1EN6A

Crystal structure analysis of the e. coli manganese superoxide dismutase q146l mutant
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
205
structure length
205
Chain Sequence
SYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITKLDQLPADKKTVLRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDNFKAEFEKAAASRFGSGWAWLVLKGDKLAVVSTANLDSPLMGEAISGASGFPIMGLDVWEHAYYLKFQNRRPDYIKEFWNVVNWDEAAARFAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords MANGANESE SUPEROXIDE DISMUTASE
publication title Outer sphere mutations perturb metal reactivity in manganese superoxide dismutase.
pubmed doi rcsb
source organism Escherichia coli
total genus 69
structure length 205
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2000-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 1en6A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 1en6A02
3LSUA 4E4EA 1AR4A 4JYYA 1PM9A 2AW9A 1JA8A 4YIPA 3AK2A 2CE4A 1BSMA 4JZGA 1N0NA 4F6EA 1SZXA 1Y67A 3MDSA 2ADPA 3DC6A 1XDCA 1D5NA 2RCVA 3RN4A 3IC9A 3TJTA 1GN6A 1GN2A 1QNMA 1AP6A 1AP5A 2QKAA 1XREA 2GDSA 1EN4A 4JZ2A 1GN4A 5AG2A 4BR6A 1IDSA 4YIOA 1LUWA 1XILA 2QKCA 1IX9A 3BFRA 1MNGA 1AR5A 3KKYA 1VARA 1EM1A 3OT7A 2P4KA 5A9GA 1ZSPA 1I08A 1IXBA 1PL4A 1JR9A 1AVMA 1ZUQA 1EN5A 3C3TA 3EVKA 3C3SA 1BS3A 1WB8A 1MSDA 1N0JA 1XUQA 1GN3A 2CDYA 4GUNA 1ZTEA 1LUVA 3DC5A 1B06A 1EN6A 1MA1A 4C7UA 1I0HA 3CEIA 1ZLZA 1WB7A 1P7GA 3AK1A 2ADQB 3K9SA 1BT8A 1KKCA 3QVNA 4X9QA 3AK3A 1VEWA 4FFKA 1MMMA
chains in the Genus database with same CATH superfamily
1N34B 1YI2V 1XQ8A 1PM9A 2X6CA 2B9ZA 4LF6O 1GH6A 3ZMTA 2ZE6A 1WAZA 2A0LA 5J2TA 2E5LO 1Q82W 2JIZG 2P22C 3A2FA 2DN9A 2QGNA 4RUEA 2DW4A 5JVDB 2LGQA 1EFRG 3MDSA 5D5QA 5IJ0A 1I5XA 3B8NA 1KP3A 5ITZB 1MSWD 1M4UA 3AG3C 5KMGA 2HG5C 2IU0A 1XHXA 3FB8C 1NU1H 5CA0A 3KCXA 1QLNA 3IAYA 1HWYA 1AP6A 1URFA 2HHHO 3BA8A 2PYJA 4YJ3A 1OCZB 3SYPA 4LFCB 3WU2Z 4I7ZB 4TSFG 1Q7YW 5IY5C 1VQ6V 4TV9B 1LUWA 2A9HA 4K35A 2JJ1G 3T1HO 1QR8A 3STZC 2YUAA 1BQ0A 1KD1W 2UXCB 4J10A 3LDCA 3K79A 5LMNO 2PI4A 1JJOA 1IXBA 4FM1A 2Y0PA 3FAVA 2PUSA 5LGNA 2WLKA 1FKAO 2L6LA 4LR3A 3STLC 5JJEB 1TA8A 2ODMA 4FM0A 1JFFB 4LNUB 1Y6XA 3OUFA 3K58A 1KC8W 1FS0G 3AG1C 3CSXA 3F5TA 1O9GA 3UQ8A 4G28B 4X65O 4NVPA 4GUNA 1LUVA 3BHPA 2VWJA 2ZDIA 2IJKA 3RGBA 4FLVA 3CEIA 1IBKB 1R3JC 3AK1A 4JI1B 3K5OA 3D36C 4ZOLA 3OEEG 1L0LH 4MVQA 4MTGA 2XAHA 3ASNB 3TETA 1AR4A 1W0KG 1WN7A 1V55B 2UUBO 1S3JA 3H1KH 2IJIA 2UXBB 1M57B 1SZTA 4NXNO 3CMEV 2X0LA 4LH6A 5DM6V 1NZ6A 1YITV 1NI8A 2FYUH 3T1YO 5ITZA 3K08A 1ZAUA 1CEZA 1Q90D 3I55V 1ZX3A 1XDCA 1D5NA 5EZYB 1NR1A 4DR5B 4LBEC 3E22A 1GK9A 1P7BA 1Q6UA 2QM4A 3VQWA 1R6TA 3IJ4A 2QDOA 1VQ9V 3ABMC 4HNAB 1PNKA 3CWBH 1XI1A 2F95B 2PI5A 4PI0A 1ZWIC 1PNMA 5L3GA 3O9OA 4CC5A 1QQCA 4U3FH 4TV9A 3A0BZ 1GM8A 1IDSA 4EB6A 2VQFB 2RMKB 4MT8A 1YDXA 1H2GA 5KAIZ 2LP7A 3RBZA 2WLMA 3CC2V 2LQTA 1COWG 2GUZB 2NN4A 1MZEA 5F2VO 1I08A 1K34A 5H6QA 1D5AA 5CA1B 2AHZA 4LNUA 4I9QA 1EN5A 2UXDB 3HKDB 2QTOA 4OPAA 4WBNB 5J2UB 5LHHA 3SJBC 4HAMA 1AROP 1WB8A 1XNRB 3KDRA 5K1PA 2YIBA 2OYQA 2M7WA 2ILMA 4N23A 2OCHA 4DR3O 3CD6V 4B3SB 1K97A 4H44B 4DV4B 2BTQA 3KG2A 3ABTA 2LFRA 4AQYO 4QNHB 1G1XB 3ZJZA 1SQPH 1Q6IA 1S77D 3GWKC 4UFZA 2XAGA 4KHPB 1HNXO 4U3JA 1YTFB 2ARHA 3HKCB 2F1MA 3QG5A 4W4KA 4LF4B 1YJWV 5IYDO 1SZXA 1Y67A 1NJIW 1R6NA 1B3QA 5KHHA 3VQVA 3VOUA 4JI5O 3RWRD 2VWKA 1WP8A 5LA6B 4JI6B 1GMGA 1NBMG 3NR7A 3ABLC 2CTWA 2XAFA 3A8TA 3AG2C 1N36O 2W0XA 1SKVA 1JNBA 4JI3O 5A2QN 2QWOB 4DO2A 1KBHA 3K9AA 1OZ0A 3RT3C 4DV3B 5EBMC 4CZZA 2Q6AA 1K9MW 2QJ1A 2VRZA 3FFQA 1N33B 4H37A 1W0JG 1R3IC 4IGGA 1MSDA 4I0XA 5FNVB 2OIEA 4DV2O 4J7KA 4XDLA 2HVKC 4J9YB 3UCSC 1B06A 2V7QG 3SDLA 3VQYA 2JK5C 1PD3A 4YY3O 4JV5B 4YHHO 1IXMA 2PGGA 4GKKO 4D7SA 4TT3G 4WFFA 1JOYA 1B04A 4QPKA 2EIMB 1KMIZ 3AEIA 2QA4V 3CX5F 4JI4O 3HKCA 4AHCA 1BL8A 3HPLC 3ZN1A 2IJJA 1EZJA 3JAWA 2CE4A 1Y66A 4G2KA 4XBFA 5JH7B 3P3NA 3ZS8C 5BMVA 4JI2B 3L71H 2QTSA 1R73A 2X6AA 4RWUA 3TGUH 5KX5A 4LF5B 5CBFA 1N32B 1Q6HA 2Q68A 1K33A 1Y4MA 3NXSA 4JAUA 5BZBA 1OCCB 3CJHA 1PNLA 3BCCH 1VMGA 3T2MA 2QWQB 1KYOF 4ICGA 5AG2A 3CCUV 1VF6C 1CP9A 4I5SA 1SF9A 5LP6B 3JD3A 4JI7O 2H8PC 4J9ZB 1AJNA 2ZIMA 3UO3A 1QR9A 1Q3EA 