1EN6A

Crystal structure analysis of the e. coli manganese superoxide dismutase q146l mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 69
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en6A02
4JYYA 5AG2A 1AP5A 3EVKA 3AK3A 3RN4A 1BT8A 1EN6A 1EN5A 1PM9A 4E4EA 1GN3A 1LUVA 3AK2A 3C3SA 1VEWA 1N0NA 3TJTA 3QVNA 1B06A 1EM1A 1P7GA 1PL4A 1ZUQA 1AR5A 2P4KA 1BS3A 1MNGA 2QKAA 1AP6A 1BSMA 1WB8A 1VARA 1D5NA 3MDSA 1KKCA 4JZ2A 3KKYA 4YIPA 1JA8A 1GN6A 3DC6A 3K9SA 2CE4A 4GUNA 1IXBA 1EN4A 4BR6A 3C3TA 2ADPA 1ZTEA 1WB7A 4JZGA 1MSDA 1Y67A 1ZSPA 1N0JA 4FFKA 1LUWA 2RCVA 1AR4A 5A9GA 1IX9A 2GDSA 3DC5A 3CEIA 2QKCA 1SZXA 1GN4A 4YIOA 1XUQA 4C7UA 1I0HA 3LSUA 1XREA 1IDSA 1MA1A 3IC9A 1MMMA 3OT7A 2ADQB 1XILA 1XDCA 1ZLZA 1GN2A 4F6EA 2CDYA 3BFRA 1AVMA 4X9QA 1QNMA 1I08A 1JR9A 3AK1A 2AW9A
chains in the Genus database with same CATH superfamily
5AG2A 1AP5A 2LW1A 3RYHA 3E83A 1DGSA 3OR7C 2ZM6B 1YITV 1ZWIC 3B4SA 2XAJA 2Q4PA 3ZHTA 5ITZB 2CH7A 4O2BA 1N0NA 2LQTA 3RYFA 1DTOA 1VQ7V 1MZFA 4X62B 2UXDO 3E2EA 3CHXA 3KCYA 2JGDA 1PL4A 1BSMA 3B09A 2JIZG 4J11A 4YXWG 2WLNA 1PD3A 1FXKA 1L0LH 3N27A 5B1AC 4JI4B 2H3OA 4JAUA 2OIEA 5IJ9A 3CCVV 4DR6O 4EFBA 3G80A 1K5SA 2X6BA 1QLEB 4UCVA 1SQPH 2YICA 1M93A 1EN4A 2H94A 5FNVA 1VQ8V 1H2GA 5IY5B 3ZX6A 3CCLV 4LF4O 1YVWA 2A7WA 3K79A 1MOFA 4KXRA 4ZKIA 1YXBA 2Y0IA 1XNRB 4X64B 1LR1A 4LBEC 3N2GB 4XDKA 4QNHB 4O4LA 2NR5A 3K5LA 3ASOC 5L3BA 2P06A 3U11A 4FPPA 4ZBMA 2VQFO 3T2MA 2JDIG 1Y74B 4DUYB 3N2KB 2UXCB 4DV4O 4DV0B 1PP9H 1URFA 4EEQA 2YDEA 4DV2O 3T1CA 1LNQA 4AQYB 2DQ3A 5CA1B 2QM8A 4PJ0Z 5JCOC 4DUZB 2UUCB 4K8ZA 1WA8A 5IYBO 3K3WA 5B1BB 3ETGA 1JVMA 2WA3A 3JD0A 5LMUB 1X59A 1K9MW 3UM7A 2WAMA 4WFEA 2VWKA 5DM6V 4TWKA 5LMNB 3AK2A 4WBNA 5BXZA 3JAWA 2A3QA 3ZHRA 2ZM6O 4J9YB 1WPBA 1XOUA 4J42A 1SQXH 3X2QC 4UXNA 3ZHUA 4X62O 3FX7A 4ZI7A 4BWAA 2EZOA 4O2AB 5IT9N 3M99B 2AHYA 1OCZC 4J41A 2OCCB 4G2KA 3P3NA 1GTOA 2XOKG 1IBLB 3FB7C 1GRJA 4JI4O 3HKDA 3ZRWA 1EZJA 1NKDA 1S5HC 2OCHA 3ETQA 2DQ0A 4UCRA 4P30A 4DR1B 5IJ0A 1AI7A 1IBKB 1XNQB 2RQ6A 5IYDO 1AR4A 1BMFG 4OXSA 1AB3A 1OHHG 3FB6C 2M6YA 2X0LA 1K33A 3CWBH 3H1LH 3JCZA 1XNRO 4X64O 3BABA 2QJ1A 4B3TB 2EX3A 4YJ3A 2E3CA 4H0LB 3CE2A 2K9PA 3LDCA 2WA4A 4PA9A 2AGAA 2ZIMA 4DUYO 1NR7A 1BCCH 4JF3A 4DV0O 4JAVA 3VQXA 3OTOO 2EIMC 1VF6A 4UV9A 2CK3G 2HJFC 4AQYO 5GTIZ 4DUZO 2UUCO 2GSMB 4TV9A 2AZ2A 4HNAB 3AG3C 4CS3A 1RM1C 1UJWB 3JALA 4MT8A 1TVKB 5EBLC 5KHIA 1K3EA 4P2ZA 1HNWB 5LMUO 4TSFG 3RT3C 4QIWF 1MZEA 1Y76B 1QVGU 1Q81W 4IHJA 2JS5A 3C3SA 2QWQB 1N34B 2BSKA 2UXBB 4MSWC 1F4MA 1BS3A 4DV5B 2R9AA 3JASB 4UB8Z 4K3AA 1AI6A 4MVZA 1XBLA 1FKAO 3MDSA 5CA3A 4OX9B 4PDRA 1MSWD 4LWSA 1WN7A 2A0LA 4I50A 2ZNJA 3F7YC 4X1KB 1IBLO 3D3IA 4JI1B 1KP3A 5KUMA 2UUBB 3G71V 1SESA 1S72V 4MVUA 4DR1O 3AG4C 1GK9A 1LUWA 1U96A 1SRYA 1NTKH 1VF7A 4CZZA 1JPXA 4NR1A 2EZPA 3OUSA 3FYEB 2KB1A 4FFBB 4XBFA 1KBHA 2RNBA 1XUQA 1H5WA 5CB4B 1HNZB 4FLWA 2G38A 1FOUA 3P3PA 4LH6A 4R7CA 4B3TO 2WLIB 1XREA 3ZMUA 5KLVH 1SKVA 4DK0A 3IFXA 3ZIAG 1K4DC 2BTQA 4IIJA 1H2MA 3ZMZA 1HR0B 1US6A 1R3IC 4LF8B 4H44B 3F5WC 3H1JH 3SYPA 3WB0A 4KHPO 2NLJC 4I0XB 4XDJA 1GM9A 4BW5A 3EVKA 3D36A 4QGPA 3SYQA 3VQVA 1GN3A 2GBOA 4LNUA 2BOBC 5BY1A 1VEWA 3CXCU 4JTDB 5KX5A 1IBMO 4U3JA 1Q90D 4FMTA 1EM1A 1VQMV 1NT2B 3KG2A 5GTHZ 2CUGA 5LP6B 1IVSA 2F95B 5L3DA 3ZHQA 3BCCH 3SJAC 1N34O 5IWAB 2F93B 2UXBO 3OEHG 2A06H 2QGNA 3L71H 2E76B 5H5NA 3P30A 3OD4A 4JI5B 3BPZA 2OTLV 2VWJA 5KAFZ 1KKCA 2F4VO 4TUYB 4BIUA 3C90A 4NXNO 4NB5A 1JA8A 4JYAB 2HFEC 2DYRC 3JSNA 3FB5C 5GONA 1VMGA 2Q5ZA 4UV8A 1H2LA 4JZGA 2HVJC 5CBHA 2BTOA 1R3JC 3GWOA 2V7QG 4OPHA 1Y66A 4O4IB 3T1HB 1ZSPA 2PTMA 4FLUA 4JI1O 3E8GA 4GT1A 1UPGA 2UUBO 4MTXA 3DC5A 3CCSV 4UUJC 3EXAA 2ZXWC 4CH3A 4LF9B 3CRQA 2D2CB 3CCEV 1HP8A 4AILC 1Y74A 2PI5A 4TV8A 1L1FA 5KAIZ 5H6RA 4KFMA 2IJHA 2CTQA 2UUAB 5IE9A 2QDOA 2YIBA 3OW2U 1M1KW 3RWRD 3WG7B 5KHJA 2ZINA 5CMUA 4IGGA 4X89A 1FFXB 4F6EA 2WLHA 3HB3B 2ZIOA 1AVMA 4TQFA 2DWDC 2ZNIA 1HR0O 4LF8O 5K1XA 4ZHQA 1XMQO 4DV3B 1GMGA 1ZAUA 4I55A 5FPOA 4OPAA 1SC5B 3SGIA 1COWG 1EN6A 4PA6A 4P9OA 1DK1A 3RVYA 5L3GA 5B5EZ 3K59A 1S5LZ 1P7BA 4CC6A 5JQGA 