 B;  3ZRS A;  1M93 A;  3CXC U;  3T1Y O;  4JTC B;  1QBZ A;  5CMU A;  1I7F A;  2UXD B;  2ITD C;  2E5L B;  3J7A U;  1HDJ A;  2ZIO A;  2WLN A;  3FB8 C;  3SPC A;  1IBK B;  3JAM N;  2H94 A;  4B7E A;  4DW1 A;  1NH2 D;  3OEH G;  4YHH B;  4RQF A;  1S77 D;  2VS0 A;  1KYO F;  4PEL A;  3HKD B;  1IXM A;  5AG2 A;  1ZLZ A;  5EYP A;  2JVD A;  3CMA V;  4LF5 O;  1YJN V;  5LP6 A;  3B4S A;  2EIK C;  2IJI A;  3MHS C;  4FLX A;  1GO3 F;  5LA6 A;  3GVM A;  1VQP V;  1V54 B;  4HYO A;  1BL8 A;  1LUW A;  1ZL8 A;  1WAZ A;  1XI1 A;  2PGG A;  2PF4 E;  2XAH A;  4D7S A;  4AIL C;  4TOI A;  2M7W A;  1XMQ O;  3LUT B;  4JI2 B;  2BTO A;  1VF6 A;  2QKC A;  3JAS A;  3JAL B;  4I4T B;  1K5Q A;  3SYP A;  2KG7 A;  2ZDI C;  4DO2 A;  3K08 A;  1YF2 A;  3JAW B;  3ASO B;  3OE7 G;  1E79 G;  1KMI Z;  3AK2 A;  2RN9 A;  5CA0 A;  5CBG A;  4LFA O;  4H0L B;  3FD9 A;  1BZK A;  4MVU A;  4DV7 O;  2Y0P A;  1OCO B;  2Q6A A;  4GKK B;  3OD4 A;  4I50 A;  3CPW U;  5KUK A;  1SA0 B;  1NTZ H;  2LO1 A;  1ROP A;  4O4L B;  5IE9 A;  1I94 O;  4DV5 B;  1UJW B;  1B06 A;  2FL4 A;  1J5E O;  1JJO A;  2XAF A;  3BFR A;  2P6J A;  3KZI Z;  4YJ3 B;  3ZHR A;  2CTQ A;  3L71 H;  3WB2 A;  3ZMS A;  3RN4 A;  2N04 A;  3JAR A;  4LF6 O;  1MG1 A;  1OHH G;  1AR4 A;  1Y76 A;  4F6R A;  1K9M W;  3A2F A;  5LHG A;  3SGI A;  4OPA A;  3A0H Z;  3UKM A;  2YXH A;  1SQG A;  3FB6 C;  4O2A A;  2P5O A;  3CJH B;  5BXZ A;  2WLL B;  2E75 B;  5F2V O;  1OJH A;  3ASO C;  4PHZ A;  2HP8 A;  4DW0 A;  2YXL A;  4MW3 A;  3JAT A;  4NTX A;  2PY5 A;  4ZBM A;  5IJ9 A;  5KHK A;  4JI3 O;  3R65 A;  4ZI7 A;  4B3S O;  1N33 B;  4GLX A;  1SC5 B;  3K03 A;  2DQ0 A;  4B08 A;  4MVO A;  2HHH O;  1P4R A;  3X2Q C;  3OTO B;  1EFR G;  2RJZ A;  4WFB V;  3IGA C;  4L87 A;  4JI4 O;  3CRM A;  1NI8 A;  2EIN B;  4PA3 A;  3OTF A;  1Q7Y W;  1JA8 A;  4IL6 Z;  1Y74 A;  4U7N A;  3E22 B;  5LOV A;  3ETD A;  2ZE6 A;  1AR1 B;  3T4D A;  1VEW A;  4GX1 A;  4JYA B;  1H2G A;  3B09 A;  5LGN A;  1EN5 A;  2HJF C;  1RPO A;  2YDE A;  4LBE C;  4BIO A;  3AG4 B;  2QKS A;  2FYU H;  4FZ1 A;  1GH6 A;  4N21 A;  5B3S B;  1OCC B;  1G4Y B;  4BWA A;  2BOB C;  3F5W C;  4JV5 O;  2P90 A;  5JQG B;  3EFF K;  3N27 A;  3RYH B;  5CB4 B;  1AI5 A;  3N2K A;  1H2L