3HKBB 3KZIZ 3WG7B 1LNQA 4JPRA 2R9RB 3Q4HA 2H94A 4PHZA 3CCRV 1AB3A 2EZOA 2EZPA 4EFBA 4PELA 3L9DA 2YEVB 4WF9V 1M93A 3BY6A 3N2KA 4H0LB 5JQGA 1RM1C 1FD9A 2AZ0A 4TQFA 1CXZB 2A79B 4XDJA 3ZHSA 2XAQA 3A0RA 3RYFA 5EYPB 1DF5A 5IWAO 4RO2A 2XAJA 2C2AA 1H8EG 1GKFA 1UFIA 4HYOA 2HP8A 3QVNA 4JTAB 3CYOA 3L72H 3RFRA 5LMUO 2ZIOA 5IDJA 1JCHA 3ETQA 4UB6Z 3WFVA 4J41A 2KKWA 3K04A 4ZIBA 1N8RW 3ICXA 1HR0O 3C90A 4R50A 4DR7O 1XEQA 2HVJC 1F51A 2ADPA 2YICA 2D2CB 3W7XA 3CCQV 3SPIA 4MS2A 1VP7A 3G6BA 4L87A 1JJ2U 2Q4PA 1GN6A 2JRIA 5CBHA 4KUMA 1SQFA 1WA8A 4GKJO 3QF7A 3MD0A 5J2TB 1A32A 1EN4A 2KSDA 1Y76A 1PL0A 2ITCC 4RQEA 4Q6GA 4UB8Z 1NS1A 3ABKC 3E83A 3TCUA 2DWEC 4TWKA 4DK0A 1IBLB 1NTKH 5IJ0B 5B5EZ 1HNWB 3B8MA 4ASUG 1VARA 3QTCA 4CS4A 2QM8A 4QJFB 5FL7G 2CTPA 3D36A 4DV7O 1Q43A 4W4LA 1SQGA 5CA0B 2YEVA 4DR1B 1RSOA 2UUAO 1FXHA 4HBNA 3H1HH 1AVMA 4JI0O 1YJ9V 1G4YB 5GTIZ 4YJ3B 4AILC 3KCYA 4JASA 4PDMA 4X66O 1TUBA 5FPRA 3OTOB 1KB9F 3QNEA 2ZXWC 5FLXN 4KP4A 2EIJC 2N74A 3K0DA 5KA6A 4JYBA 1SQVH 1R6KA 4O2AA 4PA3A 5IYZA 4TV8B 2EIKB 3SYCA 1SS3A 4B3RO 4GX1A 2UUCB 3ZN0A 3CS5A 4HZ3A 4LF9B 4B08A 2VQEB 4LF8B 1WJZA 2N05A 3FAVB 3M8AA 5EBWC 4I4TA 2F43G 3FB5C 3CRAA 4YIPA 3J80N 4JYAB 3B40A 5LBQA 4WFEA 1OCRB 3N2GA 4F6EA 4LFAB 2ZNIA 4NTXA 3AG4C 3K5LA 4E2LA 3RYCB 3OGCC 4ZOLB 1S5LZ 2UU9O 1I94O 2F66C 4UCOA 1BE3H 1DGSA 2EX3A 4UV8A 1YF2A 3RYHA 2B1GA 1AP5A 2Y4UA 3H9VA 3X2QC 1FJGB 1K5SA 5CA3A 1K4DC 3BRCA 4X1YA 2ATKC 2DYRC 4MVUA 4LWSA 2OTJV 3ETDA 1IX9A 4UV9A 4U7OA 4P30A 3J7AU 1VQMV 3K5MA 1E1QG 1M9NA 3BABA 3E22B 1BMFG 1XMQO 3CXCU 4PA7A 3J81N 3G80A 1AJQA 1SRYA 4B7KA 1IZ3A 3H1JH 5FPOA 2DMXA 3ASOC 1HNZO 4P9OA 4X64B 1N0JA 3OR6C 2CH7B 1LR1A 4EB6B 3OMNB 5KHIA 2WAMA 4TV8A 3FD9A 3JSLA 4WFGA 4PA4A 5IJ9B 4FZ1A 1FXVA 4X9QA 4DR2O 1JPXA 1NH2B 5EK0A 2BE3A 3N27A 2WLJA 3SPJA 4NXMB 1GAXA 4IL6Z 3JSNA 3JAKA 4JYYA 4DW1A 3CRRA 4UVAA 3CRCA 4P9PA 2QWNB 2QSAA 3CMAV 2VS0A 3PN1A 3GB7C 4X88A 2G38A 2OCCB 2DJVA 1IJGA 1J5EB 1K92A 3RYCA 3W7UA 1IBMB 4F6RB 3RW0A 4EKWA 1XL6A 1V54C 4CS3A 2RCVA 2BTQB 2LW1A 1SQBH 2IM9A 1GN2A 3VBBA 3ZMVA 2EILB 4TUYA 4EEQA 1H2KA 1OCOC 2W6JG 1XMOO 1PPJH 1VF5B 4U3JB 5JCOC 4K3AA 4B3TO 4DV5O 3W7SA 4JI8O 1K7DA 1R1BA 2GBOA 5BY1A 1NR7A 1YTFD 2HR3A 2XUMA 3CCMV 2XTAA 4DV6O 2Q5ZA 3GVMA 5B1AB 5K1XA 1E79G 5H2FZ 1ZUQA 2CH7A 2X6BA 2KB1A 5EC1C 1GN3A 4FLWA 4PJ0Z 3E35A 1BZKA 2CK3G 5IJ9A 5KUKA 1TGOA 1AJPA 1B6QA 2ZNJA 1SERA 1RP3B 4K0KO 2DQ0A 4MVMA 1SQXH 4QGPA 4B3MO 1W2BU 1M56B 2F4VB 5LGTA 2HJDA 5B3SB 2ZM6B 3OM3B 2WLIA 3WB0A 4J42A 4R6ZA 4UCUA 4I0XB 3CC4V 3AK2A 4DUYB 4I55A 4N21A 1VF6A 3CB2A 4F6RA 4OX9B 2JGDA 4X1IA 4FLTA 5B66Z 2EULA 4UXNA 1QLEB 3LDEA 4QIWF 2GTSA 1WPXA 3B2EE 2CUGA 5IYCO 3E8BA 4BW5A 3R66A 2LO1A 5LYJA 3OAAG 1XREA 4GX0A 4ZHQA 3JAWB 3OFNG 4MVOA 1M90W 1O9HA 5GONA 2DYSB 2ZXWB 5BMVB 4DV1O 4GZRB 4X62B 3K06A 4LFBO 4YJ2A 5C8YA 3BEHA 4Z2WA 5KX5B 1F4NA 3KKYA 1P4RA 1YEWA 4DR6O 2FKXA 3OT7A 2ZINA 1X4TA 5CB4A 3CCJV 5LOVA 1AR1B 3E8FA 1VQ8V 2CGOA 2KQXA 1XOUA 1P49A 4DV0O 3ML0A 3CJHB 1NKDA 5BR8O 1TVKA 1BS3A 2CTRA 2NLJC 3OD4A 1S72V 2OIGA 3BVOA 1Q5OA 1XNQO 2QR4A 3ABUA 4FFBA 1GM9A 4CH6A 3FYIB 1CPYA 1WB7A 1P7GA 2V1DA 4LF7B 3A0HZ 1AI4A 1N4CA 2R70A 3AG4B 1NTMH 2WLLA 4DR4O 5B1BC 3FKSG 3Q4HB 4DUZO 4O4JA 3SR2C 4A5UB 4J7JA 1TUEB 3B77A 1N34O 4LF6B 1M1KW 2AW9A 1JA8A 1WPBA 3N2KB 2E5LB 5DEDA 3ZEDA 2L35A 5JQGB 2RJZA 5KAFZ 3UM7A 5JWPA 2P5OA 3RYFB 3DGEA 2YIAA 2ZR2A 3JYCA 1K4CC 2P67A 4GLXA 3AG3B 3SPHA 3JD2A 1MG1A 2IW5A 2X7RB 2N04A 2KG7A 4WFAV 2Q69A 4MW3A 3RYIA 2HHHB 2ZD9A 4Q20A 4UCVA 1SQQH 1OCZC 2NNUA 1AILA 4NB5A 1M5IA 3T1CA 4LFCO 1R3KC 3FB7C 1SC5B 4FPPA 4PDRA 4JF3A 4YIOA 5IY5B 3ZCCA 3T1HB 2P7TC 1HW7A 1MNGA 5LXTA 1XHZA 2QM7A 5LMNB 3ZRXA 2UXCO 2R9AA 5A9GA 3ETGA 2CTQA 3P3PA 4JTDB 5GTHZ 3JASA 1VQ5V 1J95A 3LSSA 2ITDC 3CP1A 2YXYA 4I50A 4UCRA 4O4IB 1WA8B 2K1EA 3AG1B 5GW7A 1Y76B 4PA9A 3WB2A 4XDKA 3QO5A 4X65B 2PZSA 4LH7A 1RPRA 3B09A 2Y69C 5L3DA 4ZI7B 4C7UA 1ZLZA 3CC7V 1IBKO 1EBOA 5TISZ 1RPOA 4JI1O 2AGAA 3OUSA 1JQ0A 1VEWA 2XT9A 3IC7A 1RSOB 2BTOA 3LNMB 3HB3B 1P84F 3ASNC 5CN0A 2UUBB 1V55C 3OMAB 1TUBB 4NXNB 4J7ZA 1YCIA 3DXRA 1K8AW 2UXBO 1Q86W 1M57C 1ROPA 2B5UA 2K9PA 2Q9LA 4K8ZA 3BAAA 4TQDA 1OCOB 3T1YB 1MZFA 4UVCA 2P90A 