1ROPA 1G6UA 5B3SB 1FS0G 3FFQA 5KA6A 4X1YB 2ODMA 1OV9A 2HLDG 2LFSA 5IWAO 2FL4A 1I5YA 4DV1B 4DR4B 4X66B 4JASA 4MTOA 1YDXA 2N05A 4H13B 3KKYA 1V54B 3AG2B 3QNEA 1VP7A 2QTSA 2CAZC 1VQPV 4I4TA 4P9PA 3JAKA 2E5LB 2IH1C 2Q6AA 2XUMA 4RO2A 4Q6GA 3I5DA 4PDVA 2Y4UA 4JI8B 2GUZA 2KG7A 3GB7C 5A9GA 3T1HO 4PDLA 3OR6C 3M8AA 4W4KA 4DR2B 3K08A 1BHBA 2DJVA 3HKCB 3OE7G 4J10A 2LO1A 4PHZA 2YI8A 1R6NA 1MA1A 5C8YB 1KUQA 2QWNB 5L3EA 1I5XA 2UUAO 1S5JA 4Z1MG 1VQKV 3A0HZ 1Q7YW 1M90W 3SDLA 4HNAA 5B1AB 1FD9A 4TT3G 1FFTB 4K0KO 2M7WA 4O4HB 1NTZH 2YSUB 2YEVA 1H8HG 1SS3A 3RFRA 4DV3O 1YJWV 1VF6C 3CRRA 3LSQA 5LOVA 1RFYA 3OTFA 4LR3A 4BIZA 1OCRC 2XHBA 3VQWA 3OGIB 4LFAB 3TJTA 4B3MB 4MW8A 2ZE5A 1NH2B 4E2LA 5EC2C 3L9DA 4LH7A 1BHAA 3APOA 3UQ8A 1ZUQA 2ZCEA 3ABKC 2PGGA 1S3JA 2YUAA 1RP3B 4U7NA 4QE9A 2KSDA 2X7RB 2P4VA 3TCUA 5EIBD 5E1AC 3OM3B 3ASOB 2IJIA 4F6RB 4CS2A 5LYJA 4TOIA 5EBMC 4GYCB 1SQQH 1VF5B 3BHPA 2Q7HA 4DR4O 1FXHA 4X66O 3W7XA 4ZOLA 3DXRB 5CBFA 4FLTA 3TXSA 3ZJZA 5L3CA 1HNXB 4BR6A 3ZHSA 4ICGA 4LF5B 4NVPA 1WB7A 3J81N 1JJOA 1Y67A 3LUTB 2E74B 3LDDA 1N0JA 1OJHA 4DO2A 2E5LO 1B3QA 2NN4A 2NNUA 4K35A 1KD1W 3CCMV 4X8AA 5EYPA 2VQEB 4JI8O 2P22C 3Q4HA 5BZBA 2ZE6A 1SZXA 3DGEA 2QR4A 2LJ2A 2WLIA 1L0NH 3T4DA 3X2QB 4DR2O 3HKBA 3ETEA 3JCUZ 4IT5A 4WFAV 4Z1VA 4DR3B 1XILA 3JD2A 3LDEA 2ARHA 2HHHB 4D6TH 1OCZB 2DWEC 1DF4A 4D7TA 1KECA 1QBZA 4NXMB 5JJJB 4N21A 5LGUA 2QWPB 1BT8A 1PNKA 2WWWA 4LP8A 2Y69C 2PI4A 5EIBC 2YIBD 3E22A 3I56V 4B3SB 2IU3A 1F7YA 3WB2A 2MK3A 4ASUG 1RSOB 3K5OA 3D36C 1XL6A 1V55C 1UFIA 5HFLA 4X1IB 4PA4A 5JWPA 1N36B 4GLXA 4JI7O 5CN0A 1CXZB 4PA7A 4RQEA 4YHHB 4MTFA 3CPWU 1SA0A 2W6JG 3ZS8C 1K97A 5LHIA 5E79Z 3OMIB 3K9SA 1YZBA 4X65B 3ABLC 3ZMSA 2EIMB 1E79G 5KHHA 4KP4A 2UU9B 3SJCC 4LF5O 3AG3B 2Q9LA 1RM1B 2IW5A 4FFKA 1JX9A 2GDSA 5EZYA 2CTWA 4UVCA 2VQEO 5B1OA 3ZMTA 1D5AA 4LF6B 2K1EA 1SQGA 1I0HA 3JSLA 5BMVB 5IYZA 2GTAA 4EB6A 3CMAV 1K8AW 1M5IA 2Y4TA 3LSUA 3QF7A 3K5NA 3UT5A 3CX5F 1JJ2U 1IXMA 1AR1B 1Q86W 3CCJV 1OCCC 4GKJB 1GO3F 2PYLA 1KKDA 3AEIA 1S76D 3ZRSA 1PKXA 1TAEA 4WFBV 1JNBA 2KKWA 3OGCC 2Q7GA 3AK3A 3JARA 5EK0A 1K7DA 1OCOC 4IYHA 2FTKA 4Q20A 1K92A 4UCSA 1YHQV 2R72A 2UXCO 3CP1A 2WPDG 4BIOA 4OGQB 3CJHB 3AG4B 4JGSA 4JYBA 5LA6A 4X20A 2ETNA 4Z2WA 3SYAA 4FM0A 4X1YA 3K0GA 1AR5A 2P4KA 1FYJA 1TUBA 1AI5A 2QKAA 4D7SA 4JI0B 4O4JB 3SYCA 2QA4V 4IL6Z 1NQTA 1N36O 2FKXA 2X6AA 2WLLB 4AHCA 2PYJA 2P90A 2JK5C 2GTSA 3ZRVA 5K1PA 1NTMH 5HFMA 5LMNO 2EILB 3IC7A 2CGOA 1P49A 4I9WA 4LF7B 5LHHA 2YXHA 1ZL8B 4JI3B 5B1NA 1ZTEA 2XAQA 3RYCA 3TXQA 4DRXB 4DR7B 2UU9O 2AZ0A 1U97A 1FJGB 1H38A 2DMXA 4FM2A 3WFVA 1HWYA 3BEHA 4KUMA 3HKEA 3K0DA 4MW3A 1MABG 5KMGA 1YJNV 2Q8VA 2CGNA 3K57A 1M57C 5JVDB 5EC1C 4BW9A 4C7UA 5CA0A 3ICXA 1QU7A 1RPRA 1VQOV 3FAVA 3RYHB 5B66Z 5A2QN 1IDSA 1RPOA 1M56C 3IC9A 1MMMA 1JCHA 4MVSA 3ASNC 1IBKO 5JH7B 5J2TB 2ZT9B 1XNQO 2CH7B 4QPKA 4O2BB 3RYFB 2Q7EA 4RAIA 3QTCA 1VQ4V 1JR9A 2F1MA 2JGDB 3IAYA 3G67A 3AG1C 3NR7A 3BRCA 2JRIA 2JEXA 2DYRB 3K04A 2JS3A 2EIJB 1NR1A 3JATB 4PA3A 2YXLA 1N33B 1K34A 2OYQA 4K8XA 1XQ8A 2Q0OC 5IJ9B 2DYSC 4CH4A 3H1KH 3GWKC 4FLXA 3JYCA 1P7GA 1W59A 3CB2A 2DOSA 2L6LA 4JI6B 2AHZA 1DF5A 2ZXWB 4L87A 5FNVB 1SETA 3T1YB 4HAMA 1XL4A 4JI2B 2HVKC 2IBZH 4DR5B 2ATKC 1F4NA 1HNWO 4JPRA 5ITZA 2ITDC 4J9ZB 2P5OA 4WFFA 4RUFA 4U3FH 3SYOA 2H8PC 3ABTA 2EBOA 4O4LB 3HPLC 3A8TA 1Q6IA 2ADPA 1QR8A 2YS8A 1PPJH 3B2EE 4LF7O 1G1XB 4JI3O 4J7KA 4HBNA 3EFFK 4B3RB 4DV5O 1O9HA 1Q43A 1FJGO 1WA8B 2FB5A 4R6ZA 3CYOA 3RGBA 3RW0A 4OX9O 1KB9F 2Q73A 4WF9V 2QWOB 2V4DA 1FXKC 4MVMA 4EKWA 3CMEV 1EBOA 1K5QA 2D3OW 1J5EB 3F5TA 1SQBH 2ZE8A 3UO3A 4WBNB 1XDCA 3JAWB 3N2GA 3TK1A 4MVRA 1QNMA 2O57A 4DXWA 5TISZ 5LHGA 1M4UA 2BE3A 2RJZA 3N2KA 4ZI7B 1HNZO 3RN4A 3D3QA 3CRMA 1XHZA 5CA1A 3E8FA 4LC1A 3TETA 2VS0A 2FMLA 3WU2Z 1S77D 1X4TA 4GX1A 1RSOA 5DEDA 1N33O 3HKDB 3ZRWB 1NBMG 4X1IA 1XMOB 3HR0A 3MHSC 1MNGA 1KYOF 4CBCA 5IJ0B 4GKKB 3S3WA 3CRAA 1YF2A 5LL6Y 3BY6A 3ML0A 4DR5O 5LXTB 4W4LA 2EIKC 1H8EG 3K5MA 1GN6A 4H37A 1N4CA 4NTXA 2CE4A 3L70H 2CTRA 4GUNA 1Z5VA 1KU9A 3QO7A 4YJ3B 1SF9A 4G27B 1SQFA 4O2AA 3K03A 1G4YB 2JJ1G 1GM8A 5FLXN 4J80A 2DE0X 1G8MA 