A;  2GSM B;  3ZCC A;  3MAQ A;  3ZHU A;  3AG3 B;  5LMN B;  1X4T A;  1BQZ A;  2GUZ A;  1JFF A;  4IIJ B;  1FJG B;  1Q3E A;  1KUQ A;  1GM9 A;  3LSS A;  3QNE A;  5JJN B;  4UCU A;  3I56 V;  1CEZ A;  4MW8 A;  5GTI Z;  4JI6 B;  1YCI A;  3A0R A;  5CA1 A;  1H2S B;  4FPP A;  1V55 B;  1PNM A;  3N2G A;  2IU0 A;  2QWP B;  4J11 A;  2EUL A;  1AI6 A;  1MZF A;  1K92 A;  4DR7 O;  5B3S C;  2GTA A;  1WLE A;  2B1I A;  3G71 V;  1Y6X A;  2P4V A;  3E2E A;  4JAS A;  2YIA A;  4BIU A;  4OX9 O;  1IZ3 A;  2HJD A;  2B1G A;  4O4J B;  3K59 A;  4JI7 O;  4YY3 O;  3AG3 C;  3K5N A;  3KKY A;  1NZ6 A;  3NR7 A;  3WB1 A;  1SS3 A;  4DXW A;  1WJZ A;  3B8N A;  5LYJ B;  3OT7 A;  1B3Q A;  3OGI B;  4X64 O;  3ZBH A;  1LNQ A;  1EBO A;  4PJ0 Z;  2V7Q G;  2C2A A;  1V55 C;  3JD1 A;  2PI4 A;  1MMM A;  4JAU A;  3G6E V;  2YI8 A;  1NR7 A;  3T1Y B;  2QSA A;  1PL0 A;  2HG5 C;  4O4H A;  1Q82 W;  3AK1 A;  4B3M B;  1Q5O A;  4DUZ O;  2X0L A;  5J9P C;  1W2B U;  2ZD9 A;  5KA6 A;  3K06 A;  2BSK A;  4UFZ A;  1NH2 B;  1N0N A;  4NVP A;  5KX5 B;  1AP5 A;  3CXH F;  2WAM A;  4DV2 B;  2Q5Z A;  1KP2 A;  5LBQ A;  2R9R B;  5CBF A;  4TWK A;  2W6J G;  2D2C B;  4PA9 A;  4UB8 Z;  1YHQ V;  4HBN A;  3A0B Z;  4X1K B;  3ABK B;  4H44 B;  3H1I H;  3EXA A;  4UXN A;  3O9O A;  1SER A;  3TGU H;  4JI0 B;  1NS1 A;  3CRA A;  2ZQM A;  1KC8 W;  1KEC A;  3UO2 A;  3B2E E;  1TVK B;  5EC2 C;  1HNX O;  1XL6 A;  2DWE C;  4J7J A;  4LH7 A;  1TUB B;  1R3J C;  1THZ A;  3T1H B;  3CSX A;  3W7W A;  3H1J H;  2ZKO A;  3BCC H;  4IT5 A;  3CCQ V;  2MW2 B;  2PYJ A;  4DR2 O;  1XMQ B;  1M4U A;  3L74 H;  5IT9 N;  4ASU G;  2QM4 A;  1ORQ C;  1IBL O;  1KBH A;  3E86 A;  1EN4 A;  3FAV A;  2XAQ A;  3U11 A;  1K34 A;  3IJ4 A;  5KAF Z;  1YI2 V;  4J9Z B;  1BT8 A;  5JVD B;  3RYI A;  1DK1 A;  1WA8 A;  2VRZ A;  3L75 H;  4PDM A;  3SJC C;  4FFB A;  3ABT A;  2JS5 A;  1VAR A;  3ABK C;  3LDE A;  1JMK C;  3K57 A;  1I94 B;  5JCO C;  1P49 A;  2QJ1 A;  4QJF B;  5J2T B;  1HR0 O;  5EBM C;  1H8E G;  1HNW O;  5J2U B;  3J80 N;  1P84 F;  3K04 A;  3ZMT A;  4ZOL A;  3H1H H;  1N34 B;  3ZX6 A;  1I08 A;  1VP7 A;  4ZHQ B;  4MSW C;  3JD2 A;  4DR3 O;  3OW2 U;  1Q81 W;  4O4I A;  2ZE7 A;  4UV9 A;  5HFM A;  5B1O A;  2UUA O;  4HNA B;  