4O2AB 5IYZB 3JATA 2OTLV 1US6A 4CH5A 2YXLA 1VQ4V 4NTWA 2JVDA 4DR5O 2Q7HA 1SESA 3ABMB 3IC9A 3L73H 1FAFA 4I4TB 3R65A 4DW0A 4JZ2A 2ZKOA 2M6YA 2BSKA 2VQFO 3N2GB 1XILA 1UJWB 1FXKC 3BFRA 3WB1A 2E3CA 4FK5C 1QCEA 1TAEA 3D3IA 2XNDG 4PD4F 3L75H 2YIDA 2ZQMA 4O4IA 1YVWA 3RYHB 4NTYA 3ZMUA 1YIJV 4UCSA 4WFHA 2UXDO 1ENVA 2RNBA 1GTOA 3ETEA 1XUQA 1XNRO 4X1YB 2ZE7A 4ZI7A 4LWSB 2BOCC 2H3OA 1U97A 4DR3B 1ZL8A 5E79Z 3JARA 3JD1A 4O4HA 4B3SO 1YZBA 3UO2A 4DV4O 2EJRA 3OGIB 4AQYB 4OGQB 1VQPV 1T5EA 2AXTZ 2W6IG 4FVMA 4X20A 3G71V 1HNXB 3ZRSA 5JCOA 4KHPO 3JALA 2JEXA 4KFMA 1N0NA 4YXWG 2RN9A 2ZE8A 3TXQA 4LF4O 1H2MA 1PV0A 2HJFC 2OT5A 3RN4A 4IHJA 2Q8VA 1BHAA 2JJ2G 3O65A 3EHBB 4Z1MG 4JI5B 4FM2A 2BOBC 2ZT9B 4G27B 1NQTA 3JAKB 5KHJA 3JAMN 4WCEV 4JI6O 3ABLB 1NH2D 2WWWA 1Z2GA 3AG2B 1N36B 4BW9A 1YSCA 3BA9A 4JI3B 4MVSA 1PKXA 4NR1A 4IIJA 2YIBD 2AHYA 1S76D 1L8DA 3APOA 3CCVV 4OPHA 3E89A 4DV3O 3IGAC 4TUYB 1X59A 3S3XA 4U7NA 2EBOA 4L8JA 4PV1B 4MTOA 1OV9A 3GWOA 3OTFA 4PDLA 1N33O 3D3QA 1U96A 4DV2B 4RAIA 2O57A 3DSQA 4QE9A 2A3QA 1MA1A 1WP7A 4YY3B 4J11A 2ADQB 1BT8A 3UT5A 4YHHB 1RFYA 4JV5O 4CH3A 1NVPB 4GKKB 1I5YA 4KXRA 1MMMA 4UUJC 3CCEV 4GCZA 2GSMB 1Q8IA 2FMLA 4LP8A 5LHGA 4JI4B 2EIMC 1Y74B 4GX5A 4JYCA 2YSUB 5KA5A 2Y48A 4DYLA 5L3FA 1KQSU 2UXXA 4JI2O 4ABMA 3ZHUA 4DRXA 4LF5O 3RVYA 3E8GA 1N32O 3CCSV 2D3OW 3CHXA 3I56V 1AI5A 2WLIB 2YI9A 2QKAA 1OCCC 2ETNA 1F4MA 5CMUA 2Z0AA 4JAAA 2DOSA 3TK1A 4WFBV 4LCUC 1KKDA 4I55B 2F23A 2ZCEA 3THOA 2JGDB 4JI7B 4X1IB 4UCTA 5LP6C 3F7VC 1EM1A 2Y69B 1VQLV 3W7WA 4F4LA 1MABG 1S5HC 3WG7C 1I7FA 3CCLV 3LSQA 3MHHC 1D2DA 3LNNA 2B1IA 3ZRWA 1QHTA 5LYJB 1BQZA 3C3TA 1GM7A 4FJCC 4ZHQB 1RM1B 2E76B 3SPGA 1H5WA 3ZHTA 1L0NH 2JS5A 5GONB 1R3LC 2EJ7A 4B7EA 5EIBD 3M99B 1VQKV 5L3CA 4R8CA 5JVDA 1ZTEA 2IJHA 4R7CA 4YJ2B 5C8YB 1EN6A 2HLDG 3G67A 5IWAB 3UKMA 3T4DA 5CB4B 5LOVB 2CGNA 5LMUB 2WLHA 4AI8A 3LDDA 3AG7A 4FZ0A 2IBZH 3K5NA 4K8XA 1Y74A 4E4EA 1JX9A 3DTUB 4JAVA 2YXHA 1TVKB 1HR0B 5DECA 1SA0B 2HFEC 4H33A 2IH1C 3D8CA 2JDIG 4IYIA 4NYKA 4DR7B 4FFBB 2EINC 1H2SB 3ZHRA 1AI7A 2ZE5A 1W59A 2IH3C 2MW2B 3SGIA 1FXKB 3E8HA 2WLLB 1G6UA 4O4LB 3SJQC 4O4JB 1QNMA 1F7YA 3FYEB 3ZBHA 2CAZC 2IU3A 2Q67A 2GDSA 4GKJB 3JD0A 1H2LA 1JFFA 2JGUA 1GN4A 4OXSA 1AI6A 3SYAA 3ABKB 1GO3F 1ORQC 2QKCA 1IBLO 3JD4A 3K3WA 4LC1A 2P06A 4QPJA 1IVSA 1VQNV 3P30A 1HNWO 3PJSK 3ZIAG 4DV7B 3U0ZA 2UUAB 2KG7B 4FLZA 3JCZA 4DR1O 1HDJA 2DE0X 1PL4A 4JI0B 5KHGA 1YXBA 4CBCA 3RYIB 4GX2A 2UXNA 2V4DA 3C3SA 4X66B 1YHQV 2HEPA 2EIJB 3OTOO 2XASA 1DTOA 4MTXA 2AZ2A 1MOFA 2GV9A 3TXSA 4NKGB 5IT9N 1S0VA 3LUTB 4FLYA 2BCCH 5LXTB 4JGSA 2MK3A 5HFMA 4B3RB 2EIKC 5IE9A 2QE7G 3OW2U 2NR5A 5EZYA 5IYBO 4J80A 2UUCO 4LF9O 2VQEO 3S3WA 2PYLA 4LF8O 3JASB 5JJJB 1IURA 3B4SA 1SA0A 1KUQA 4HNAA 5B1NA 4I50B 1GRJA 1VQ7V 4GYCB 1OJHA 2WPDG 2JEUA 2YI8A 5HFLA 2Q0AA 4JYAO 1BSMA 4JZGA 5LHIA 1FPOA 1OCRC 1FXKA 2XOKG 2ZDIC 4LFAO 3OMIB 4ZBMA 3ZHQA 3HKEB 4I9WA 4O4LA 2WA3A 2GUZA 1QU7A 2UU9B 3OE7G 1I94B 3FX7A 5CA1A 3TJTA 5D5PA 1XL4A 1K3EA 3JCUZ 3P32A 3X2QB 4BWAA 3ZRVA 2A06H 2QEXV 3H01A 3HKDA 1FJGO 3DXRB 4WBNA 5J2UA 4MVZA 1NT2B 4BIOA 2DYRB 4CC6A 4MSWC 5LGUA 3E86A 5H5NA 1QVFU 3MHSC 2GHYA 1WLEA 3JATB 4IT5A 3ZHVA 3L74H 5B1OA 4D7TA 5H6RA 3ZMZA 1XMQB 1PP9H 1VQOV 5J9PC 2P6JA 4KL1A 4P2ZA 2YDEA 3F7YC 2PY5A 2Y4TA 4CH4A 3ASOB 3CRMA 1H38A 1HNZB 3T4ZA 3ZX6A 1H2NA 3EFFK 1Z5VA 2PF4E 4X64O 3K0GA 2BSKB 3APQA 2OWOA 1DK1A 3IFXA 3U11A 1I0HA 4O2BB 3K9SA 1UPGA 1BCCH 1Q81W 4DR2B 2GTAA 3AK3A 1XBLA 3OR7C 4GT1A 2Q0OC 2YS8A 3L70H 4NXMO 3LSUA 3I5DA 3EXAA 2XHBA 5LA6A 2Q7EA 5EC2C 4FIPC 1V9PA 3HKEA 2OCCC 4BIUA 5E1AC 5KHKA 1J5EO 4FLUA 3W7TA 1EZVH 4MVRA 1THZA 1ZL8B 5L3BA 3JARB 1IBMO 3DC6A 3G4SV 1V54B 3K03A 4O4HB 1G8MA 3QO8A 4X8AA 2FL4A 1F23A 3BPZA 2EILC 2YC0A 4X20B 3SYOA 1XMOB 4RQFA 2LFSA 3CPWU 1NTZH 2ZR3A 4X1KB 5FNVA 1SETA 3JALB 4B3TB 4DV5B 4JI8B 2F93B 2Z3YA 4BAYA 2LW7A 4RUFA 4X89A 2P4KA 5L3EA 4IYHA 4IHJB 4CS2A 4DV6B 1L1FA 3M7MX 4JTCB 3MAQA 5B1AC 4PI2A 5DN6G 2QKSA 3EVKA 2PTMA 1FFXB 2DWDC 4FLXA 2P4VA 1VIBA 3CRQA 5JH7A 3ZMSA 3OEHG 1H8HG 1KECA 2E74B 2LGWA 4O2BA 3DC5A 3FB6C 2EINB 4MW8A 2W0FC 4PA6A 4K0KB 4TOIA 3U10A 1JMKC 4QE7A 4IIJB 2HKOA 1Z5WA 1E1RG 4B3MB 2Z5UA 1FFTB 4FFKA 1M56C 2JS3A 