1SZTA 4JI5O 2R9IA 3SJQC 2QKCA 4PI2A 1OCRB 4TV9B 3LNNA 5BMVA 3B8NA 4JYAO 1NVPB 5LGTA 3JALB 3E8BA 2CTPA 3SPJA 3O9OA 2B9ZA 3ABKB 1XHXA 1J5EO 3CSXA 4UB6Z 1TA8A 2P7TC 4IHJB 2PY5A 3RBZA 2BSKB 3W7TA 4X9QA 3OFNG 2AW9A 3M7MX 4LF9O 1IURA 3L74H 1FPOA 1Y6XA 3B8MA 4FIPC 3ZCCA 1EN5A 1PM9A 1B04A 2B5UA 5FL7G 5C93A 1EZVH 1QR9A 2Y0PA 1WPXA 2LGWA 2OT5A 3CJHA 1Q5OA 4FJCC 1VQNV 1W0JG 3FD9A 2QEXV 1VQ9V 2B1IA 4LCUC 5KHKA 3B40A 2MW2B 4O4JA 4AI8A 1TVKA 1YTFD 4DK1A 4JV5B 3R65A 4GCZA 4EFEA 1Y76A 2WLLA 4CC5A 1EFRG 1JOYA 1NJIW 4GKKO 3J80N 1Q6HA 3U10A 3CRCA 3KZIZ 1AILA 4YIPA 3VQYA 1YEWA 5JJEB 1NH2D 4DV4B 2YIAA 3MD0A 2JEUA 2Q69A 3JASA 1P84F 2X6CA 1L8DA 2C2AA 2VRZA 1JMKC 1IX9A 2BTQB 4FLZA 3KDRA 5IYCO 1YCIA 3UKMA 5DN6G 4DV1O 3SPHA 1F23A 4X1KA 4YIOA 5JVDA 4L8JA 2Y69B 4FM1A 2QTOA 3VOUA 5F2VO 2F23A 1BE3H 4IYIA 2LFRA 3CCRV 1WP7A 1V55B 2XAHA 3OT7A 5JH7A 5J2TA 2WSSG 4R8CA 1K4CC 4LNUB 3KCXA 4NTYA 2CDYA 4FFBA 5KX5B 4U3JB 3K9AA 5KUKA 5CB4A 2EULA 3VBBA 2EINC 4YJ2B 2KQXA 3JD3A 5JJNB 3ABLB 1AJQA 2L35A 3P32A 1LUVA 3JATA 4R50A 3CC2V 4FZ1A 5H6QA 2OIGA 1WNSA 1H2KA 1GM7A 1E1QG 3ABMC 1A32A 1YJ9V 4I0XA 5GONB 3H9VA 3OMNB 4I7ZB 1THZA 2QKSA 3GVMA 1NS1A 4A5UB 4JV5O 4MVQA 2W0XA 4JZ2A 3K58A 3SR2C 4PI0A 2ZDIA 3QG5A 3FB8C 4HZ3A 5LP6A 3IJ4A 3RYIB 4LFAO 2HKOA 4B3MO 2XASA 4BAYA 1OCCB 4TV8B 1KMIZ 1AI4A 3OTOB 2AXTZ 3L73H 2QE7G 2ZKOA 4N23A 3ABUA 3FYIB 3DSQA 3ZHVA 5D5PA 4TUYA 4I9QA 1OCOB 3CEIA 2P67A 4DV7B 4FVMA 4J7ZA 1H2NA 2HG5C 4ZHQB 4I55B 4O4IA 3D8CA 3B77A 1HNXO 1BQ0A 3G6BA 1FAFA 3L75H 2F66C 1NI8A 1E1RG 1QLEC 4JYCA 4PV1B 4FK5C 2Q67A 5JQGB 1KQSU 3FKSG 1R3LC 5IY5C 1M9NA 3L72H 4QPJA 2PF4E 3E35A 5J2UB 2N74A 3SPIA 2ZE7A 3CCQV 2F43G 1SERA 3EHBB 2E75B 2IM9A 1FFXA 1PV0A 4ABMA 1JQ0A 2RN9A 2UXXA 1YI2V 3U0ZA 2XAGA 2RMKB 4DR3O 1F51A 3BAAA 3T4ZA 4UCOA 1W2BU 1VQ6V 4G28B 3OAAG 3H1IH 4I4TB 2HHHO 3JAKB 3NXSA 1AP6A 1QVFU 1IZ3A 1WP8A 1WB8A 1M57B 1JFFB 1NU1H 2Y48A 4NXMO 1D5NA 2LW7A 3E86A 5B1BC 2DW4A 2GUZB 5LXTA 2KG7B 4NTWA 3A0BZ 3J7AU 1M56B 4WFHA 1T5EA 3ASNB 4WCEV 1S0VA 3UCSC 4UVAA 4B3SO 4J7JA 3LSSA 3CD6V 3W7UA 2Z0AA 3OEEG 1AJNA 3JD1A 1DLBA 3AG1B 2WLMA 4U7OA 1W0KG 2ZQMA 4KHPB 5IDJA 1XI1A 4YHHO 3CCUV 1Q6UA 1GN4A 5H9CA 3IGAC 3CC7V 1ZX3A 1SQVH 4DV7O 2ZR3A 3MHHC 2YEVB 2OCCC 2DYSB 4X65O 3BA8A 4PDMA 2R9RB 1IBMB 4B7EA 2YI9A 5LOVB 2Z5UA 5L3FA 1ORQC 1O9GA 1KP2A 1I08A 3I55V 4WFGA 4F4LA 3AK1A 3HKCA 2QM7A 2W0FC 4I5SA 2BCCH 4JYYA 2QWRB 1AROP 4LF6O 3W7SA 2F4VB 1TUEB 2GV9A 5C8YA 4NXNB 3DTUB 3RVZA 5LYJB 1QHTA 1H2SB 1YSCA 1QLNA 2ZR2A 1TGOA 1B06A 2ITCC 3WB1A 4FLVA 3A0RA 4ZOLB 2Z3YA 4O4HA 3PN1A 4GKJO 2GHYA 1PL0A 4NKGB 3SJBC 5LGNA 1YIJV 4GX5A 1FXKB 1I94B 5EYPB 1R1BA 4RWUA 2WLKA 4QE7A 1Q3EA 3Q4HB 5BR8B 3QO5A 3C3TA 1AJPA 4HYOA 3HKBB 4QJFB 5GW7A 2EILC 4RUEA 3BVOA 3SPGA 3APQA 4F6RA 4DW0A 2QSAA 3LNMB 4JI0O 1HDJA 3UO2A 1GKFA 2V1DA 4DYLA 3H1HH 1PNLA 4GZRB 1XMQB 3DXRA 5JCOA 2Q0AA 3STLC 1FXVA 2JGUA 1ENVA 1OZ0A 2A9HA 1Q8IA 2JVDA 4JTCB 3R66A 4LFBB 3OUFA 1N8RW 2B1GA 2XTAA 2EJRA 2HP8A 4MTGA 5DECA 4CS4A 4DR7O 5FPRA 4YY3B 3K06A 1R6TA 1BGYH 1GAXA 4JTAB 3E22B 4DV6B 4YJ2A 2UXNA 1WAZA 2FYUH 2YIDA 4XDLA 3JD4A 4UFZA 4FLYA 3S3XA 2PUSA 2EIKB 5H2FZ 1CP9A 1QQCA 2ILMA 3ETDA 3A2FA 1Q82W 5EBWC 2XNDG 1Y4MA 1SA0B 2W6IG 3W7WA 4NYKA 2QM4A 4UCUA 4B08A 4TQDA 1I7FA 3ZEDA 2EIJC 2EJ7A 5J9PC 5LBQA 3ZN1A 1XEQA 1VARA 2P6JA 1Z2GA 4DW1A 1CEZA 4ZIBA 1R73A 1N32B 1IJGA 5EZYB 2ZD9A 4RQFA 1I94O 4LFCB 1CPYA 3RYIA 3O65A 1BZKA 5BR8O 5IYZB 4EB6B 2OWOA 4JI6O 4H33A 2ZDIC 1GH6A 3UT5B 5LP6C 3T1YO 4JI2O 4K0KB 2RDCA 3G4SV 2HJDA 3SPCA 3BA9A 2IJJA 3ZRXA 4MS2A 3ZN0A 4GX0A 2DN9A 3JARB 1D2DA 2YXYA 2Q68A 2ADQB 4GX2A 2OTJV 2R70A 4LFBO 1ZLZA 3F7VC 4B3RO 4CH6A 3CS5A 4YY3O 3E89A 1MG1A 5LA6B 4X20B 5J2UA 5D5QA 4DV6O 1K73W 1KC8W 1WJZA 1TUBB 1NVPD 4E4EA 1WLEA 2XT9A 3H01A 3MAQA 2UXDB 1PNMA 4JAAA 3QVNA 1NZ6A 2A79B 1BQZA 1VQLV 1R3KC 2IU0A 3ZBHA 3WG7C 2XAFA 1JFFA 3RYCB 3QO8A 4DR6B 2LGQA 1R6KA 4UCTA 2HR3A 4LWSB 5KHGA 3CC4V 4I50B 3DC6A 3HKEB 1N32O 5KMGB 1IXBA 3G6EV 4LFCO 3E8HA 4UVBA 4KL1A 4MVOA 2JJ2G 5CA0B 3CXHF 4B7KA 5KA5A 3TGUH 1BL8A 4PD4F 4LF4B 2N04A 1MSDA 4FZ0A 3FAVB 1XMOO 2EINB 1HW7A 2RCVA 4PELA 5B3SC 1VIBA 2WLJA 2YC0A 2LP7A 3STZC 3ZMVA 2HEPA 1QCEA 1P4RA 2VQFB 1YTFB 1ZL8A 3OMAB 4X88A 2BOCC 4DV2B 1J95A 4DRXA 2IH3C 3ABMB 2IJKA 1V54C 1Z5WA 3AG2C 3PJSK 3AG7A 3JAMN 5CBGA 2PZSA 1GN2A 4IIJB 1B6QA 3BFRA 4JI7B 1V9PA 1VQ5V 3THOA 4CH5A