2ZM6 B;  1JCH A;  3KG2 A;  4DR1 O;  1ZX3 A;  4FLU A;  3RYF A;  4PA7 A;  2QE7 G;  2WPD G;  1OZ0 A;  2YUA A;  1XBL A;  4F6E A;  1Q90 D;  3CD6 V;  4TSF G;  3ZRW A;  5B1A C;  3VBB A;  1TGO A;  1H2N A;  5EZY A;  3VQV A;  3ABL B;  2YIB D;  2R9A A;  1K4D C;  1VMG A;  3D36 A;  1MZE A;  3RVY A;  3CEI A;  4LH6 A;  2YS8 A;  2HVK C;  3CB2 A;  3TJT A;  3SDL A;  1D2D A;  1K73 W;  3BHP A;  5B5E Z;  4LF8 O;  1Z5W A;  1T5E A;  3CC4 V;  3OAA G;  5KMG A;  4DV1 B;  2YSU B;  5H6R A;  4Q6G A;  1MOF A;  3AG1 B;  3SJA C;  4B3R O;  1K4C C;  1XUQ A;  1YJ9 V;  1WB8 A;  4NTW A;  5FPO A;  2L6L A;  2N74 A;  3HKE A;  1UPG A;  5JH7 B;  2X6C A;  3HKC A;  3CCM V;  4NTY A;  4JPR A;  1AI7 A;  3UT5 B;  2Y4T A;  2Q4P A;  2F4V B;  3OMA B;  2QR4 A;  3MDS A;  2HFE C;  3ASN B;  3JYC A;  2ZE5 A;  1DLB A;  4JTA B;  4LWS B;  4DUY B;  1VQ5 V;  3I55 V;  2XOK G;  2VQE B;  2WLI B;  1U96 A;  3RT3 C;  3ZHT A;  5IWA B;  3HB3 B;  1XNQ O;  3GWO A;  2D3O W;  3ABL C;  2CH7 B;  4EB6 A;  4YJ2 A;  1V9P A;  4CS2 A;  4I0X A;  2VWK A;  4TV8 B;  3PN1 A;  1Z2G A;  2MK3 A;  1SF9 A;  1M9N A;  3JD3 A;  2O57 A;  1Q6H A;  1FS0 G;  2JRI A;  2JGD A;  4JAA A;  1JJ2 U;  4QNH B;  4GT1 A;  5GON B;  1GRJ A;  2HEP A;  2YEV B;  4DR7 B;  2EZO A;  2B9Z A;  2PZS A;  4JI5 B;  1GK9 A;  4RQE A;  1K33 A;  1H8H G;  1YXB A;  5ITZ A;  2H8P C;  2R70 A;  2LQT A;  2Q9L A;  3ASN C;  5KHI A;  3D8C A;  3L73 H;  1PPJ H;  2EBO A;  2ADQ B;  3G6B A;  3SR2 C;  4I5S A;  5IJ0 B;  4JI7 B;  2UXC B;  4D6T H;  4QPK A;  4J7Z A;  4JZ2 A;  4IYH A;  1FAF A;  2XAJ A;  5IYZ B;  4MVZ A;  1N0J A;  4PV1 B;  2QKA A;  4UVB A;  2E76 B;  1E1Q G;  4LFC O;  3DGE A;  4XDK A;  2BTQ B;  1FFX A;  2E3C A;  2BE3 A;  3B8M A;  5GTH Z;  4U3J A;  1F4M A;  1S76 D;  3JAS B;  5GW7 A;  2OCC C;  1VQ6 V;  2G38 A;  2M6Y A;  1R73 A;  2UUB O;  2LGW A;  5B1N A;  3SPG A;  1XMO B;  3FX7 A;  2ADP A;  4X89 A;  2GHY A;  4DUZ B;  1US6 A;  2YID A;  2Q69 A;  5H2F Z;  2PI5 A;  1DF4 A;  2Q7G A;  4P2Z A;  3DTU B;  2P7T C;  5DM6 V;  2ATK C;  3HKB B;  2UU9 B;  1RM1 C;  1R3L C;  5TIS Z;  4P30 A;  2AZ0 A;  5D5Q A;  1N4C A;  4P9O A;  4JI1 B;  2RQ6 A;  2IW5 A;  4I55 B;  4DR4 O;  1YIJ V;  4FLW A;  1HP8 A;  3HKD A;  4LF9 O;  3M8A A;  