3H1IH 5KUMA 2F4VO 5B3SC 2ZM6O 4ZKIA 3CE2A 5JJNB 3QO7A 4FMTA 3F5WC 2WSSG 4DUYO 1KU9A 1QBZA 5CBGA 4D6TH 2RQ6A 4OX9O 3VQXA 5LP6A 3UT5B 3HKBA 4MTFA 1QLEC 4UVBA 1BHBA 1YJNV 5KMGB 2R72A 5EIBC 4X1KA 1DF4A 3CXHF 1NVPD 3RVZA 1QVGU 3SYQA 1DLBA 4DV1B 4BR6A 2FB5A 2QWRB 2WLNA 2DYSC 4LFBB 2QWPB 2LJ2A 2RDCA 4X62O 4DRXB 4DXWA 1AR5A 5EYPA 3SJAC 2Y0IA 4DR6B 3HR0A 4PDVA 3SJCC 1ZSPA 2Q7GA 4EFEA 4DV0B 4BIZA 5BR8B 1BGYH 1JVMA 1JR9A 1FFXA 3G6EV 5C93A 5BXZA 2FTKA 1KP2A 4Z1VA 1FOUA 2R9IA 1XNQB 2DQ3A 2CDYA 1HP8A 5H9CA 1K5QA 1WNSA 1VF7A 2A7WA 3K57A 5LL6Y 1S5JA 3H1LH 1K73W 3K59A 4DK1A 4H13B 1KKCA 4LF7O 5EBLC 3E2EA 4DR4B 5B1BB 2Q73A 5KLVH 2E75B 4DUZB 3ZRWB 1OHHG 3SPCA 1FYJA 2WA4A
chains in the Genus database with same CATH topology
3LSUA 4E4EA 1AR4A 4JYYA 1PM9A 2AW9A 1JA8A 4YIPA 3AK2A 2CE4A 1BSMA 4JZGA 1N0NA 4F6EA 1SZXA 1Y67A 3MDSA 2ADPA 3DC6A 1XDCA 1D5NA 2RCVA 3RN4A 3IC9A 3TJTA 1GN6A 1GN2A 1QNMA 1AP6A 1AP5A 2QKAA 1XREA 2GDSA 1EN4A 4JZ2A 1GN4A 5AG2A 4BR6A 1IDSA 4YIOA 1LUWA 1XILA 2QKCA 1IX9A 3BFRA 1MNGA 1AR5A 3KKYA 1VARA 1EM1A 3OT7A 2P4KA 5A9GA 1ZSPA 1I08A 1IXBA 1PL4A 1JR9A 1AVMA 1ZUQA 1EN5A 3C3TA 3EVKA 3C3SA 1BS3A 1WB8A 3KDRA 1MSDA 1N0JA 1XUQA 1GN3A 2CDYA 4GUNA 1ZTEA 1LUVA 3DC5A 1B06A 1EN6A 1MA1A 4C7UA 1I0HA 3CEIA 1ZLZA 1WB7A 1P7GA 3AK1A 2ADQB 3K9SA 1BT8A 1KKCA 3QVNA 4X9QA 3AK3A 1VEWA 4FFKA 1MMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSU A;  4E4E A;  1AR4 A;  4JYY A;  1PM9 A;  2AW9 A;  1JA8 A;  4YIP A;  3AK2 A;  2CE4 A;  1BSM A;  4JZG A;  1N0N A;  4F6E A;  1SZX A;  1Y67 A;  3MDS A;  2ADP A;  3DC6 A;  1XDC A;  1D5N A;  2RCV A;  3RN4 A;  3IC9 A;  3TJT A;  1GN6 A;  1GN2 A;  1QNM A;  1AP6 A;  1AP5 A;  2QKA A;  1XRE A;  2GDS A;  1EN4 A;  4JZ2 A;  1GN4 A;  5AG2 A;  4BR6 A;  1IDS A;  4YIO A;  1LUW A;  1XIL A;  2QKC A;  1IX9 A;  3BFR A;  1MNG A;  1AR5 A;  3KKY A;  1VAR A;  1EM1 A;  3OT7 A;  2P4K A;  5A9G A;  1ZSP A;  1I08 A;  1IXB A;  1PL4 A;  1JR9 A;  1AVM A;  1ZUQ A;  1EN5 A;  3C3T A;  3EVK A;  3C3S A;  1BS3 A;  1WB8 A;  1MSD A;  1N0J A;  1XUQ A;  1GN3 A;  2CDY A;  4GUN A;  1ZTE A;  1LUV A;  3DC5 A;  1B06 A;  1EN6 A;  1MA1 A;  4C7U A;  1I0H A;  3CEI A;  1ZLZ A;  1WB7 A;  1P7G A;  3AK1 A;  2ADQ B;  3K9S A;  1BT8 A;  1KKC A;  3QVN A;  4X9Q A;  3AK3 A;  1VEW A;  4FFK A;  1MMM A; 
#chains in the Genus database with same CATH topology
 1N34 B;  1YI2 V;  1XQ8 A;  1PM9 A;  2X6C A;  2B9Z A;  4LF6 O;  1GH6 A;  3ZMT A;  2ZE6 A;  1WAZ A;  2A0L A;  5J2T A;  2E5L O;  1Q82 W;  2JIZ G;  2P22 C;  3A2F A;  2DN9 A;  2QGN A;  4RUE A;  2DW4 A;  5JVD B;  2LGQ A;  1EFR G;  3MDS A;  5D5Q A;  5IJ0 A;  1I5X A;  3B8N A;  1KP3 A;  5ITZ B;  1MSW D;  1M4U A;  3AG3 C;  5KMG A;  2HG5 C;  2IU0 A;  1XHX A;  3FB8 C;  1NU1 H;  5CA0 A;  3KCX A;  1QLN A;  3IAY A;  1HWY A;  1AP6 A;  1URF A;  2HHH O;  3BA8 A;  2PYJ A;  4YJ3 A;  1OCZ B;  3SYP A;  4LFC B;  3WU2 Z;  4I7Z B;  4TSF G;  1Q7Y W;  5IY5 C;  1VQ6 V;  4TV9 B;  1LUW A;  2A9H A;  4K35 A;  2JJ1 G;  3T1H O;  1QR8 A;  3STZ C;  2YUA A;  1BQ0 A;  1KD1 W;  2UXC B;  4J10 A;  3LDC A;  3K79 A;  5LMN O;  2PI4 A;  1JJO A;  1IXB A;  4FM1 A;  2Y0P A;  3FAV A;  2PUS A;  5LGN A;  2WLK A;  1FKA O;  2L6L A;  4LR3 A;  3STL C;  5JJE B;  1TA8 A;  2ODM A;  4FM0 A;  1JFF B;  4LNU B;  1Y6X A;  3OUF A;  3K58 A;  1KC8 W;  1FS0 G;  3AG1 C;  3CSX A;  3F5T A;  1O9G A;  3UQ8 A;  4G28 B;  4X65 O;  4NVP A;  4GUN A;  1LUV A;  3BHP A;  2VWJ A;  2ZDI A;  2IJK A;  3RGB A;  4FLV A;  3CEI A;  1IBK B;  1R3J C;  3AK1 A;  4JI1 B;  3K5O A;  3D36 C;  4ZOL A;  3OEE G;  1L0L H;  4MVQ A;  4MTG A;  2XAH A;  3ASN B;  3TET A;  1AR4 A;  1W0K G;  1WN7 A;  1V55 B;  2UUB O;  1S3J A;  3H1K H;  2IJI A;  2UXB B;  1M57 B;  1SZT A;  4NXN O;  3CME V;  2X0L A;  4LH6 A;  5DM6 V;  1NZ6 A;  1YIT V;  1NI8 A;  2FYU H;  3T1Y O;  5ITZ A;  3K08 A;  1ZAU A;  1CEZ A;  1Q90 D;  3I55 V;  1ZX3 A;  1XDC A;  1D5N A;  5EZY B;  1NR1 A;  4DR5 B;  4LBE C;  3E22 A;  1GK9 A;  1P7B A;  1Q6U A;  2QM4 A;  3VQW A;  1R6T A;  3IJ4 A;  2QDO A;  1VQ9 V;  3ABM C;  4HNA B;  1PNK A;  3CWB H;  1XI1 A;  2F95 B;  2PI5 A;  4PI0 A;  1ZWI C;  1PNM A;  5L3G A;  3O9O A;  4CC5 A;  1QQC A;  4U3F