4GUNA

Crystal structure of the k184r, l185p mutant manganese superoxide dismutase from candida albicans cytosol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
rcsb
source organism Candida albicans
molecule tags Oxidoreductase
total genus 81
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4gunA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4gunA02
1XILA 1MNGA 2QKAA 2P4KA 1XDCA 1JA8A 4FFKA 1KKCA 1AR5A 3TJTA 1VARA 3LSUA 1AVMA 4GUNA 3K9SA 4F6EA 3DC5A 1BT8A 2CDYA 1GN6A 4JZ2A 2ADPA 1IX9A 1EN5A 3AK2A 1GN2A 1MMMA 1LUVA 1ZSPA 4X9QA 1MA1A 1I0HA 2QKCA 1B06A 1VEWA 1AP5A 3BFRA 1EM1A 1MSDA 3IC9A 1XUQA 1EN6A 3KKYA 3QVNA 4JZGA 1WB8A 4JYYA 1ZUQA 1AP6A 1D5NA 3C3TA 1XREA 1ZLZA 1SZXA 5AG2A 3CEIA 1P7GA 1PM9A 1ZTEA 1N0NA 4C7UA 2ADQB 4E4EA 1BS3A 3AK3A 1BSMA 3OT7A 1JR9A 5A9GA 1EN4A 2CE4A 2RCVA 2GDSA 3RN4A 1WB7A 4BR6A 1QNMA 1Y67A 4YIOA 1GN4A 4YIPA 1N0JA 1LUWA 2AW9A 1AR4A 3AK1A 1IXBA 1GN3A 1PL4A 3EVKA 1I08A 3DC6A 1IDSA 3C3SA 3MDSA
chains in the Genus database with same CATH superfamily
5KHGA 3ZIAG 3T4DA 2ETNA 5LP6B 2F23A 2CAZC 3TJTA 2UUBB 3LSUA 1NS1A 4UB8Z 1XNRB 2XAJA 1JMKC 3QO8A 4K8ZA 1QVFU 3DXRA 3OTOB 5E79Z 2UXCB 3CRQA 1Q6UA 1ENVA 3R66A 2YIBA 3MHHC 1JFFA 1SA0B 3ABLC 2H3OA 1IXMA 3BFRA 3FB7C 5IWAB 3CCLV 2QE7G 3HR0A 5JWPA 5JH7A 2E75B 2GTSA 2QWRB 5CA1B 4HZ3A 2F66C 4H37A 1D5NA 4PA3A 2BOBC 5AG2A 4JI7O 1TGOA 2AHYA 4DV4O 1Z5WA 4JGSA 5JCOA 2AGAA 1YTFD 4R6ZA 3J80N 1JX9A 2QDOA 3T1YO 1AROP 3T4ZA 1E1RG 3LSQA 1BSMA 2Y69B 2DYRB 3H1IH 4CZZA 3E35A 3JALA 1AI6A 3H01A 2Q7GA 3PN1A 4X20B 5A9GA 2RNBA 2P22C 2RCVA 5KA5A 3CD6V 3D36A 4B08A 4EB6B 4NR1A 1F23A 3EHBB 3UM7A 1NR1A 4U3JB 1D5AA 2HP8A 2ILMA 2X6BA 4O2AA 3CCSV 3IAYA 4MTFA 4X65B 1GN3A 4JTDB 4EKWA 4J9ZB 1XMOO 2FL4A 2BTQA 3ABKB 3MDSA 4CS3A 2XASA 1MNGA 3A8TA 4KFMA 4ABMA 3G4SV 4DR6B 4FM1A 4QNHB 3N2KA 4X1IB 4IHJA 1AI7A 4PDRA 1VQPV 1VQ8V 