5L3B A;  4WFA V;  1YIT V;  3JAR B;  3CWB H;  4QPJ A;  2Q8V A;  2LGQ A;  3X2Q B;  5FLX N;  4F6R B;  4X20 B;  5EK0 A;  1E1R G;  3UO3 A;  4JI8 O;  4AHC A;  2Y4U A;  1H5W A;  4I9Q A;  3STZ C;  1VF6 C;  4X8A A;  3ZHQ A;  4CC6 A;  4DR6 B;  2UXB O;  4Z1V A;  5LGU A;  1VQO V;  2OWO A;  4WBN B;  4DR2 B;  5L3E A;  4KL1 A;  1QR9 A;  1H2K A;  4R50 A;  4HZ3 A;  5LGT A;  4MTO A;  3WB0 A;  3QO7 A;  1VF7 A;  4DR5 O;  4ZI7 B;  2ILM A;  1VQK V;  1Z5V A;  3SYO A;  3JAL A;  4I4T A;  2ZIM A;  4JYB A;  4Z1M G;  4LF4 O;  4P9P A;  4BW9 A;  4FLV A;  4B3T B;  4DV0 O;  4IGG A;  3ML0 A;  4J9Y B;  4R7C A;  1Y74 B;  1RPR A;  2GDS A;  3C90 A;  1IXB A;  1HNZ O;  1XNR O;  3K5O A;  3EVK A;  1SA0 A;  4O4L A;  1ZUQ A;  5FNV B;  4BAY A;  1HR0 B;  4G28 B;  1AVM A;  1K8A W;  4NXN B;  1HNW B;  3QVN A;  4YJ3 A;  4FK5 C;  3E35 A;  4U7O A;  4PI0 A;  1AP6 A;  4OXS A;  3T2M A;  4X1I B;  3QF7 A;  3W7U A;  2YI9 A;  3RVZ A;  1BQ0 A;  1N32 B;  3P3N A;  4PDL A;  4NR1 A;  4FJC C;  3ETE A;  3CJH A;  1L0N H;  2OCH A;  2WLL A;  4KHP O;  4BIZ A;  3H9V A;  4K0K O;  2UUC B;  5FPR A;  4GKJ O;  4U3F H;  4LFB O;  2KQX A;  3ABM C;  3DXR A;  2DN9 A;  1L1F A;  3SPI A;  2P22 C;  4DRX A;  1IUR A;  4DV3 O;  2LW7 A;  4EFB A;  3L72 H;  3SJQ C;  1BHA A;  3HPL C;  2CE4 A;  4RUE A;  2EZP A;  1RP3 B;  3ZRV A;  2F23 A;  2A9H A;  4X62 B;  3CCJ V;  2YIC A;  4GX5 A;  1IBM O;  3ZED A;  4EKW A;  1NT2 B;  4B3R B;  4JAV A;  5D5P A;  1CP9 A;  4I9W A;  4J41 A;  2LJ2 A;  1GMG A;  1N36 B;  3FB7 C;  3T4Z A;  2XHB A;  4JZG A;  2F1M A;  4GUN A;  3BAB A;  1M5I A;  4QE9 A;  1WPB A;  1J95 A;  4DV4 B;  1KU9 A;  3E89 A;  2OIE A;  3MHH C;  4AQY O;  4CS4 A;  4GZR B;  1R3K C;  1BHB A;  4CBC A;  5DED A;  5JQG A;  2YIB A;  1VQM V;  1JQ0 A;  3RYH A;  5CB4 A;  1N8R W;  1WPX A;  2A3Q A;  3JD4 A;  3G4S V;  3JD0 A;  1KKD A;  1NTM H;  4MVS A;  5A2Q N;  4NXM O;  2Q7E A;  2QA4 V;  4IIJ A;  3R66 A;  3F5T A;  5IYC O;  3S3W A;  2Y0I A;  5LMU B;  3QO8 A;  2JGU A;  2DYS B;  5E1A C;  4O4H B;  3E8G A;  4LF7 B;  2AXT Z;  5EIB C;  4DK0 A;  3QO5 A;  3AEI A;  1SQP H;  2UXD O;  2E5L O;  1IBK O;  2Y69 C;  3RYC B;  4TUY A;  5KHJ A;  1Y67 A;  2VWJ A;  2ETN A;  3BA8 A;  4YHH O;  2ARH A;  3HR0 A;  