H;  4TV9 A;  3A0B Z;  1GM8 A;  1IDS A;  4EB6 A;  2VQF B;  2RMK B;  4MT8 A;  1YDX A;  1H2G A;  5KAI Z;  2LP7 A;  3RBZ A;  2WLM A;  3CC2 V;  2LQT A;  1COW G;  2GUZ B;  2NN4 A;  1MZE A;  5F2V O;  1I08 A;  1K34 A;  5H6Q A;  1D5A A;  5CA1 B;  2AHZ A;  4LNU A;  4I9Q A;  1EN5 A;  2UXD B;  3HKD B;  2QTO A;  4OPA A;  4WBN B;  5J2U B;  5LHH A;  3SJB C;  4HAM A;  1ARO P;  1WB8 A;  1XNR B;  3KDR A;  5K1P A;  2YIB A;  2OYQ A;  2M7W A;  2ILM A;  4N23 A;  2OCH A;  4DR3 O;  3CD6 V;  4B3S B;  1K97 A;  4H44 B;  4DV4 B;  2BTQ A;  3KG2 A;  3ABT A;  2LFR A;  4AQY O;  4QNH B;  1G1X B;  3ZJZ A;  1SQP H;  1Q6I A;  1S77 D;  3GWK C;  4UFZ A;  2XAG A;  4KHP B;  1HNX O;  4U3J A;  1YTF B;  2ARH A;  3HKC B;  2F1M A;  3QG5 A;  4W4K A;  4LF4 B;  1YJW V;  5IYD O;  1SZX A;  1Y67 A;  1NJI W;  1R6N A;  1B3Q A;  5KHH A;  3VQV A;  3VOU A;  4JI5 O;  3RWR D;  2VWK A;  1WP8 A;  5LA6 B;  4JI6 B;  1GMG A;  1NBM G;  3NR7 A;  3ABL C;  2CTW A;  2XAF A;  3A8T A;  3AG2 C;  1N36 O;  2W0X A;  1SKV A;  1JNB A;  4JI3 O;  5A2Q N;  2QWO B;  4DO2 A;  1KBH A;  3K9A A;  1OZ0 A;  3RT3 C;  4DV3 B;  5EBM C;  4CZZ A;  2Q6A A;  1K9M W;  2QJ1 A;  2VRZ A;  3FFQ A;  1N33 B;  4H37 A;  1W0J G;  1R3I C;  4IGG A;  1MSD A;  4I0X A;  5FNV B;  2OIE A;  4DV2 O;  4J7K A;  4XDL A;  2HVK C;  4J9Y B;  3UCS C;  1B06 A;  2V7Q G;  3SDL A;  3VQY A;  2JK5 C;  1PD3 A;  4YY3 O;  4JV5 B;  4YHH O;  1IXM A;  2PGG A;  4GKK O;  4D7S A;  4TT3 G;  4WFF A;  1JOY A;  1B04 A;  4QPK A;  2EIM B;  1KMI Z;  3AEI A;  2QA4 V;  3CX5 F;  4JI4 O;  3HKC A;  4AHC A;  1BL8 A;  3HPL C;  3ZN1 A;  2IJJ A;  1EZJ A;  3JAW A;  2CE4 A;  1Y66 A;  4G2K A;  4XBF A;  5JH7 B;  3P3N A;  3ZS8 C;  5BMV A;  4JI2 B;  3L71 H;  2QTS A;  1R73 A;  2X6A A;  4RWU A;  3TGU H;  5KX5 A;  4LF5 B;  5CBF A;  1N32 B;  1Q6H A;  2Q68 A;  1K33 A;  1Y4M A;  3NXS A;  4JAU A;  5BZB A;  1OCC B;  3CJH A;  1PNL A;  3BCC H;  1VMG A;  3T2M A;  2QWQ B;  1KYO F;  4ICG A;  5AG2 A;  3CCU V;  1VF6 C;  1CP9 A;  4I5S A;  1SF9 A;  5LP6 B;  3JD3 A;  4JI7 O;  2H8P C;  4J9Z B;  1AJN A;  2ZIM A;  3UO3 A;  1QR9 A;  1Q3E A;  3HKB B;  3KZI Z;  3WG7 B;  1LNQ A;  4JPR A;  2R9R B;  3Q4H A;  2H94 A;  4PHZ A;  3CCR V;  1AB3 A;  2EZO A;  2EZP A;  4EFB A;  4PEL A;  3L9D A;  2YEV B;  4WF9 V;  1M93 A;  3BY6 A;  3N2K A;  4H0L B;  5JQG A;  1RM1 C;  1FD9 A;  2AZ0 A;  4TQF A;  1CXZ B;  2A79 B;  4XDJ A;  3ZHS A;  2XAQ A;  3A0R A;  3RYF A;  5EYP B;  1DF5 A;  5IWA O;  4RO2 A;  2XAJ A;  2C2A A;  1H8E G;  1GKF A;  1UFI A;  4HYO A;  2HP8 A;  3QVN A;  4JTA B;  3CYO A;  3L72 H;  3RFR A;  5LMU O;  2ZIO A;  5IDJ A;  1JCH A;  3ETQ A;  4UB6 Z;  3WFV A;  4J41 A;  2KKW A;  3K04 A;  4ZIB A;  1N8R W;  3ICX A;  1HR0 O;  3C90 A;  4R50 A;  4DR7 O;  1XEQ A;  2HVJ C;  1F51 A;  2ADP A;  2YIC A;  2D2C B;  3W7X A;  3CCQ V;  3SPI A;  4MS2 A;  1VP7 A;  3G6B A;  4L87 A;  1JJ2 U;  2Q4P A;  1GN6 A;  2JRI A;  5CBH A;  4KUM A;  1SQF A;  1WA8 A;  4GKJ O;  3QF7 A;  3MD0 A;  5J2T B;  1A32 A;  1EN4 A;  2KSD A;  1Y76 A;  1PL0 A;  2ITC C;  4RQE A;  4Q6G A;  4UB8 Z;  1NS1 A;  3ABK C;  3E83 A;  3TCU A;  2DWE C;  4TWK A;  4DK0 A;  1IBL B;  1NTK H;  5IJ0 B;  5B5E Z;  1HNW B;  3B8M A;  4ASU G;  1VAR A;  3QTC A;  4CS4 A;  2QM8 A;  4QJF B;  5FL7 G;  2CTP A;  3D36 A;  4DV7 O;  1Q43 A;  4W4L A;  1SQG A;  5CA0 B;  2YEV A;  4DR1 B;  1RSO A;  2UUA O;  1FXH A;  4HBN A;  3H1H H;  1AVM A;  4JI0 O;  1YJ9 V;  1G4Y B;  5GTI Z;  4YJ3 B;  4AIL C;  3KCY A;  4JAS A;  4PDM A;  4X66 O;  1TUB A;  5FPR A;  3OTO B;  1KB9 F;  3QNE A;  2ZXW C;  5FLX N;  4KP4 A;  2EIJ C;  2N74 A;  3K0D A;  5KA6 A;  4JYB A;  1SQV H;  1R6K A;  4O2A A;  4PA3 A;  5IYZ A;  4TV8 B;  2EIK B;  3SYC A;  1SS3 A;  4B3R O;  4GX1 A;  2UUC B;  3ZN0 A;  3CS5 A;  4HZ3 A;  4LF9 B;  4B08 A;  2VQE B;  4LF8 B;  1WJZ A;  2N05 A;  3FAV B;  3M8A A;  5EBW C;  4I4T A;  2F43 G;  3FB5 C;  3CRA A;  4YIP A;  3J80 N;  4JYA B;  3B40 A;  5LBQ A;  4WFE A;  1OCR B;  3N2G A;  4F6E A;  4LFA B;  2ZNI A;  4NTX A;  3AG4 C;  3K5L A;  4E2L A;  3RYC B;  3OGC C;  4ZOL B;  1S5L Z;  2UU9 O;  1I94 O;  2F66 C;  4UCO A;  1BE3 H;  1DGS A;  2EX3 A;  4UV8 A;  1YF2 A;  3RYH A;  2B1G A;  1AP5 