4LF8O 3CC4V 1VQ9V 1K4DC 2W6IG 4P9PA 3OMNB 4YJ2B 4AILC 2Y4UA 4JAUA 5KAIZ 3HKCA 4PDLA 1ORQC 1QR9A 5JVDA 4JI1B 5B3SB 2ZR2A 3L75H 1FJGO 2Q8VA 4J41A 1YITV 1RPOA 1H2NA 5HFLA 4JI0O 5KHKA 3N2GB 1MZEA 1ZAUA 3BA9A 4U3FH 2YIBD 3SYCA 5LHIA 2CTQA 2JGUA 4UXNA 4NB5A 4DR1O 3CP1A 4QJFB 2P5OA 1K3EA 4PJ0Z 4JI7B 1KKDA 3CCRV 4DV4B 4NVPA 3ZMSA 1ZUQA 2Z0AA 1L8DA 4LNUB 5GONA 4F6RA 3T1YB 1MG1A 1WA8B 2QKSA 4DV5O 3E8BA 2PYJA 3JARB 1XOUA 1HR0B 1S5LZ 2GV9A 3QF7A 3ETDA 2CE4A 3SGIA 3DSQA 3OR6C 2O57A 1THZA 2QM8A 3LSSA 1FD9A 4HNAB 4R50A 1NH2B 2ARHA 5KLVH 1XMOB 1Q90D 1YEWA 4P30A 3CWBH 4X1KB 1M57B 4TUYB 1M9NA 1FS0G 1JOYA 5FL7G 3UT5B 1U96A 3EVKA 2W0XA 3CRMA 5KAFZ 3ZHUA 2WAMA 1SQVH 2JEXA 1OCZB 1VF5B 1F51A 5DECA 3QNEA 3K0GA 4TV9A 1QR8A 2UXXA 2XHBA 3BRCA 3CCVV 4Q20A 5B1OA 4UFZA 2WA4A 3DC5A 2Q73A 3E8GA 3JD4A 1FJGB 1O9HA 3KCYA 4XDKA 4JI0B 2Q4PA 1EN5A 4O4JA 3K5OA 2EBOA 4DR1B 3L9DA 5IJ9B 2QEXV 3K5NA 3D3IA 1B04A 2DN9A 3G6EV 5J2UA 3E8HA 3ABMC 1AJQA 1Y66A 5B1AB 4DRXA 4CS2A 2X0LA 4I55B 3JAWA 4DV5B 1Q86W 1PNMA 3CCQV 4TV8B 4MTOA 3APOA 4I0XB 4Z1MG 1NVPB 3FB8C 4WF9V 3K5LA 4OPAA 1EBOA 4DR2O 2Z5UA 5KHHA 3I55V 5GTHZ 4BW5A 1JJOA 1Y76A 4FIPC 4LFAO 5IYZB 1NR7A 3ZHVA 1Y74B 1RFYA 3ZRWA 5J2TA 3K59A 3AG3C 5IT9N 1Q6HA 1BQ0A 2LJ2A 4MSWC 3D3QA 2JEUA 1V55B 1RSOA 4H44B 2F43G 5CBFA 1K5QA 2E74B 3AG4B 2JDIG 1KB9F 4JV5O 1WPXA 4DR3O 1YHQV 1DF4A 3DTUB 4E2LA 3S3XA 1S5HC 1M56C 3VQXA 2X6CA 1UFIA 3BCCH 1VIBA 1SKVA 2EX3A 1BT8A 1DGSA 5EZYA 3NXSA 1BHBA 2OCCB 2KG7A 3C90A 2XOKG 1NTZH 4DUYB 1H8HG 1BMFG 1I0HA 2ODMA 3VQVA 3UQ8A 5FNVB 1AP5A 3AG1C 1S3JA 3JD3A 3K0DA 4LWSB 4UCSA 3JSLA 2HG5C 5CA0A 4WCEV 1GO3F 3QO5A 2IJKA 4DR2B 3X2QC 2QM4A 4B3TO 2ZT9B 4NTXA 1N0NA 4QE9A 1QCEA 3MAQA 1K9MW 3ZHSA 2ADQB 4FVMA 1I7FA 3RYIA 4E4EA 1VMGA 4LFAB 1XHXA 2PUSA 5EIBD 4O2BA 1SESA 2BCCH 3GB7C 2WPDG 3SYQA 1YXBA 5BMVA 1EN4A 1HDJA 4GLXA 1VQOV 1S5JA 5EBLC 4RQFA 