chains in the Genus database with same CATH topology
4JYYA 5AG2A 1AP5A 3EVKA 3AK3A 3RN4A 1BT8A 1EN6A 1EN5A 1PM9A 4E4EA 1GN3A 1LUVA 3AK2A 3C3SA 1VEWA 1N0NA 3TJTA 3QVNA 1B06A 1EM1A 1P7GA 1PL4A 1ZUQA 1AR5A 2P4KA 1BS3A 1MNGA 2QKAA 1AP6A 1BSMA 1WB8A 1VARA 1D5NA 3MDSA 1KKCA 4JZ2A 3KKYA 4YIPA 1JA8A 1GN6A 3DC6A 3K9SA 2CE4A 4GUNA 1IXBA 1EN4A 4BR6A 3C3TA 2ADPA 1ZTEA 1WB7A 4JZGA 1MSDA 1Y67A 1ZSPA 1N0JA 4FFKA 1LUWA 2RCVA 1AR4A 5A9GA 1IX9A 2GDSA 3DC5A 3KDRA 3CEIA 2QKCA 1SZXA 1GN4A 4YIOA 1XUQA 4C7UA 1I0HA 3LSUA 1XREA 1IDSA 1MA1A 3IC9A 1MMMA 3OT7A 2ADQB 1XILA 1XDCA 1ZLZA 1GN2A 4F6EA 2CDYA 3BFRA 1AVMA 4X9QA 1QNMA 1I08A 1JR9A 3AK1A 2AW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYY A;  5AG2 A;  1AP5 A;  3EVK A;  3AK3 A;  3RN4 A;  1BT8 A;  1EN6 A;  1EN5 A;  1PM9 A;  4E4E A;  1GN3 A;  1LUV A;  3AK2 A;  3C3S A;  1VEW A;  1N0N A;  3TJT A;  3QVN A;  1B06 A;  1EM1 A;  1P7G A;  1PL4 A;  1ZUQ A;  1AR5 A;  2P4K A;  1BS3 A;  1MNG A;  2QKA A;  1AP6 A;  1BSM A;  1WB8 A;  1VAR A;  1D5N A;  3MDS A;  1KKC A;  4JZ2 A;  3KKY A;  4YIP A;  1JA8 A;  1GN6 A;  3DC6 A;  3K9S A;  2CE4 A;  4GUN A;  1IXB A;  1EN4 A;  4BR6 A;  3C3T A;  2ADP A;  1ZTE A;  1WB7 A;  4JZG A;  1MSD A;  1Y67 A;  1ZSP A;  1N0J A;  4FFK A;  1LUW A;  2RCV A;  1AR4 A;  5A9G A;  1IX9 A;  2GDS A;  3DC5 A;  3CEI A;  2QKC A;  1SZX A;  1GN4 A;  4YIO A;  1XUQ A;  4C7U A;  1I0H A;  3LSU A;  1XRE A;  1IDS A;  1MA1 A;  3IC9 A;  1MMM A;  3OT7 A;  2ADQ B;  1XIL A;  1XDC A;  1ZLZ A;  1GN2 A;  4F6E A;  2CDY A;  3BFR A;  1AVM A;  4X9Q A;  1QNM A;  1I08 A;  1JR9 A;  3AK1 A;  2AW9 A; 
#chains in the Genus database with same CATH topology
 5AG2 A;  1AP5 A;  2LW1 A;  3RYH A;  3E83 A;  1DGS A;  3OR7 C;  2ZM6 B;  1YIT V;  1ZWI C;  3B4S A;  2XAJ A;  2Q4P A;  3ZHT A;  5ITZ B;  2CH7 A;  4O2B A;  1N0N A;  2LQT A;  3RYF A;  1DTO A;  1VQ7 V;  1MZF A;  4X62 B;  2UXD O;  3E2E A;  3CHX A;  3KCY A;  2JGD A;  1PL4 A;  1BSM A;  3B09 A;  2JIZ G;  4J11 A;  4YXW G;  2WLN A;  1PD3 A;  1FXK A;  1L0L H;  3N27 A;  5B1A C;  4JI4 B;  2H3O A;  4JAU A;  2OIE A;  5IJ9 A;  3CCV V;  4DR6 O;  4EFB A;  3G80 A;  1K5S A;  2X6B A;  1QLE B;  4UCV A;  1SQP H;  2YIC A;  1M93 A;  1EN4 A;  2H94 A;  5FNV A;  1VQ8 V;  1H2G A;  5IY5 B;  3ZX6 A;  3CCL V;  4LF4 O;  1YVW A;  2A7W A;  3K79 A;  1MOF A;  4KXR A;  4ZKI A;  1YXB A;  2Y0I A;  1XNR B;  4X64 B;  1LR1 A;  4LBE C;  3N2G B;  4XDK A;  4QNH B;  4O4L A;  2NR5 A;  3K5L A;  3ASO C;  5L3B A;  2P06 A;  3U11 A;  4FPP A;  4ZBM A;  2VQF O;  3T2M A;  2JDI G;  1Y74 B;  4DUY B;  3N2K B;  2UXC B;  4DV4 O;  4DV0 B;  1PP9 H;  1URF A;  4EEQ A;  2YDE A;  4DV2 O;  3T1C A;  1LNQ A;  4AQY B;  2DQ3 A;  5CA1 B;  2QM8 A;  4PJ0 Z;  5JCO C;  4DUZ B;  2UUC B;  4K8Z A;  1WA8 A;  5IYB O;  3K3W A;  5B1B B;  3ETG A;  1JVM A;  2WA3 A;  3JD0 A;  5LMU B;  1X59 A;  1K9M W;  3UM7 A;  2WAM A;  4WFE A;  2VWK A;  5DM6 V;  4TWK A;  5LMN B;  3AK2 A;  4WBN A;  5BXZ A;  3JAW A;  2A3Q A;  3ZHR A;  2ZM6 O;  4J9Y B;  1WPB A;  1XOU A;  4J42 A;  1SQX H;  3X2Q C;  4UXN A;  3ZHU A;  4X62 O;  3FX7 A;  4ZI7 A;  4BWA A;  2EZO A;  4O2A B;  5IT9 N;  3M99 B;  2AHY A;  1OCZ C;  4J41 A;  2OCC B;  4G2K A;  3P3N A;  1GTO A;  2XOK G;  1IBL B;  3FB7 C;  1GRJ A;  4JI4 O;  3HKD A;  3ZRW A;  1EZJ A;  1NKD A;  1S5H C;  2OCH A;  3ETQ A;  2DQ0 A;  4UCR A;  4P30 A;  4DR1 B;  5IJ0 A;  1AI7 A;  1IBK B;  1XNQ B;  2RQ6 A;  5IYD O;  1AR4 A;  1BMF G;  4OXS A;  1AB3 A;  1OHH G;  3FB6 C;  2M6Y A;  2X0L A;  1K33 A;  3CWB H;  3H1L H;  3JCZ A;  1XNR O;  4X64 O;  3BAB A;  2QJ1 A;  4B3T B;  2EX3 A;  4YJ3 A;  2E3C A;  4H0L B;  3CE2 A;  2K9P A;  3LDC A;  2WA4 A;  4PA9 A;  2AGA A;  2ZIM A;  4DUY O;  1NR7 A;  1BCC H;  4JF3 A;  4DV0 O;  4JAV A;  3VQX A;  3OTO O;  2EIM C;  1VF6 A;  4UV9 A;  2CK3 G;  2HJF C;  4AQY