1L8D A;  2FKX A;  1JOY A;  3OFN G;  2ZT9 B;  4KFM A;  4CZZ A;  1FYJ A;  2N05 A;  4X66 O;  1XHZ A;  5FL7 G;  5L3C A;  5L3G A;  3OR7 C;  2ZIN A;  2F95 B;  2DJV A;  1RFY A;  1MSD A;  2A7W A;  3TK1 A;  4EFE A;  2WWW A;  5LYJ A;  2P67 A;  2IJK A;  4LNU B;  4LF5 B;  1G1X B;  2DYS C;  3H1K H;  1S72 V;  2ODM A;  4PD4 F;  4JI2 O;  1F23 A;  5IY5 B;  1W0J G;  1I5Y A;  1K5S A;  3JSL A;  1YTF B;  1PNL A;  5L3F A;  2YC0 A;  3LSU A;  3CRR A;  2Z5U A;  2WA3 A;  3IAY A;  3CCU V;  1ZTE A;  4GKK O;  5L3D A;  3PJS K;  2PTM A;  2WLM A;  4IHJ A;  1R6K A;  4RWU A;  4L8J A;  5H6Q A;  1GTO A;  4AI8 A;  3JAK B;  4DV5 O;  2RMK B;  4K35 A;  3IC9 A;  1XOU A;  1BMF G;  1NKD A;  4LFA B;  4X1K A;  4LF9 B;  1OCR B;  2EIJ B;  3ZMV A;  5JWP A;  4CS3 A;  4DV7 B;  1VF5 B;  2W6I G;  2X6B A;  5JCO A;  3P32 A;  2L35 A;  1GN6 A;  5B1A B;  4TQF A;  2R9I A;  5EBL C;  2HR3 A;  1SQF A;  1S3J A;  4ZKI A;  1BGY H;  1TVK A;  2LFS A;  4MS2 A;  2DWD C;  5BMV B;  1J5E B;  4K3A A;  2NNU A;  2QM8 A;  4FLT A;  3ETQ A;  3STL C;  1TUB A;  1QNM A;  1VQL V;  5JJE B;  4JTD B;  2UXX A;  3FYI B;  3K9S A;  1VQ9 V;  3AG7 A;  1CPY A;  5IY5 C;  1WP7 A;  3B40 A;  3FB5 C;  1QCE A;  4LF6 B;  3F7V C;  4XDL A;  4WCE V;  2B5U A;  4QGP A;  4FLY A;  4J7K A;  2Q0A A;  3D3I A;  1N33 O;  3CC7 V;  4MTF A;  5CA3 A;  5BR8 O;  2JK5 C;  4J10 A;  3OTO O;  5JVD A;  5EZY B;  3A8T A;  1Q43 A;  4X1Y B;  1WB7 A;  5KHH A;  3WU2 Z;  5BY1 A;  4O2B B;  4FIP C;  1FOU A;  1OCR C;  2EIJ C;  3G80 A;  5JJJ B;  4JI3 B;  1DTO A;  3K9A A;  3E8F A;  4B3S B;  4E2L A;  2OYQ A;  4JYA O;  5J2T A;  1ZAU A;  3Q4H A;  5KMG B;  2HHH B;  2Q0O C;  3LDD A;  4JI4 B;  1NVP B;  2AHZ A;  2QWN B;  2F43 G;  3WFV A;  2ZNI A;  4B7K A;  3HKC B;  4LC1 A;  5CBH A;  1ZSP A;  1G6U A;  4OPH A;  5EIB D;  3LNM B;  3M99 B;  5H9C A;  5KHG A;  2KSD A;  5LMN O;  3E83 A;  4EB6 B;  4QE7 A;  1FJG O;  5LL6 Y;  4JV5 B;  1PP9 H;  4J80 A;  5LHI A;  4A5U B;  5C8Y A;  4JI6 O;  1FXK B;  2K9P A;  5DN6 G;  4MVR A;  3DSQ A;  1QLE B;  1G8M A;  2A79 B;  2JJ1 G;  1RSO A;  4BW5 A;  2KB1 A;  3RGB A;  4BR6 A;  4FM1 A;  4Z2W A;  1JPX A;  1M1K W;  2XAG A;  3OEE G;  3OM3 B;  5EBW C;  3APQ A;  3WG7 C;  3LNN A;  1FXH A;  3U10 A;  3L70 