1NI8A 1EZVH 1O9GA 5LXTA 4ZHQA 1OCRC 1MZFA 4IIJB 5JCOC 5KUKA 3CC7V 1R6NA 3U11A 4P2ZA 5KHIA 4BIUA 3LNMB 1UJWB 4DR3B 1N33O 2XTAA 5EC2C 1FXHA 2DWDC 2AZ0A 3B2EE 1KP3A 2QA4V 4DV6O 4KXRA 3D36C 2R9IA 4GUNA 2CTWA 3AG2B 2R70A 2XNDG 3GWKC 2QTOA 4PDMA 4EFBA 1LUVA 2A06H 1KQSU 4J42A 4X1YB 3LDCA 4I4TA 1KUQA 4UV9A 3AEIA 4FLUA 1BL8A 2ZE6A 4MVSA 3CSXA 2QSAA 4DR4B 4J11A 1EM1A 4OPHA 4MVMA 5H2FZ 3M8AA 3M99B 3ABLB 2ZKOA 2A3QA 4KHPO 5L3FA 2PZSA 2OT5A 2B5UA 2Z3YA 3W7XA 3ZMUA 4J10A 5LYJA 2UU9B 4B3TB 2XUMA 5LOVA 3A0BZ 2VQFB 3OD4A 4MVOA 4QPJA 3CXCU 3RVYA 2WLNA 4DRXB 4L8JA 3CE2A 1Q7YW 2BSKA 2QJ1A 3JAWB 1MOFA 3CCEV 3CC2V 2HEPA 1BE3H 1JR9A 5IWAO 2F4VO 5LA6A 5KMGB 4U7NA 4UCTA 1U97A 3UO2A 3SJBC 1H8EG 4ICGA 3RFRA 4RUFA 1GN4A 1SC5B 2EIKC 2XAQA 2JJ1G 4LF9O 1N33B 1ZL8A 2QR4A 5LGTA 1IBLB 1K7DA 2IBZH 4FM0A 3E22A 2VWJA 4G27B 2Q9LA 1EFRG 2VRZA 3HKDA 2DJVA 1XDCA 1W0JG 4LFCO 4RUEA 3U0ZA 2D2CB 3OW2U 2UUCO 2HJDA 3FAVA 1XL6A 4X62O 4KP4A 5KHJA 2BOCC 5L3GA 1NT2B 3SPIA 2CH7B 5LL6Y 1IZ3A 2XT9A 1N8RW 3R65A 2P7TC 4DV7O 4UUJC 3ZRSA 3LDEA 4KHPB 5LMUO 2R72A 4O4HB 1ROPA 4OX9O 3AG2C 1PD3A 4PDVA 4CH4A 4DR6O 1BZKA 3RYFB 1M4UA 2WLKA 3RYHB 3TGUH 3K06A 4O4LB 4LP8A 1M1KW 4KUMA 3ETEA 1AJNA 4NXNO 1ZLZA 3W7UA 3CEIA 3GWOA 2Q68A 3TK1A 4BIZA 3WFVA 2XAHA 4UCVA 2E5LO 2RN9A 4JI1O 3RYCA 1S0VA 1K5SA 2HFEC 1P84F 1K97A 2F4VB 3ETGA 1ZWIC 1OCCC 3LUTB 4B3SB 2YS8A 3SYAA 2DWEC 5JJJB 4L87A 1KMIZ 2ZE8A 1H2GA 4F4LA 1HNXO 4JI5O 4JI6O 1YIJV 4AQYO 3QG5A 4FLXA 4LF9B 5BY1A 4GKJO 4R8CA 4AHCA 3ZEDA 2WLIB 5JQGA 1N0JA 3B8NA 1WN7A 4QIWF 5L3EA 2X7RB 3VQWA 3BHPA 2Q67A 2OIGA 3FYEB 2YI8A 4D7SA 5LXTB 4WBNA 1TVKA 3KZIZ 4LFCB 5C8YB 1I5YA 1TUEB 3JATB 3HKEA 1HR0O 2UUCB 2UXDO 2LW1A 3H1KH 3ZRVA 2Q6AA 4X62B 4MVRA 5IJ0A 3FB6C 1GM9A 4YJ3A 1KC8W 3TXQA 5LHHA 1YJ9V 4IL6Z 4JASA 2BE3A 4FLYA 4LCUC 3RWRD 4DV7B 2EJRA 4GT1A 2HLDG 4DXWA 4Q6GA 2DYSC 2V1DA 5LMUB 3CXHF 2AHZA 