O;  5GTI Z;  4DUZ O;  2UUC O;  2GSM B;  4TV9 A;  2AZ2 A;  4HNA B;  3AG3 C;  4CS3 A;  1RM1 C;  1UJW B;  3JAL A;  4MT8 A;  1TVK B;  5EBL C;  5KHI A;  1K3E A;  4P2Z A;  1HNW B;  5LMU O;  4TSF G;  3RT3 C;  4QIW F;  1MZE A;  1Y76 B;  1QVG U;  1Q81 W;  4IHJ A;  2JS5 A;  3C3S A;  2QWQ B;  1N34 B;  2BSK A;  2UXB B;  4MSW C;  1F4M A;  1BS3 A;  4DV5 B;  2R9A A;  3JAS B;  4UB8 Z;  4K3A A;  1AI6 A;  4MVZ A;  1XBL A;  1FKA O;  3MDS A;  5CA3 A;  4OX9 B;  4PDR A;  1MSW D;  4LWS A;  1WN7 A;  2A0L A;  4I50 A;  2ZNJ A;  3F7Y C;  4X1K B;  1IBL O;  3D3I A;  4JI1 B;  1KP3 A;  5KUM A;  2UUB B;  3G71 V;  1SES A;  1S72 V;  4MVU A;  4DR1 O;  3AG4 C;  1GK9 A;  1LUW A;  1U96 A;  1SRY A;  1NTK H;  1VF7 A;  4CZZ A;  1JPX A;  4NR1 A;  2EZP A;  3OUS A;  3FYE B;  2KB1 A;  4FFB B;  4XBF A;  1KBH A;  2RNB A;  1XUQ A;  1H5W A;  5CB4 B;  1HNZ B;  4FLW A;  2G38 A;  1FOU A;  3P3P A;  4LH6 A;  4R7C A;  4B3T O;  2WLI B;  1XRE A;  3ZMU A;  5KLV H;  1SKV A;  4DK0 A;  3IFX A;  3ZIA G;  1K4D C;  2BTQ A;  4IIJ A;  1H2M A;  3ZMZ A;  1HR0 B;  1US6 A;  1R3I C;  4LF8 B;  4H44 B;  3F5W C;  3H1J H;  3SYP A;  3WB0 A;  4KHP O;  2NLJ C;  4I0X B;  4XDJ A;  1GM9 A;  4BW5 A;  3EVK A;  3D36 A;  4QGP A;  3SYQ A;  3VQV A;  1GN3 A;  2GBO A;  4LNU A;  2BOB C;  5BY1 A;  1VEW A;  3CXC U;  4JTD B;  5KX5 A;  1IBM O;  4U3J A;  1Q90 D;  4FMT A;  1EM1 A;  1VQM V;  1NT2 B;  3KG2 A;  5GTH Z;  2CUG A;  5LP6 B;  1IVS A;  2F95 B;  5L3D A;  3ZHQ A;  3BCC H;  3SJA C;  1N34 O;  5IWA B;  2F93 B;  2UXB O;  3OEH G;  2A06 H;  2QGN A;  3L71 H;  2E76 B;  5H5N A;  3P30 A;  3OD4 A;  4JI5 B;  3BPZ A;  2OTL V;  2VWJ A;  5KAF Z;  1KKC A;  2F4V O;  4TUY B;  4BIU A;  3C90 A;  4NXN O;  4NB5 A;  1JA8 A;  4JYA B;  2HFE C;  2DYR C;  3JSN A;  3FB5 C;  5GON A;  1VMG A;  2Q5Z A;  4UV8 A;  1H2L A;  4JZG A;  2HVJ C;  5CBH A;  2BTO A;  1R3J C;  3GWO A;  2V7Q G;  4OPH A;  1Y66 A;  4O4I B;  3T1H B;  1ZSP A;  2PTM A;  4FLU A;  4JI1 O;  3E8G A;  4GT1 A;  1UPG A;  2UUB O;  4MTX A;  3DC5 A;  3CCS V;  4UUJ C;  3EXA A;  2ZXW C;  4CH3 A;  4LF9 B;  3CRQ A;  2D2C B;  3CCE V;  1HP8 A;  4AIL C;  1Y74 A;  2PI5 A;  4TV8 A;  1L1F A;  5KAI Z;  5H6R A;  4KFM A;  2IJH A;  2CTQ A;  2UUA B;  5IE9 A;  2QDO A;  2YIB A;  3OW2 U;  1M1K W;  3RWR D;  3WG7 B;  5KHJ A;  2ZIN A;  5CMU A;  4IGG A;  4X89 A;  1FFX B;  4F6E A;  2WLH A;  3HB3 B;  2ZIO A;  1AVM A;  4TQF A;  2DWD C;  2ZNI A;  1HR0 O;  4LF8 O;  5K1X A;  4ZHQ A;  1XMQ O;  4DV3 B;  1GMG A;  1ZAU A;  4I55 A;  5FPO A;  4OPA A;  1SC5 B;  3SGI A;  1COW G;  1EN6 A;  4PA6 A;  4P9O A;  1DK1 A;  3RVY A;  5L3G A;  5B5E Z;  3K59 A;  1S5L Z;  1P7B A;  4CC6 A;  5JQG A;  1ROP A;  1G6U A;  5B3S B;  1FS0 G;  3FFQ A;  5KA6 A;  4X1Y B;  2ODM A;  1OV9 A;  2HLD G;  2LFS A;  5IWA O;  2FL4 A;  1I5Y A;  4DV1 B;  4DR4 B;  4X66 B;  4JAS A;  4MTO A;  1YDX A;  2N05 A;  4H13 B;  3KKY A;  1V54 B;  3AG2 B;  3QNE A;  1VP7 A;  2QTS A;  2CAZ C;  1VQP V;  4I4T A;  4P9P A;  3JAK A;  2E5L B;  2IH1 C;  2Q6A A;  2XUM A;  4RO2 A;  4Q6G A;  3I5D A;  4PDV A;  2Y4U A;  4JI8 B;  2GUZ A;  2KG7 A;  3GB7 C;  5A9G A;  3T1H O;  4PDL A;  3OR6 C;  3M8A A;  4W4K A;  4DR2 B;  3K08 A;  1BHB A;  2DJV A;  3HKC B;  3OE7 G;  4J10 A;  2LO1 A;  4PHZ A;  2YI8 A;  1R6N A;  1MA1 A;  5C8Y B;  1KUQ A;  2QWN B;  5L3E A;  1I5X A;  2UUA O;  1S5J A;  4Z1M G;  1VQK V;  3A0H Z;  1Q7Y W;  1M90 W;  3SDL A;  4HNA A;  5B1A B;  1FD9 A;  4TT3 G;  1FFT B;  4K0K O;  2M7W A;  4O4H B;  1NTZ H;  2YSU B;  2YEV A;  1H8H G;  1SS3 A;  3RFR A;  4DV3 O;  1YJW V;  1VF6 C;  3CRR A;  3LSQ A;  5LOV A;  1RFY A;  3OTF A;  4LR3 A;  4BIZ A;  1OCR C;  2XHB A;  3VQW A;  3OGI B;  4LFA B;  3TJT A;  4B3M B;  4MW8 A;  2ZE5 A;  1NH2 B;  4E2L A;  5EC2 C;  3L9D A;  4LH7 A;  1BHA A;  3APO A;  3UQ8 A;  1ZUQ A;  2ZCE A;  3ABK C;  2PGG A;  1S3J A;  2YUA A;  1RP3 B;  4U7N A;  4QE9 A;  2KSD A;  2X7R B;  2P4V A;  3TCU A;  5EIB D;  5E1A C;  3OM3 B;  3ASO B;  2IJI A;  4F6R B;  4CS2 A;  5LYJ A;  4TOI A;  5EBM C;  4GYC B;  1SQQ H;  1VF5 B;  3BHP A;  2Q7H A;  4DR4 O;  1FXH A;  4X66 O;  3W7X