H;  4W4L A;  2X6A A;  4DYL A;  4DV6 O;  2OCC B;  3TCU A;  1GM8 A;  2VQF O;  1JVM A;  3L9D A;  5JH7 A;  2GV9 A;  5C93 A;  1BE3 H;  3K58 A;  4UV8 A;  2H3O A;  1IVS A;  3CHX A;  3RW0 A;  3W7T A;  1S5J A;  1XHX A;  4LWS A;  2P4K A;  1R6T A;  2WLI A;  5EYP B;  1KB9 F;  4OX9 B;  3TET A;  4JGS A;  1RM1 B;  2DQ3 A;  5KA5 A;  4C7U A;  5LP6 B;  1FXK C;  2CH7 A;  4YY3 B;  1D5N A;  3CRQ A;  2AZ2 A;  5LXT A;  1QLE C;  1EM1 A;  1YSC A;  4TV8 A;  1EN6 A;  5LA6 B;  2DE0 X;  2IH3 C;  4FVM A;  1SRY A;  1ZL8 B;  2Z3Y A;  4J42 A;  3RFR A;  2A06 H;  3GWK C;  3FFQ A;  3G67 A;  3RBZ A;  4B3M O;  1FPO A;  3OUS A;  3CC2 V;  4FFK A;  4X64 B;  1BCC H;  2FB5 A;  5LHH A;  5GON A;  4JF3 A;  3K0D A;  2YEV A;  4UVC A;  1AIL A;  4NYK A;  1Y4M A;  3LSQ A;  4DV2 O;  1M57 B;  2KG7 B;  3ZRX A;  4K8Z A;  1AI4 A;  1O9G A;  4TV9 A;  3DC6 A;  3TXQ A;  3ZMZ A;  2AHY A;  5CA0 B;  3KCY A;  3GB7 C;  4I50 B;  1SKV A;  1YTF D;  4JYY A;  4X66 B;  1LUV A;  4RUF A;  2FTK A;  4JI0 O;  1TA8 A;  2ZDI A;  1YDX A;  5IJ0 A;  1KD1 W;  1WNS A;  4YXW G;  5K1X A;  3T1H O;  5LP6 C;  1SQX H;  1XEQ A;  5IYZ A;  3D3Q A;  2QEX V;  2EJ7 A;  2GBO A;  5CN0 A;  3TXS A;  2OTL V;  2BTQ A;  3UCS C;  1AJP A;  2RCV A;  1I5X A;  1HNX B;  1Y76 B;  2XT9 A;  4YIP A;  1H2M A;  5A9G A;  1XL4 A;  4O2A B;  1R6N A;  3UQ8 A;  1M57 C;  2XND G;  1NBM G;  4GYC B;  5IYD O;  1WN7 A;  2QGN A;  3CP1 A;  3JAT B;  1IBL B;  5IJ9 B;  2IJJ A;  3HKB A;  4X65 O;  3JAW A;  4I55 A;  4NKG B;  1PKX A;  1PL4 A;  1AJN A;  2X7R B;  1N34 O;  2JIZ G;  1V54 C;  1TUE B;  2ITC C;  4UUJ C;  3K3W A;  5LOV B;  3ABM B;  2CUG A;  2QM7 A;  5KUM A;  3B77 A;  1PD3 A;  4PI2 A;  4WF9 V;  2ZR2 A;  1NTK H;  4X20 A;  2CTW A;  4KP4 A;  4PDV A;  1ENV A;  2ZM6 O;  3E8H A;  1JX9 A;  4CH5 A;  3CME V;  4WBN A;  3CS5 A;  2RDC A;  3SYA A;  4DR3 B;  1FKA O;  2Q68 A;  1NVP D;  2WA4 A;  1OCO C;  2DOS A;  2JDI G;  3DXR B;  2EIL B;  2UUA B;  3KDR A;  5BR8 B;  4DR1 B;  3THO A;  1LR1 A;  1B6Q A;  4DRX B;  1MSW D;  2JEX A;  4X9Q A;  3N2K B;  1IJG A;  1HW7 A;  1SQV H;  3ZIA G;  4LCU C;  1AJQ A;  4I7Z B;  2DYR B;  4D7T A;  1MNG A;  2GUZ B;  1JFF B;  1FFT B;  3IFX A;  2EJR A;  1VQ4 V;  1PV0 A;  5FNV A;  2CGN A;  5B1B