2ATKC 4OX9B 1VEWA 3J81N 1YCIA 2YXLA 4WFBV 1Q5OA 3L73H 4FPPA 2F1MA 2Q0AA 5CB4A 4NXNB 3TCUA 3VOUA 4DV1O 3A0HZ 2E5LB 3ABMB 4GX5A 3STZC 4ZOLB 5K1PA 3WU2Z 4CH3A 1P7GA 4PA4A 5ITZB 1NTKH 2RMKB 3ABTA 1WNSA 1GTOA 3P30A 4K8XA 2OCHA 1TUBA 2JS5A 4FZ1A 4JI5B 4JI6B 1R3JC 1HNXB 4AQYB 3ZHTA 2FTKA 1Y4MA 3CJHA 5HFMA 1N34O 2QWOB 4DR5O 4TOIA 4GKJB 1V9PA 2GDSA 2NN4A 3OMIB 5A2QN 1WLEA 1RPRA 2UXNA 2GUZB 4P9OA 1F4NA 1H2SB 3RW0A 1LUWA 2AW9A 3CMEV 4MW3A 3OEHG 1FFXB 3OFNG 2UXDB 2YEVB 4HAMA 3BY6A 1I08A 3AG3B 5IYBO 2ZM6O 2WLLA 5EBWC 1IURA 1FXKA 5B5EZ 4XDLA 4D7TA 3OM3B 4EEQA 2QKAA 5EC1C 4D6TH 4LF7O 1L0NH 2UUAO 3JAKA 4JAAA 1IBKO 5DN6G 1OCOC 3EXAA 2EZOA 1M90W 4GCZA 4DV2B 3JASB 2CDYA 1M56B 2JGDB 2EIJB 2A9HA 4FLTA 3HB3B 3LDDA 1EZJA 4DK0A 4FFBB 1K92A 4DUZO 2ITDC 1R6TA 3JYCA 2OYQA 4JI3O 1B06A 1SQPH 1L0LH 3BAAA 2YIAA 1NQTA 1IVSA 4DV1B 1YDXA 4QPKA 1S77D 3QVNA 3AG1B 4I9WA 1Q8IA 2E3CA 1WB8A 3CCJV 3Q4HA 1AP6A 3B8MA 3C3TA 2YC0A 2RQ6A 1H2KA 4LH6A 4W4KA 5H6RA 2L35A 2K1EA 3DXRB 4A5UB 2F93B 3WG7C 4BIOA 2QWPB 1N34B 4DUYO 4DR5B 1H2LA 3CB2A 3T2MA 3X2QB 2B9ZA 1HNWB 2R9AA 1JFFB 1NBMG 4X66O 4PA7A 4LC1A 1AR1B 1BQZA 2OTJV 4U7OA 5JH7B 4JYAO 1Y67A 4J7KA 2ZM6B 2IU3A 3CYOA 1OCRB 4BW9A 1PL0A 3APQA 4WFAV 2DE0X 2KKWA 1YF2A 4LF7B 3PJSK 2UUAB 3AG7A 1FXVA 4DW1A 1IBKB 4GX1A 2GTAA 2DW4A 1JNBA 1K34A 4IGGA 3THOA 3JALB 4ZI7A 2LFRA 2LFSA 1URFA 3ASNC 2HJFC 1N36O 2JK5C 2N74A 4YHHO 5H9CA 4NYKA 5EYPA 5IDJA 4DUZB 1PP9H 3OUSA 3ZMZA 1GN6A 2Y48A 5TISZ 4JI3B 4YXWG 5IY5C 1XI1A 3AK2A 5LMNB 4MVZA 1VQ5V 1MMMA 3HKBA 4B7EA 4O2AB 2A79B 1SQGA 1V54C 1FKAO 4DR7O 2DOSA 4O4IA 1N4CA 3KG2A 2QTSA 2M7WA 2BTQB 2M6YA 4MW8A 2EIJC 3CS5A 2PTMA 4NXMO 1Y6XA 3DGEA 4DV3O 2HR3A 3N2KB 4DYLA 3ZHRA 4IHJB 2X6AA 5B1BC 2WLHA 5KX5A 2A7WA 5KUMA 2P6JA 3P32A 3B09A 2VWKA 4I50A 2N04A 1IJGA 4QE7A 2DQ0A 3HKCB 2XAFA 3B77A 5JVDB 5LP6A 1HW7A 1YJWV 4X66B 3BA8A 4DR4O 1XHZA 