A;  4ZOL A;  3DXR B;  5CBF A;  4FLT A;  3TXS A;  3ZJZ A;  5L3C A;  1HNX B;  4BR6 A;  3ZHS A;  4ICG A;  4LF5 B;  4NVP A;  1WB7 A;  3J81 N;  1JJO A;  1Y67 A;  3LUT B;  2E74 B;  3LDD A;  1N0J A;  1OJH A;  4DO2 A;  2E5L O;  1B3Q A;  2NN4 A;  2NNU A;  4K35 A;  1KD1 W;  3CCM V;  4X8A A;  5EYP A;  2VQE B;  4JI8 O;  2P22 C;  3Q4H A;  5BZB A;  2ZE6 A;  1SZX A;  3DGE A;  2QR4 A;  2LJ2 A;  2WLI A;  1L0N H;  3T4D A;  3X2Q B;  4DR2 O;  3HKB A;  3ETE A;  3JCU Z;  4IT5 A;  4WFA V;  4Z1V A;  4DR3 B;  1XIL A;  3JD2 A;  3LDE A;  2ARH A;  2HHH B;  4D6T H;  1OCZ B;  2DWE C;  1DF4 A;  4D7T A;  1KEC A;  1QBZ A;  4NXM B;  5JJJ B;  4N21 A;  5LGU A;  2QWP B;  1BT8 A;  1PNK A;  2WWW A;  4LP8 A;  2Y69 C;  2PI4 A;  5EIB C;  2YIB D;  3E22 A;  3I56 V;  4B3S B;  2IU3 A;  1F7Y A;  3WB2 A;  2MK3 A;  4ASU G;  1RSO B;  3K5O A;  3D36 C;  1XL6 A;  1V55 C;  1UFI A;  5HFL A;  4X1I B;  4PA4 A;  5JWP A;  1N36 B;  4GLX A;  4JI7 O;  5CN0 A;  1CXZ B;  4PA7 A;  4RQE A;  4YHH B;  4MTF A;  3CPW U;  1SA0 A;  2W6J G;  3ZS8 C;  1K97 A;  5LHI A;  5E79 Z;  3OMI B;  3K9S A;  1YZB A;  4X65 B;  3ABL C;  3ZMS A;  2EIM B;  1E79 G;  5KHH A;  4KP4 A;  2UU9 B;  3SJC C;  4LF5 O;  3AG3 B;  2Q9L A;  1RM1 B;  2IW5 A;  4FFK A;  1JX9 A;  2GDS A;  5EZY A;  2CTW A;  4UVC A;  2VQE O;  5B1O A;  3ZMT A;  1D5A A;  4LF6 B;  2K1E A;  1SQG A;  1I0H A;  3JSL A;  5BMV B;  5IYZ A;  2GTA A;  4EB6 A;  3CMA V;  1K8A W;  1M5I A;  2Y4T A;  3LSU A;  3QF7 A;  3K5N A;  3UT5 A;  3CX5 F;  1JJ2 U;  1IXM A;  1AR1 B;  1Q86 W;  3CCJ V;  1OCC C;  4GKJ B;  1GO3 F;  2PYL A;  1KKD A;  3AEI A;  1S76 D;  3ZRS A;  1PKX A;  1TAE A;  4WFB V;  1JNB A;  2KKW A;  3OGC C;  2Q7G A;  3AK3 A;  3JAR A;  5EK0 A;  1K7D A;  1OCO C;  4IYH A;  2FTK A;  4Q20 A;  1K92 A;  4UCS A;  1YHQ V;  2R72 A;  2UXC O;  3CP1 A;  2WPD G;  4BIO A;  4OGQ B;  3CJH B;  3AG4 B;  4JGS A;  4JYB A;  5LA6 A;  4X20 A;  2ETN A;  4Z2W A;  3SYA A;  4FM0 A;  4X1Y A;  3K0G A;  1AR5 A;  2P4K A;  1FYJ A;  1TUB A;  1AI5 A;  2QKA A;  4D7S A;  4JI0 B;  4O4J B;  3SYC A;  2QA4 V;  4IL6 Z;  1NQT A;  1N36 O;  2FKX A;  2X6A A;  2WLL B;  4AHC A;  2PYJ A;  2P90 A;  2JK5 C;  2GTS A;  3ZRV A;  5K1P A;  1NTM H;  5HFM A;  5LMN O;  2EIL B;  3IC7 A;  2CGO A;  1P49 A;  4I9W A;  4LF7 B;  5LHH A;  2YXH A;  1ZL8 B;  4JI3 B;  5B1N A;  1ZTE A;  2XAQ A;  3RYC A;  3TXQ A;  4DRX B;  4DR7 B;  2UU9 O;  2AZ0 A;  1U97 A;  1FJG B;  1H38 A;  2DMX A;  4FM2 A;  3WFV A;  1HWY A;  3BEH A;  4KUM A;  3HKE A;  3K0D A;  4MW3 A;  1MAB G;  5KMG A;  1YJN V;  2Q8V A;  2CGN A;  3K57 A;  1M57 C;  5JVD B;  5EC1 C;  4BW9 A;  4C7U A;  5CA0 A;  3ICX A;  1QU7 A;  1RPR A;  1VQO V;  3FAV A;  3RYH B;  5B66 Z;  5A2Q N;  1IDS A;  1RPO A;  1M56 C;  3IC9 A;  1MMM A;  1JCH A;  4MVS A;  3ASN C;  1IBK O;  5JH7 B;  5J2T B;  2ZT9 B;  1XNQ O;  2CH7 B;  4QPK A;  4O2B B;  3RYF B;  2Q7E A;  4RAI A;  3QTC A;  1VQ4 V;  1JR9 A;  2F1M A;  2JGD B;  3IAY A;  3G67 A;  3AG1 C;  3NR7 A;  3BRC A;  2JRI A;  2JEX A;  2DYR B;  3K04 A;  2JS3 A;  2EIJ B;  1NR1 A;  3JAT B;  4PA3 A;  2YXL A;  1N33 B;  1K34 A;  2OYQ A;  4K8X A;  1XQ8 A;  2Q0O C;  5IJ9 B;  2DYS C;  4CH4 A;  3H1K H;  3GWK C;  4FLX A;  3JYC A;  1P7G A;  1W59 A;  3CB2 A;  2DOS A;  2L6L A;  4JI6 B;  2AHZ A;  1DF5 A;  2ZXW B;  4L87 A;  5FNV B;  1SET A;  3T1Y B;  4HAM A;  1XL4 A;  4JI2 B;  2HVK C;  2IBZ H;  4DR5 B;  2ATK C;  1F4N A;  1HNW O;  4JPR A;  5ITZ A;  2ITD C;  4J9Z B;  2P5O A;  4WFF A;  4RUF A;  4U3F H;  3SYO A;  2H8P C;  3ABT A;  2EBO A;  4O4L B;  3HPL C;  3A8T A;  1Q6I A;  2ADP A;  1QR8 A;  2YS8 A;  1PPJ H;  3B2E E;  4LF7 O;  1G1X B;  4JI3 O;  4J7K A;  4HBN A;  3EFF K;  4B3R B;  4DV5 O;  1O9H A;  1Q43 A;  1FJG O;  1WA8 B;  2FB5 A;  4R6Z A;  3CYO A;  3RGB A;  3RW0 A;  4OX9 O;  1KB9 F;  2Q73 A;  4WF9 V;  2QWO B;  2V4D A;  1FXK C;  4MVM A;  4EKW A;  3CME V;  1EBO A;  1K5Q A;  2D3O W;  1J5E B;  3F5T A;  1SQB H;  2ZE8 A;  3UO3 A;  4WBN B;  1XDC A;  3JAW B;  3N2G A;  3TK1 A;  4MVR A;  1QNM A;  2O57 A;  4DXW A;  5TIS Z;  5LHG A;  1M4U A;  2BE3 A;  2RJZ A;  3N2K A;  4ZI7 