A;  2Y4U A;  3H9V A;  3X2Q C;  1FJG B;  1K5S A;  5CA3 A;  1K4D C;  3BRC A;  4X1Y A;  2ATK C;  2DYR C;  4MVU A;  4LWS A;  2OTJ V;  3ETD A;  1IX9 A;  4UV9 A;  4U7O A;  4P30 A;  3J7A U;  1VQM V;  3K5M A;  1E1Q G;  1M9N A;  3BAB A;  3E22 B;  1BMF G;  1XMQ O;  3CXC U;  4PA7 A;  3J81 N;  3G80 A;  1AJQ A;  1SRY A;  4B7K A;  1IZ3 A;  3H1J H;  5FPO A;  2DMX A;  3ASO C;  1HNZ O;  4P9O A;  4X64 B;  1N0J A;  3OR6 C;  2CH7 B;  1LR1 A;  4EB6 B;  3OMN B;  5KHI A;  2WAM A;  4TV8 A;  3FD9 A;  3JSL A;  4WFG A;  4PA4 A;  5IJ9 B;  4FZ1 A;  1FXV A;  4X9Q A;  4DR2 O;  1JPX A;  1NH2 B;  5EK0 A;  2BE3 A;  3N27 A;  2WLJ A;  3SPJ A;  4NXM B;  1GAX A;  4IL6 Z;  3JSN A;  3JAK A;  4JYY A;  4DW1 A;  3CRR A;  4UVA A;  3CRC A;  4P9P A;  2QWN B;  2QSA A;  3CMA V;  2VS0 A;  3PN1 A;  3GB7 C;  4X88 A;  2G38 A;  2OCC B;  2DJV A;  1IJG A;  1J5E B;  1K92 A;  3RYC A;  3W7U A;  1IBM B;  4F6R B;  3RW0 A;  4EKW A;  1XL6 A;  1V54 C;  4CS3 A;  2RCV A;  2BTQ B;  2LW1 A;  1SQB H;  2IM9 A;  1GN2 A;  3VBB A;  3ZMV A;  2EIL B;  4TUY A;  4EEQ A;  1H2K A;  1OCO C;  2W6J G;  1XMO O;  1PPJ H;  1VF5 B;  4U3J B;  5JCO C;  4K3A A;  4B3T O;  4DV5 O;  3W7S A;  4JI8 O;  1K7D A;  1R1B A;  2GBO A;  5BY1 A;  1NR7 A;  1YTF D;  2HR3 A;  2XUM A;  3CCM V;  2XTA A;  4DV6 O;  2Q5Z A;  3GVM A;  5B1A B;  5K1X A;  1E79 G;  5H2F Z;  1ZUQ A;  2CH7 A;  2X6B A;  2KB1 A;  5EC1 C;  1GN3 A;  4FLW A;  4PJ0 Z;  3E35 A;  1BZK A;  2CK3 G;  5IJ9 A;  5KUK A;  1TGO A;  1AJP A;  1B6Q A;  2ZNJ A;  1SER A;  1RP3 B;  4K0K O;  2DQ0 A;  4MVM A;  1SQX H;  4QGP A;  4B3M O;  1W2B U;  1M56 B;  2F4V B;  5LGT A;  2HJD A;  5B3S B;  2ZM6 B;  3OM3 B;  2WLI A;  3WB0 A;  4J42 A;  4R6Z A;  4UCU A;  4I0X B;  3CC4 V;  3AK2 A;  4DUY B;  4I55 A;  4N21 A;  1VF6 A;  3CB2 A;  4F6R A;  4OX9 B;  2JGD A;  4X1I A;  4FLT A;  5B66 Z;  2EUL A;  4UXN A;  1QLE B;  3LDE A;  4QIW F;  2GTS A;  1WPX A;  3B2E E;  2CUG A;  5IYC O;  3E8B A;  4BW5 A;  3R66 A;  2LO1 A;  5LYJ A;  3OAA G;  1XRE A;  4GX0 A;  4ZHQ A;  3JAW B;  3OFN G;  4MVO A;  1M90 W;  1O9H A;  5GON A;  2DYS B;  2ZXW B;  5BMV B;  4DV1 O;  4GZR B;  4X62 B;  3K06 A;  4LFB O;  4YJ2 A;  5C8Y A;  3BEH A;  4Z2W A;  5KX5 B;  1F4N A;  3KKY A;  1P4R A;  1YEW A;  4DR6 O;  2FKX A;  3OT7 A;  2ZIN A;  1X4T A;  5CB4 A;  3CCJ V;  5LOV A;  1AR1 B;  3E8F A;  1VQ8 V;  2CGO A;  2KQX A;  1XOU A;  1P49 A;  4DV0 O;  3ML0 A;  3CJH B;  1NKD A;  5BR8 O;  1TVK A;  1BS3 A;  2CTR A;  2NLJ C;  3OD4 A;  1S72 V;  2OIG A;  3BVO A;  1Q5O A;  1XNQ O;  2QR4 A;  3ABU A;  4FFB A;  1GM9 A;  4CH6 A;  3FYI B;  1CPY A;  1WB7 A;  1P7G A;  2V1D A;  4LF7 B;  3A0H Z;  1AI4 A;  1N4C A;  2R70 A;  3AG4 B;  1NTM H;  2WLL A;  4DR4 O;  5B1B C;  3FKS G;  3Q4H B;  4DUZ O;  4O4J A;  3SR2 C;  4A5U B;  4J7J A;  1TUE B;  3B77 A;  1N34 O;  4LF6 B;  1M1K W;  2AW9 A;  1JA8 A;  1WPB A;  3N2K B;  2E5L B;  5DED A;  3ZED A;  2L35 A;  5JQG B;  2RJZ A;  5KAF Z;  3UM7 A;  5JWP A;  2P5O A;  3RYF B;  3DGE A;  2YIA A;  2ZR2 A;  3JYC A;  1K4C C;  2P67 A;  4GLX A;  3AG3 B;  3SPH A;  3JD2 A;  1MG1 A;  2IW5 A;  2X7R B;  2N04 A;  2KG7 A;  4WFA V;  2Q69 A;  4MW3 A;  3RYI A;  2HHH B;  2ZD9 A;  4Q20 A;  4UCV A;  1SQQ H;  1OCZ C;  2NNU A;  1AIL A;  4NB5 A;  1M5I A;  3T1C A;  4LFC O;  1R3K C;  3FB7 C;  1SC5 B;  4FPP A;  4PDR A;  4JF3 A;  4YIO A;  5IY5 B;  3ZCC A;  3T1H B;  2P7T C;  1HW7 A;  1MNG A;  5LXT A;  1XHZ A;  2QM7 A;  5LMN B;  3ZRX A;  2UXC O;  2R9A A;  5A9G A;  3ETG A;  2CTQ A;  3P3P A;  4JTD B;  5GTH Z;  3JAS A;  1VQ5 V;  1J95 A;  3LSS A;  2ITD C;  3CP1 A;  2YXY A;  4I50 A;  4UCR A;  4O4I B;  1WA8 B;  2K1E A;  3AG1 B;  5GW7 A;  1Y76 B;  4PA9 A;  3WB2 A;  4XDK A;  3QO5 A;  4X65 B;  2PZS A;  4LH7 A;  1RPR A;  3B09 A;  2Y69 C;  5L3D A;  4ZI7 B;  4C7U A;  1ZLZ A;  3CC7 V;  1IBK O;  1EBO A;  5TIS Z;  1RPO A;  4JI1 O;  2AGA A;  3OUS A;  1JQ0 A;  1VEW A;  2XT9 A;  3IC7 A;  1RSO B;  2BTO A;  3LNM B;  3HB3 B;  1P84 F;  3ASN C;  5CN0 A;  2UUB B;  1V55 C;  3OMA B;  1TUB B;  4NXN B;  4J7Z A;  1YCI A;  3DXR A;  1K8A W;  2UXB O;  1Q86 W;  1M57 C;  1ROP A;  2B5U A;  2K9P A;  2Q9L A;  4K8Z A;  3BAA A;  4TQD A;  1OCO B;  3T1Y B;  1MZF