3H1HH 1J95A 3SYPA 4JYAB 3ASOC 4J9YB 2FMLA 5LBQA 3JD2A 3I5DA 5IYDO 1NZ6A 2UU9O 4FLVA 1Q6IA 4WFGA 2EJ7A 5GONB 5K1XA 1G8MA 2VQFO 4F6RB 3SR2C 3OAAG 3SPJA 2EIKB 1SA0A 1Q43A 1GKFA 2IU0A 1WAZA 4GZRB 1GRJA 1IDSA 2OWOA 5J9PC 4TQFA 3D8CA 4JAVA 1M93A 3UO3A 1N36B 5CA1A 3ZHQA 4YHHB 4ZBMA 4FFKA 1RM1C 1H5WA 3T1HO 1G1XB 2Q0OC 4JTAB 5GW7A 1Q3EA 3ETQA 3CCMV 4X88A 3CRCA 2D3OW 4JZ2A 3QTCA 1IX9A 4DR7B 4YY3O 5KA6A 1AI5A 2IM9A 4LFBO 1IBLO 4FLZA 4X20A 3JD1A 4NXMB 3K5MA 4DV3B 3ZMVA 1XUQA 4UVAA 4EB6A 2CTRA 3KKYA 4TV9B 4U3JA 4PI0A 2P4VA 5C93A 2LO1A 1OJHA 5DEDA 2YUAA 3BPZA 1VF6A 1HNZO 1W2BU 5JJNB 4BAYA 2ITCC 4Z2WA 1ZTEA 4CH5A 5D5PA 2MK3A 4FK5C 2Y0PA 4Z1VA 3JSNA 4B3RO 4O4JB 3JAMN 4X1IA 1FPOA 2YIDA 1AJPA 1OCCB 2P90A 3NR7A 5IE9A 1WB7A 5J2UB 2ZCEA 4BR6A 4YJ2A 1L1FA 1FAFA 3UCSC 4LF6O 2VQEB 2W0FC 5L3BA 1XL4A 3FYIB 1KP2A 2NR5A 3N2GA 3H1JH 3O65A 3KDRA 2JVDA 4DW0A 1P4RA 3IJ4A 3CX5F 1PPJH 4ZIBA 1ZX3A 3T1HB 4X8AA 4B3SO 1E79G 1X59A 2KB1A 4J7JA 4NTYA 5E1AC 4LNUA 3U10A 1XMQO 4UVCA 2LQTA 1Y76B 2QM7A 4JI8O 4YY3B 3K3WA 3O9OA 1WA8A 2JRIA 4LFBB 3JARA 3ZRWB 1QLNA 2ZDIA 2ADPA 2JJ2G 5J2TB 2EIMB 1NU1H 2ZXWC 1FXKC 3I56V 2DYSB 2V7QG 5BR8O 3KCXA 2BTOA 1YI2V 5IYCO 1RSOB 3H9VA 3F5TA 3A2FA 2QWNB 3W7SA 1TAEA 2QGNA 4HNAA 1HNZB 1VP7A 4X89A 4G28B 4X1KA 1QLEC 3EFFK 4CS4A 4TUYA 3JCUZ 4NKGB 3MHSC 4JF3A 2WLJA 3UT5A 1FYJA 3OUFA 1BCCH 5F2VO 5EZYB 4B3RB 5GTIZ 3WB2A 2KG7B 1UPGA 2ZE7A 3AK3A 4FMTA 4JYBA 3OT7A 1D2DA 1AB3A 1K4CC 1K73W 1S72V 2ZIMA 1VQMV 4LF6B 3OGCC 2ZIOA 4MVQA 4GX0A 5CA0B 4CC5A 1YJNV 2KQXA 1R3IC 2CGNA 4LF5O 1VQ4V 3K58A 5EBMC 3OTFA 1KBHA 1R1BA 5IJ9A 3DC6A 3B40A 1QQCA 2FYUH 3ICXA 4KL1A 5CBHA 4IYHA 2RDCA 5LGNA 1XMQB 1K33A 2P4KA 3RYIB 1F7YA 1SQFA 4O2BB 4JI8B 2Y4TA 4I55A 4CC6A 1VARA 1GAXA 3K9SA 5BMVB 2JIZG 4K3AA 5H6QA 2IJIA 1KU9A 1P7BA 4TV8A 2WSSG 4I0XA 2K9PA 3LNNA 2IH3C 5DM6V 1OCOB 2V4DA 5EIBC 4PHZA 4ZHQB 4HYOA 