B;  1HNZ O;  3RN4 A;  3D3Q A;  3CRM A;  1XHZ A;  5CA1 A;  3E8F A;  4LC1 A;  3TET A;  2VS0 A;  2FML A;  3WU2 Z;  1S77 D;  1X4T A;  4GX1 A;  1RSO A;  5DED A;  1N33 O;  3HKD B;  3ZRW B;  1NBM G;  4X1I A;  1XMO B;  3HR0 A;  3MHS C;  1MNG A;  1KYO F;  4CBC A;  5IJ0 B;  4GKK B;  3S3W A;  3CRA A;  1YF2 A;  5LL6 Y;  3BY6 A;  3ML0 A;  4DR5 O;  5LXT B;  4W4L A;  2EIK C;  1H8E G;  3K5M A;  1GN6 A;  4H37 A;  1N4C A;  4NTX A;  2CE4 A;  3L70 H;  2CTR A;  4GUN A;  1Z5V A;  1KU9 A;  3QO7 A;  4YJ3 B;  1SF9 A;  4G27 B;  1SQF A;  4O2A A;  3K03 A;  1G4Y B;  2JJ1 G;  1GM8 A;  5FLX N;  4J80 A;  2DE0 X;  1G8M A;  1SZT A;  4JI5 O;  2R9I A;  3SJQ C;  2QKC A;  4PI2 A;  1OCR B;  4TV9 B;  3LNN A;  5BMV A;  3B8N A;  4JYA O;  1NVP B;  5LGT A;  3JAL B;  3E8B A;  2CTP A;  3SPJ A;  3O9O A;  2B9Z A;  3ABK B;  1XHX A;  1J5E O;  3CSX A;  4UB6 Z;  1TA8 A;  2P7T C;  4IHJ B;  2PY5 A;  3RBZ A;  2BSK B;  3W7T A;  4X9Q A;  3OFN G;  2AW9 A;  3M7M X;  4LF9 O;  1IUR A;  3L74 H;  1FPO A;  1Y6X A;  3B8M A;  4FIP C;  3ZCC A;  1EN5 A;  1PM9 A;  1B04 A;  2B5U A;  5FL7 G;  5C93 A;  1EZV H;  1QR9 A;  2Y0P A;  1WPX A;  2LGW A;  2OT5 A;  3CJH A;  1Q5O A;  4FJC C;  1VQN V;  1W0J G;  3FD9 A;  2QEX V;  1VQ9 V;  2B1I A;  4LCU C;  5KHK A;  3B40 A;  2MW2 B;  4O4J A;  4AI8 A;  1TVK A;  1YTF D;  4DK1 A;  4JV5 B;  3R65 A;  4GCZ A;  4EFE A;  1Y76 A;  2WLL A;  4CC5 A;  1EFR G;  1JOY A;  1NJI W;  4GKK O;  3J80 N;  1Q6H A;  3U10 A;  3CRC A;  3KZI Z;  1AIL A;  4YIP A;  3VQY A;  1YEW A;  5JJE B;  1NH2 D;  4DV4 B;  2YIA A;  3MD0 A;  2JEU A;  2Q69 A;  3JAS A;  1P84 F;  2X6C A;  1L8D A;  2C2A A;  2VRZ A;  1JMK C;  1IX9 A;  2BTQ B;  4FLZ A;  3KDR A;  5IYC O;  1YCI A;  3UKM A;  5DN6 G;  4DV1 O;  3SPH A;  1F23 A;  4X1K A;  4YIO A;  5JVD A;  4L8J A;  2Y69 B;  4FM1 A;  2QTO A;  3VOU A;  5F2V O;  2F23 A;  1BE3 H;  4IYI A;  2LFR A;  3CCR V;  1WP7 A;  1V55 B;  2XAH A;  3OT7 A;  5JH7 A;  5J2T A;  2WSS G;  4R8C A;  1K4C C;  4LNU B;  3KCX A;  4NTY A;  2CDY A;  4FFB A;  5KX5 B;  4U3J B;  3K9A A;  5KUK A;  5CB4 A;  2EUL A;  3VBB A;  2EIN C;  4YJ2 B;  2KQX A;  3JD3 A;  5JJN B;  3ABL B;  1AJQ A;  2L35 A;  3P32 A;  1LUV A;  3JAT A;  4R50 A;  3CC2 V;  4FZ1 A;  5H6Q A;  2OIG A;  1WNS A;  1H2K A;  1GM7 A;  1E1Q G;  3ABM C;  1A32 A;  1YJ9 V;  4I0X A;  5GON B;  3H9V A;  3OMN B;  4I7Z B;  1THZ A;  2QKS A;  3GVM A;  1NS1 A;  4A5U B;  4JV5 O;  4MVQ A;  2W0X A;  4JZ2 A;  3K58 A;  3SR2 C;  4PI0 A;  2ZDI A;  3QG5 A;  3FB8 C;  4HZ3 A;  5LP6 A;  3IJ4 A;  3RYI B;  4LFA O;  2HKO A;  4B3M O;  2XAS A;  4BAY A;  1OCC B;  4TV8 B;  1KMI Z;  1AI4 A;  3OTO B;  2AXT Z;  3L73 H;  2QE7 G;  2ZKO A;  4N23 A;  3ABU A;  3FYI B;  3DSQ A;  3ZHV A;  5D5P A;  4TUY A;  4I9Q A;  1OCO B;  3CEI A;  2P67 A;  4DV7 B;  4FVM A;  4J7Z A;  1H2N A;  2HG5 C;  4ZHQ B;  4I55 B;  4O4I A;  3D8C A;  3B77 A;  1HNX O;  1BQ0 A;  3G6B A;  1FAF A;  3L75 H;  2F66 C;  1NI8 A;  1E1R G;  1QLE C;  4JYC A;  4PV1 B;  4FK5 C;  2Q67 A;  5JQG B;  1KQS U;  3FKS G;  1R3L C;  5IY5 C;  1M9N A;  3L72 H;  4QPJ A;  2PF4 E;  3E35 A;  5J2U B;  2N74 A;  3SPI A;  2ZE7 A;  3CCQ V;  2F43 G;  1SER A;  3EHB B;  2E75 B;  2IM9 A;  1FFX A;  1PV0 A;  4ABM A;  1JQ0 A;  2RN9 A;  2UXX A;  1YI2 V;  3U0Z A;  2XAG A;  2RMK B;  4DR3 O;  1F51 A;  3BAA A;  3T4Z A;  4UCO A;  1W2B U;  1VQ6 V;  4G28 B;  3OAA G;  3H1I H;  4I4T B;  2HHH O;  3JAK B;  3NXS A;  1AP6 A;  1QVF U;  1IZ3 A;  1WP8 A;  1WB8 A;  1M57 B;  1JFF B;  1NU1 H;  2Y48 A;  4NXM O;  1D5N A;  2LW7 A;  3E86 A;  5B1B C;  2DW4 A;  2GUZ B;  5LXT A;  2KG7 B;  4NTW A;  3A0B Z;  3J7A U;  1M56 B;  4WFH A;  1T5E A;  3ASN B;  4WCE V;  1S0V A;  3UCS C;  4UVA A;  4B3S O;  4J7J A;  3LSS A;  3CD6 V;  3W7U A;  2Z0A A;  3OEE G;  1AJN A;  3JD1 A;  1DLB A;  3AG1 B;  2WLM A;  4U7O A;  1W0K G;  2ZQM A;  4KHP B;  5IDJ A;  1XI1 A;  4YHH O;  3CCU V;  1Q6U A;  1GN4 A;  5H9C A;  3IGA C;  3CC7 V;  1ZX3 A;  1SQV H;  4DV7 O;  2ZR3 A;  3MHH C;  2YEV B;  2OCC C;  2DYS B;  4X65 O;  3BA8 A;  4PDM A;  2R9R B;  1IBM B;  4B7E A;  2YI9 A;  5LOV B;  2Z5U A;  5L3F