B;  2CAZ C;  3OMN B;  4H13 B;  3NXS A;  2OT5 A;  1L0L H;  4DV1 O;  1QU7 A;  2XAS A;  1H38 A;  4R8C A;  5BZB A;  3BRC A;  5CA1 B;  1ZWI C;  1DGS A;  2CDY A;  4PA6 A;  4X1I A;  1TAE A;  3N2G B;  4MT8 A;  3E22 A;  2F93 B;  3DC5 A;  2QTO A;  4HAM A;  3BY6 A;  2F4V O;  2QWQ B;  5IDJ A;  4LF8 B;  1Q8I A;  2EIM B;  4DUY O;  3FYE B;  4CH6 A;  2QDO A;  1SQQ H;  3P30 A;  1QVG U;  2VQE O;  1VIB A;  4ICG A;  4FM2 A;  2EIL C;  5HFL A;  1UFI A;  1URF A;  2Y69 B;  2LFR A;  4GX0 A;  5IWA O;  2XTA A;  3ZN1 A;  1F51 A;  1W59 A;  2IM9 A;  2EIN C;  1PNK A;  1Q6I A;  2ZXW B;  2ZR3 A;  2DYR C;  4WFH A;  2K1E A;  3M7M X;  1A32 A;  3MD0 A;  3ETG A;  2NN4 A;  1NJI W;  3K79 A;  2V4D A;  4CH3 A;  4PDR A;  5B1B C;  1KP3 A;  2A0L A;  2PYL A;  1S0V A;  2F66 C;  1P7G A;  2FML A;  1XNQ B;  2YXY A;  3AG4 C;  3AG2 B;  4TUY B;  2P06 A;  1SZT A;  1OCC C;  3VQX A;  4JI5 O;  2CTR A;  1GN4 A;  3U0Z A;  3ZHV A;  2JJ2 G;  1EZJ A;  2W0F C;  2LW1 A;  3CCR V;  4DV6 B;  4DK1 A;  4XDJ A;  2EIM C;  3UM7 A;  2VQF B;  3OUF A;  3OGC C;  1X59 A;  3AK3 A;  2BCC H;  2W0X A;  2BSK B;  3F7Y C;  4UCS A;  2UXC O;  3W7X A;  1VQ8 V;  1GAX A;  3SYQ A;  2IH1 C;  3ZS8 C;  4KXR A;  4RO2 A; 
#chains in the Genus database with same CATH homology
 2ADQ B;  1MSD A;  1WB7 A;  1GN3 A;  1XRE A;  4YIP A;  3CEI A;  5A9G A;  4JZ2 A;  3TJT A;  2CDY A;  1LUW A;  1N0J A;  1JA8 A;  2QKA A;  1EN4 A;  4JZG A;  2GDS A;  1IXB A;  4GUN A;  3DC5 A;  2P4K A;  2AW9 A;  1I0H A;  3EVK A;  1BT8 A;  1XUQ A;  3KKY A;  1ZUQ A;  1VEW A;  1IDS A;  1WB8 A;  4C7U A;  2QKC A;  3LSU A;  1EN5 A;  1AVM A;  1SZX A;  1D5N A;  3OT7 A;  1ZTE A;  1EM1 A;  1VAR A;  3QVN A;  1EN6 A;  3AK2 A;  1PL4 A;  3MDS A;  1AP6 A;  2ADP A;  1ZSP A;  3IC9 A;  1MA1 A;  1GN2 A;  1BS3 A;  4FFK A;  1MMM A;  1XDC A;  1PM9 A;  1BSM A;  1B06 A;  1I08 A;  3C3T A;  3AK1 A;  1GN6 A;  3BFR A;  1IX9 A;  1P7G A;  3DC6 A;  1KKC A;  1N0N A;  3RN4 A;  1AP5 A;  1QNM A;  4E4E A;  4YIO A;  3K9S A;  4JYY A;  1Y67 A;  1LUV A;  1AR4 A;  1GN4 A;  1AR5 A;  3KDR A;  3C3S A;  4F6E A;  4BR6 A;  4X9Q A;  1JR9 A;  1XIL A;  3AK3 A;  1MNG A;  2CE4 A;  5AG2 A;  1ZLZ A;  2RCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...