1YZBA 5BR8B 1CPYA 1GN2A 1TA8A 1SQBH 4X9QA 3SJAC 3IC7A 1DLBA 5IYZA 3BABA 3E89A 5H5NA 2RJZA 1Y74A 2CK3G 2OTLV 4XBFA 2EIMC 1R3KC 4B3MO 1NH2D 4WFHA 1X4TA 3SDLA 1MABG 3K9AA 3RT3C 2VS0A 4DV2O 2P06A 3W7WA 1H2MA 3A0RA 3E83A 1PM9A 4MTGA 5L3DA 1M5IA 4N21A 5EK0A 2G38A 4OXSA 5BZBA 4FLWA 5JJEB 3WG7B 3ZS8C 3CRRA 3STLC 2W6JG 2A0LA 3P3NA 2EINC 1GM7A 4I4TB 3FX7A 3RN4A 3SYOA 2ZD9A 1BHAA 1SERA 2H94A 4TSFG 4JI4O 2ZQMA 4LF5B 1QVGU 2XAGA 4TQDA 5LYJB 4BWAA 5LHGA 5LOVB 4DV0O 3E86A 2YXYA 5FNVA 3K03A 1F4MA 5LP6C 1PKXA 2BSKB 4B7KA 3N27A 1CEZA 2HHHO 2PGGA 3HPLC 4LWSA 2ZINA 1HNWO 1HP8A 3G67A 4LBEC 4UB6Z 3ABUA 5FPOA 1KKCA 1IBMO 4K0KO 1G6UA 4H0LB 5LGUA 1BGYH 1R73A 5B1NA 4F6EA 5LA6B 1YTFB 2EZPA 3ML0A 3ASNB 3FKSG 1YSCA 2CTPA 3VQYA 2Y0IA 1NVPD 1XNQO 1B6QA 3SPCA 2WA3A 1DTOA 5IY5B 1ZL8B 3CHXA 1OV9A 1MSDA 3E22B 4B3MB 1V54B 3ZJZA 4JZGA 3HKDB 3W7TA 4ZKIA 1Z2GA 4IIJA 1N32O 1Q81W 3VBBA 3FAVB 5B1BB 3ZCCA 4TT3G 2LGQA 5LMNO 1VQ7V 2Y69C 2DYRC 2C2AA 4C7UA 1NJIW 1GMGA 3S3WA 1SS3A 4I9QA 3E8FA 4JI4B 4AI8A 1JQ0A 4LF8B 3CPWU 1GM8A 4LF4O 1A32A 1QNMA 3ASOB 1VF6C 2YSUB 4DV0B 4PD4F 3L72H 3ZRXA 2YDEA 2PF4E 3IFXA 4X64O 1IXBA 4X1YA 3ABKC 4J7ZA 2HHHB 5CN0A 3H1LH 1VQNV 3OE7G 1W0KG 1IBMB 2LP7A 4K0KB 3RYCB 3M7MX 5CMUA 3F7YC 4QGPA 4PV1B 1T5EA 4IYIA 3K04A 1AVMA 4FM2A 4MT8A 1SETA 1NKDA 1J5EO 3UKMA 4J80A 3B4SA 1RM1B 4FJCC 1XNQB 3ZN0A 5B3SC 1JVMA 5JQGB 3SJQC 1CP9A 1CXZB 2PYLA 4JI2O 2WLMA 4RQEA 3GVMA 4UCOA 3SPHA 1QBZA 1R3LC 2HKOA 3FD9A 2R9RB 4WBNB 4GKKO 1TVKB 4OGQB 3IC9A 1LNQA 1N32B 1Q82W 5KMGA 2B1GA 3HKEB 1FOUA 4JYYA 4UVBA 5IJ0B 1I94O 1P49A 1XREA 4YJ3B 2Q7HA 2NLJC 2ZDIC 2AXTZ 1KECA 3J7AU 4N23A 1BS3A 2HVKC 2L6LA 4LF4B 1R6KA 2HVJC 2EILB 4NTWA 1WP7A 5BXZA 2CUGA 5CB4B 1GK9A 1M57C 1JPXA 4X64B 2CH7A 4RAIA 5CBGA 2FKXA 1E1QG 4YIPA 1YVWA 4RWUA 1RP3B 3L74H 3WB0A 1SZTA 1OCZC 4O4HA 1PNKA 2LGWA 2DQ3A 3TETA 3BEHA 3RYFA 5L3CA 3RYHA 1J5EB 