A;  1ORQ C;  1O9G A;  1KP2 A;  1I08 A;  3I55 V;  4WFG A;  4F4L A;  3AK1 A;  3HKC A;  2QM7 A;  2W0F C;  4I5S A;  2BCC H;  4JYY A;  2QWR B;  1ARO P;  4LF6 O;  3W7S A;  2F4V B;  1TUE B;  2GV9 A;  5C8Y A;  4NXN B;  3DTU B;  3RVZ A;  5LYJ B;  1QHT A;  1H2S B;  1YSC A;  1QLN A;  2ZR2 A;  1TGO A;  1B06 A;  2ITC C;  3WB1 A;  4FLV A;  3A0R A;  4ZOL B;  2Z3Y A;  4O4H A;  3PN1 A;  4GKJ O;  2GHY A;  1PL0 A;  4NKG B;  3SJB C;  5LGN A;  1YIJ V;  4GX5 A;  1FXK B;  1I94 B;  5EYP B;  1R1B A;  4RWU A;  2WLK A;  4QE7 A;  1Q3E A;  3Q4H B;  5BR8 B;  3QO5 A;  3C3T A;  1AJP A;  4HYO A;  3HKB B;  4QJF B;  5GW7 A;  2EIL C;  4RUE A;  3BVO A;  3SPG A;  3APQ A;  4F6R A;  4DW0 A;  2QSA A;  3LNM B;  4JI0 O;  1HDJ A;  3UO2 A;  1GKF A;  2V1D A;  4DYL A;  3H1H H;  1PNL A;  4GZR B;  1XMQ B;  3DXR A;  5JCO A;  2Q0A A;  3STL C;  1FXV A;  2JGU A;  1ENV A;  1OZ0 A;  2A9H A;  1Q8I A;  2JVD A;  4JTC B;  3R66 A;  4LFB B;  3OUF A;  1N8R W;  2B1G A;  2XTA A;  2EJR A;  2HP8 A;  4MTG A;  5DEC A;  4CS4 A;  4DR7 O;  5FPR A;  4YY3 B;  3K06 A;  1R6T A;  1BGY H;  1GAX A;  4JTA B;  3E22 B;  4DV6 B;  4YJ2 A;  2UXN A;  1WAZ A;  2FYU H;  2YID A;  4XDL A;  3JD4 A;  4UFZ A;  4FLY A;  3S3X A;  2PUS A;  2EIK B;  5H2F Z;  1CP9 A;  1QQC A;  2ILM A;  3ETD A;  3A2F A;  1Q82 W;  5EBW C;  2XND G;  1Y4M A;  1SA0 B;  2W6I G;  3W7W A;  4NYK A;  2QM4 A;  4UCU A;  4B08 A;  4TQD A;  1I7F A;  3ZED A;  2EIJ C;  2EJ7 A;  5J9P C;  5LBQ A;  3ZN1 A;  1XEQ A;  1VAR A;  2P6J A;  1Z2G A;  4DW1 A;  1CEZ A;  4ZIB A;  1R73 A;  1N32 B;  1IJG A;  5EZY B;  2ZD9 A;  4RQF A;  1I94 O;  4LFC B;  1CPY A;  3RYI A;  3O65 A;  1BZK A;  5BR8 O;  5IYZ B;  4EB6 B;  2OWO A;  4JI6 O;  4H33 A;  2ZDI C;  1GH6 A;  3UT5 B;  5LP6 C;  3T1Y O;  4JI2 O;  4K0K B;  2RDC A;  3G4S V;  2HJD A;  3SPC A;  3BA9 A;  2IJJ A;  3ZRX A;  4MS2 A;  3ZN0 A;  4GX0 A;  2DN9 A;  3JAR B;  1D2D A;  2YXY A;  2Q68 A;  2ADQ B;  4GX2 A;  2OTJ V;  2R70 A;  4LFB O;  1ZLZ A;  3F7V C;  4B3R O;  4CH6 A;  3CS5 A;  4YY3 O;  3E89 A;  1MG1 A;  5LA6 B;  4X20 B;  5J2U A;  5D5Q A;  4DV6 O;  1K73 W;  1KC8 W;  1WJZ A;  1TUB B;  1NVP D;  4E4E A;  1WLE A;  2XT9 A;  3H01 A;  3MAQ A;  2UXD B;  1PNM A;  4JAA A;  3QVN A;  1NZ6 A;  2A79 B;  1BQZ A;  1VQL V;  1R3K C;  2IU0 A;  3ZBH A;  3WG7 C;  2XAF A;  1JFF A;  3RYC B;  3QO8 A;  4DR6 B;  2LGQ A;  1R6K A;  4UCT A;  2HR3 A;  4LWS B;  5KHG A;  3CC4 V;  4I50 B;  3DC6 A;  3HKE B;  1N32 O;  5KMG B;  1IXB A;  3G6E V;  4LFC O;  3E8H A;  4UVB A;  4KL1 A;  4MVO A;  2JJ2 G;  5CA0 B;  3CXH F;  4B7K A;  5KA5 A;  3TGU H;  1BL8 A;  4PD4 F;  4LF4 B;  2N04 A;  1MSD A;  4FZ0 A;  3FAV B;  1XMO O;  2EIN B;  1HW7 A;  2RCV A;  4PEL A;  5B3S C;  1VIB A;  2WLJ A;  2YC0 A;  2LP7 A;  3STZ C;  3ZMV A;  2HEP A;  1QCE A;  1P4R A;  2VQF B;  1YTF B;  1ZL8 A;  3OMA B;  4X88 A;  2BOC C;  4DV2 B;  1J95 A;  4DRX A;  2IH3 C;  3ABM B;  2IJK A;  1V54 C;  1Z5W A;  3AG2 C;  3PJS K;  3AG7 A;  3JAM N;  5CBG A;  2PZS A;  1GN2 A;  4IIJ B;  1B6Q A;  3BFR A;  4JI7 B;  1V9P A;  1VQ5 V;  3THO A;  4CH5 A; 
#chains in the Genus database with same CATH homology
 4JYY A;  5AG2 A;  1AP5 A;  3EVK A;  3AK3 A;  3RN4 A;  1BT8 A;  1EN6 A;  1EN5 A;  1PM9 A;  4E4E A;  1GN3 A;  1LUV A;  3AK2 A;  3C3S A;  1VEW A;  1N0N A;  3TJT A;  3QVN A;  1B06 A;  1EM1 A;  1P7G A;  1PL4 A;  1ZUQ A;  1AR5 A;  2P4K A;  1BS3 A;  1MNG A;  2QKA A;  1AP6 A;  1BSM A;  1WB8 A;  1VAR A;  1D5N A;  3MDS A;  1KKC A;  4JZ2 A;  3KKY A;  4YIP A;  1JA8 A;  1GN6 A;  3DC6 A;  3K9S A;  2CE4 A;  4GUN A;  1IXB A;  1EN4 A;  4BR6 A;  3C3T A;  2ADP A;  1ZTE A;  1WB7 A;  4JZG A;  1MSD A;  1Y67 A;  1ZSP A;  1N0J A;  4FFK A;  1LUW A;  2RCV A;  1AR4 A;  5A9G A;  1IX9 A;  2GDS A;  3DC5 A;  3KDR A;  3CEI A;  2QKC A;  1SZX A;  1GN4 A;  4YIO A;  1XUQ A;  4C7U A;  1I0H A;  3LSU A;  1XRE A;  1IDS A;  1MA1 A;  3IC9 A;  1MMM A;  3OT7 A;  2ADQ B;  1XIL A;  1XDC A;  1ZLZ A;  1GN2 A;  4F6E A;  2CDY A;  3BFR A;  1AVM A;  4X9Q A;  1QNM A;  1I08 A;  1JR9 A;  3AK1 A;  2AW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...