A;  4UVC A;  2P90 A;  4O2A B;  5IYZ B;  3JAT A;  2OTL V;  1US6 A;  4CH5 A;  2YXL A;  1VQ4 V;  4NTW A;  2JVD A;  4DR5 O;  2Q7H A;  1SES A;  3ABM B;  3IC9 A;  3L73 H;  1FAF A;  4I4T B;  3R65 A;  4DW0 A;  4JZ2 A;  2ZKO A;  2M6Y A;  2BSK A;  2VQF O;  3N2G B;  1XIL A;  1UJW B;  1FXK C;  3BFR A;  3WB1 A;  2E3C A;  4FK5 C;  1QCE A;  1TAE A;  3D3I A;  2XND G;  4PD4 F;  3L75 H;  2YID A;  2ZQM A;  4O4I A;  1YVW A;  3RYH B;  4NTY A;  3ZMU A;  1YIJ V;  4UCS A;  4WFH A;  2UXD O;  1ENV A;  2RNB A;  1GTO A;  3ETE A;  1XUQ A;  1XNR O;  4X1Y B;  2ZE7 A;  4ZI7 A;  4LWS B;  2BOC C;  2H3O A;  1U97 A;  4DR3 B;  1ZL8 A;  5E79 Z;  3JAR A;  3JD1 A;  4O4H A;  4B3S O;  1YZB A;  3UO2 A;  4DV4 O;  2EJR A;  3OGI B;  4AQY B;  4OGQ B;  1VQP V;  1T5E A;  2AXT Z;  2W6I G;  4FVM A;  4X20 A;  3G71 V;  1HNX B;  3ZRS A;  5JCO A;  4KHP O;  3JAL A;  2JEX A;  4KFM A;  1N0N A;  4YXW G;  2RN9 A;  2ZE8 A;  3TXQ A;  4LF4 O;  1H2M A;  1PV0 A;  2HJF C;  2OT5 A;  3RN4 A;  4IHJ A;  2Q8V A;  1BHA A;  2JJ2 G;  3O65 A;  3EHB B;  4Z1M G;  4JI5 B;  4FM2 A;  2BOB C;  2ZT9 B;  4G27 B;  1NQT A;  3JAK B;  5KHJ A;  3JAM N;  4WCE V;  4JI6 O;  3ABL B;  1NH2 D;  2WWW A;  1Z2G A;  3AG2 B;  1N36 B;  4BW9 A;  1YSC A;  3BA9 A;  4JI3 B;  4MVS A;  1PKX A;  4NR1 A;  4IIJ A;  2YIB D;  2AHY A;  1S76 D;  1L8D A;  3APO A;  3CCV V;  4OPH A;  3E89 A;  4DV3 O;  3IGA C;  4TUY B;  1X59 A;  3S3X A;  4U7N A;  2EBO A;  4L8J A;  4PV1 B;  4MTO A;  1OV9 A;  3GWO A;  3OTF A;  4PDL A;  1N33 O;  3D3Q A;  1U96 A;  4DV2 B;  4RAI A;  2O57 A;  3DSQ A;  4QE9 A;  2A3Q A;  1MA1 A;  1WP7 A;  4YY3 B;  4J11 A;  2ADQ B;  1BT8 A;  3UT5 A;  4YHH B;  1RFY A;  4JV5 O;  4CH3 A;  1NVP B;  4GKK B;  1I5Y A;  4KXR A;  1MMM A;  4UUJ C;  3CCE V;  4GCZ A;  2GSM B;  1Q8I A;  2FML A;  4LP8 A;  5LHG A;  4JI4 B;  2EIM C;  1Y74 B;  4GX5 A;  4JYC A;  2YSU B;  5KA5 A;  2Y48 A;  4DYL A;  5L3F A;  1KQS U;  2UXX A;  4JI2 O;  4ABM A;  3ZHU A;  4DRX A;  4LF5 O;  3RVY A;  3E8G A;  1N32 O;  3CCS V;  2D3O W;  3CHX A;  3I56 V;  1AI5 A;  2WLI B;  2YI9 A;  2QKA A;  1OCC C;  2ETN A;  1F4M A;  5CMU A;  2Z0A A;  4JAA A;  2DOS A;  3TK1 A;  4WFB V;  4LCU C;  1KKD A;  4I55 B;  2F23 A;  2ZCE A;  3THO A;  2JGD B;  4JI7 B;  4X1I B;  4UCT A;  5LP6 C;  3F7V C;  1EM1 A;  2Y69 B;  1VQL V;  3W7W A;  4F4L A;  1MAB G;  1S5H C;  3WG7 C;  1I7F A;  3CCL V;  3LSQ A;  3MHH C;  1D2D A;  3LNN A;  2B1I A;  3ZRW A;  1QHT A;  5LYJ B;  1BQZ A;  3C3T A;  1GM7 A;  4FJC C;  4ZHQ B;  1RM1 B;  2E76 B;  3SPG A;  1H5W A;  3ZHT A;  1L0N H;  2JS5 A;  5GON B;  1R3L C;  2EJ7 A;  4B7E A;  5EIB D;  3M99 B;  1VQK V;  5L3C A;  4R8C A;  5JVD A;  1ZTE A;  2IJH A;  4R7C A;  4YJ2 B;  5C8Y B;  1EN6 A;  2HLD G;  3G67 A;  5IWA B;  3UKM A;  3T4D A;  5CB4 B;  5LOV B;  2CGN A;  5LMU B;  2WLH A;  4AI8 A;  3LDD A;  3AG7 A;  4FZ0 A;  2IBZ H;  3K5N A;  4K8X A;  1Y74 A;  4E4E A;  1JX9 A;  3DTU B;  4JAV A;  2YXH A;  1TVK B;  1HR0 B;  5DEC A;  1SA0 B;  2HFE C;  4H33 A;  2IH1 C;  3D8C A;  2JDI G;  4IYI A;  4NYK A;  4DR7 B;  4FFB B;  2EIN C;  1H2S B;  3ZHR A;  1AI7 A;  2ZE5 A;  1W59 A;  2IH3 C;  2MW2 B;  3SGI A;  1FXK B;  3E8H A;  2WLL B;  1G6U A;  4O4L B;  3SJQ C;  4O4J B;  1QNM A;  1F7Y A;  3FYE B;  3ZBH A;  2CAZ C;  2IU3 A;  2Q67 A;  2GDS A;  4GKJ B;  3JD0 A;  1H2L A;  1JFF A;  2JGU A;  1GN4 A;  4OXS A;  1AI6 A;  3SYA A;  3ABK B;  1GO3 F;  1ORQ C;  2QKC A;  1IBL O;  3JD4 A;  3K3W A;  4LC1 A;  2P06 A;  4QPJ A;  1IVS A;  1VQN V;  3P30 A;  1HNW O;  3PJS K;  3ZIA G;  4DV7 B;  3U0Z A;  2UUA B;  2KG7 B;  4FLZ A;  3JCZ A;  4DR1 O;  1HDJ A;  2DE0 X;  1PL4 A;  4JI0 B;  5KHG A;  1YXB A;  4CBC A;  3RYI B;  4GX2 A;  2UXN A;  2V4D A;  3C3S A;  4X66 B;  1YHQ V;  2HEP A;  2EIJ B;  3OTO O;  2XAS A;  1DTO A;  4MTX A;  2AZ2 A;  1MOF A;  2GV9 A;  3TXS A;  4NKG B;  5IT9 N;  1S0V A;  3LUT B;  4FLY A;  2BCC H;  5LXT B;  4JGS A;  2MK3 A;  5HFM A;  4B3R B;  2EIK C;  5IE9 A;  2QE7 G;  3OW2 U;  2NR5 A;  5EZY A;  5IYB O;  4J80 A;  2UUC O;  4LF9 O;  2VQE O;  3S3W A;  2PYL A;  4LF8 O;  3JAS B;  5JJJ B;  1IUR A;  3B4S A;  1SA0 A;  1KUQ A;  4HNA A;  5B1N A;  4I50 B;  1GRJ A;  1VQ7 V;  4GYC B;  1OJH A;  2WPD G;  2JEU A;  2YI8 A;  5HFL A;  2Q0A A;  4JYA O;  1BSM A;  4JZG A;  5LHI A;  1FPO A;  1OCR C;  1FXK A;  2XOK G;  2ZDI C;  4LFA O;  3OMI B;  4ZBM A;  3ZHQ A;  3HKE B;  4I9W A;  4O4L A;  2WA3 A;  2GUZ A;  1QU7 A;  2UU9 B;  3OE7 G;  1I94 B;  3FX7 A;  5CA1 A;  3TJT A;  5D5P A;  1XL4 A;  1K3E A;  3JCU Z;  3P32 A;  3X2Q B;  4BWA A;  3ZRV A;  2A06 H;  2QEX V;  3H01 A;  3HKD A;  1FJG O;  3DXR B;  4WBN A;  5J2U A;  4MVZ A;  1NT2 B;  4BIO A;  2DYR B;  4CC6 A;  4MSW C;  5LGU A;  3E86 A;  5H5N A;  1QVF U;  3MHS C;  2GHY A;  1WLE A;  3JAT B;  4IT5 A;  3ZHV A;  3L74 H;  5B1O A;  4D7T A;  5H6R A;  3ZMZ A;  1XMQ B;  1PP9 H;  1VQO V;  5J9P C;  2P6J A;  4KL1 A;  4P2Z A;  2YDE A;  3F7Y C;  2PY5 A;  2Y4T A;  4CH4 A;  3ASO B;  3CRM A;  1H38 A;  1HNZ B;  3T4Z A;  3ZX6 A;  1H2N A;  3EFF K;  1Z5V A;  2PF4 E;  4X64 O;  3K0G A;  2BSK B;  3APQ A;  2OWO A;  1DK1 A;  3IFX A;  3U11 A;  1I0H A;  4O2B B;  3K9S A;  1UPG A;  1BCC H;  1Q81 W;  4DR2 B;  2GTA A;  3AK3 A;  1XBL A;  3OR7 C;  4GT1 A;  2Q0O C;  2YS8 A;  3L70 H;  4NXM O;  3LSU A;  3I5D A;  3EXA A;  2XHB A;  5LA6 A;  2Q7E A;  5EC2 C;  4FIP C;  1V9P A;  3HKE A;  2OCC C;  4BIU A;  5E1A C;  5KHK A;  1J5E O;  4FLU A;  3W7T A;  1EZV H;  4MVR A;  1THZ A;  1ZL8 B;  5L3B A;  3JAR B;  1IBM O;  3DC6 A;  3G4S V;  1V54 B;  3K03 A;  4O4H B;  1G8M A;  3QO8 A;  4X8A A;  2FL4 A;  1F23 A;  3BPZ A;  2EIL C;  2YC0 A;  4X20 B;  3SYO A;  1XMO B;  4RQF A;  2LFS A;  3CPW U;  1NTZ H;  2ZR3 A;  4X1K B;  5FNV A;  1SET A;  3JAL B;  4B3T B;  4DV5 B;  4JI8 B;  2F93 B;  2Z3Y A;  4BAY A;  2LW7 A;  4RUF A;  4X89 A;  2P4K A;  5L3E A;  4IYH A;  4IHJ B;  4CS2 A;  4DV6 B;  1L1F A;  3M7M X;  4JTC B;  3MAQ A;  5B1A C;  4PI2 A;  5DN6 G;  2QKS A;  3EVK A;  2PTM A;  1FFX B;  2DWD C;  4FLX A;  2P4V A;  1VIB A;  3CRQ A;  5JH7 A;  3ZMS A;  3OEH G;  1H8H G;  1KEC A;  2E74 B;  2LGW A;  4O2B A;  3DC5 A;  3FB6 C;  2EIN B;  4MW8 A;  2W0F C;  4PA6 A;  4K0K B;  4TOI A;  3U10 A;  1JMK C;  4QE7 A;  4IIJ B;  2HKO A;  1Z5W A;  1E1R G;  4B3M B;  2Z5U A;  1FFT B;  4FFK A;  1M56 C;  2JS3 A;  3H1I H;  5KUM A;  2F4V O;  5B3S C;  2ZM6 O;  4ZKI A;  3CE2 A;  5JJN B;  3QO7 A;  4FMT A;  3F5W C;  2WSS G;  4DUY O;  1KU9 A;  1QBZ A;  5CBG A;  4D6T H;  2RQ6 A;  4OX9 O;  3VQX A;  5LP6 A;  3UT5 B;  3HKB A;  4MTF A;  1QLE C;  4UVB A;  1BHB A;  1YJN V;  5KMG B;  2R72 A;  5EIB C;  4X1K A;  1DF4 A;  3CXH F;  1NVP D;  3RVZ A;  1QVG U;  3SYQ A;  1DLB A;  4DV1 B;  4BR6 A;  2FB5 A;  2QWR B;  2WLN A;  2DYS C;  4LFB B;  2QWP B;  2LJ2 A;  2RDC A;  4X62 O;  4DRX B;  4DXW A;  1AR5 A;  5EYP A;  3SJA C;  2Y0I A;  4DR6 B;  3HR0 A;  4PDV A;  3SJC C;  1ZSP A;  2Q7G A;  4EFE A;  4DV0 B;  4BIZ A;  5BR8 B;  1BGY H;  1JVM A;  1JR9 A;  1FFX A;  3G6E V;  5C93 A;  5BXZ A;  2FTK A;  1KP2 A;  4Z1V A;  1FOU A;  2R9I A;  1XNQ B;  2DQ3 A;  2CDY A;  1HP8 A;  5H9C A;  1K5Q A;  1WNS A;  1VF7 A;  2A7W A;  3K57 A;  5LL6 Y;  1S5J A;  3H1L H;  1K73 W;  3K59 A;  4DK1 A;  4H13 B;  1KKC A;  4LF7 O;  5EBL C;  3E2E A;  4DR4 B;  5B1B B;  2Q73 A;  5KLV H;  2E75 B;  4DUZ B;  3ZRW B;  1OHH G;  3SPC A;  1FYJ A;  2WA4 A; 
#chains in the Genus database with same CATH homology
 3LSU A;  4E4E A;  1AR4 A;  4JYY A;  1PM9 A;  2AW9 A;  1JA8 A;  4YIP A;  3AK2 A;  2CE4 A;  1BSM A;  4JZG A;  1N0N A;  4F6E A;  1SZX A;  1Y67 A;  3MDS A;  2ADP A;  3DC6 A;  1XDC A;  1D5N A;  2RCV A;  3RN4 A;  3IC9 A;  3TJT A;  1GN6 A;  1GN2 A;  1QNM A;  1AP6 A;  1AP5 A;  2QKA A;  1XRE A;  2GDS A;  1EN4 A;  4JZ2 A;  1GN4 A;  5AG2 A;  4BR6 A;  1IDS A;  4YIO A;  1LUW A;  1XIL A;  2QKC A;  1IX9 A;  3BFR A;  1MNG A;  1AR5 A;  3KKY A;  1VAR A;  1EM1 A;  3OT7 A;  2P4K A;  5A9G A;  1ZSP A;  1I08 A;  1IXB A;  1PL4 A;  1JR9 A;  1AVM A;  1ZUQ A;  1EN5 A;  3C3T A;  3EVK A;  3C3S A;  1BS3 A;  1WB8 A;  3KDR A;  1MSD A;  1N0J A;  1XUQ A;  1GN3 A;  2CDY A;  4GUN A;  1ZTE A;  1LUV A;  3DC5 A;  1B06 A;  1EN6 A;  1MA1 A;  4C7U A;  1I0H A;  3CEI A;  1ZLZ A;  1WB7 A;  1P7G A;  3AK1 A;  2ADQ B;  3K9S A;  1BT8 A;  1KKC A;  3QVN A;  4X9Q A;  3AK3 A;  1VEW A;  4FFK A;  1MMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...