1TUBB 4O4LA 2Q69A 2GBOA 5FPRA 3G80A 4DK1A 3CJHB 1AR5A 5FLXN 3L70H 3G6BA 1B3QA 4H13B 2FB5A 2ZE5A 1KYOF 4JI2B 4MVUA 2ZR3A 1H38A 4LH7A 4FZ0A 2VQEO 1OZ0A 3CRAA 4GKKB 2IH1C 4JPRA 2LW7A 1PNLA 2YI9A 3F7VC 5B1AC 1VF7A 2WLLB 4PI2A 2ZXWB 3K79A 4MS2A 1FXKB 4EFEA 1I94B 1QU7A 2YXHA 2E76B 3MD0A 2MW2B 4W4LA 2WLIA 3RGBA 1HWYA 1OHHG 4K35A 3JAKB 4PA9A 1NTMH 3F5WC 1SZXA 4CBCA 1KD1W 1PV0A 1COWG 1QLEB 3OR7C 5C8YA 3JATA 1DF5A 2PI4A 3JCZA 2H8PC 3ZMTA 4MTXA 3OMAB 1I5XA 4R7CA 3E2EA 2B1IA 4JV5B 2JS3A 1JJ2U 1JCHA 4DO2A 4UCUA 1LR1A 4GYCB 2Q7EA 3G71V 1SQQH 3QO7A 1VQ6V 3JD0A 3FB5C 2Q5ZA 4YIOA 3CCUV 3L71H 1GH6A 3Q4HB 2AZ2A 4JYCA 2UXBO 1V55C 4I5SA 1XEQA 2EILC 4ASUG 1QHTA 1VQLV 1Z5VA 1K8AW 3AG4C 4JTCB 2KSDA 3C3SA 1SQXH 2N05A 1XILA 2CGOA 1WJZA 3FFQA 1US6A 2F95B 1JA8A 4ZOLA 3ZBHA 2OCCC 3BVOA 2UUBO 5ITZA 3CMAV 1XNRO 3ZX6A 3RVZA 3SPGA 4CH6A 3P3PA 3K57A 1ZSPA 1MA1A 3OTOO 1SRYA 2EULA 3ZN1A 2QKCA 2UXCO 4PA6A 2ZNIA 5B66Z 2IJJA 2IW5A 1WP8A 2WWWA 1EN6A 1WPBA 2OIEA 2GHYA 4HBNA 4UCRA 4I7ZB 2GUZA 4TWKA 1MSWD 4ZI7B 4G2KA 4LR3A 3T1CA 3SJCC 1FFXA 2ZNJA 4H33A 1SF9A 2YEVA 1AI4A 4WFEA 5EYPB 5D5QA 4GX2A 2PY5A 1VQKV 2NNUA 2GSMB 3HKBB 2IJHA 3OEEG 4PELA 1AILA 2PI5A 4DV6B 4O4IB 2QWQB 3OGIB 1DK1A 4WFFA 2EINB 1XQ8A 2UXBB 3JASA 2JGDA 2DMXA 3RBZA 1W59A 1XBLA 4UV8A 5CA3A 4FFBA 2P67A 3K08A 3TXSA 1AR4A 3AK1A 1G4YB 4IT5A 5KX5B 3WB1A 1PL4A 3IGAC 1FFTB 4I50B 4XDJA 4X65O 4RO2A 2YICA 1S76D
chains in the Genus database with same CATH topology
1XILA 1MNGA 2QKAA 2P4KA 1XDCA 1JA8A 4FFKA 1KKCA 1AR5A 3TJTA 1VARA 3LSUA 1AVMA 4GUNA 3K9SA 4F6EA 3DC5A 1BT8A 2CDYA 1GN6A 4JZ2A 2ADPA 1IX9A 1EN5A 3AK2A 1GN2A 1MMMA 1LUVA 1ZSPA 4X9QA 1MA1A 1I0HA 2QKCA 1B06A 1VEWA 1AP5A 3BFRA 1EM1A 1MSDA 3IC9A 1XUQA 1EN6A 3KKYA 3QVNA 4JZGA 1WB8A 4JYYA 1ZUQA 1AP6A 1D5NA 3C3TA 1XREA 1ZLZA 1SZXA 5AG2A 3CEIA 1P7GA 1PM9A 1ZTEA 1N0NA 4C7UA 2ADQB 4E4EA 1BS3A 3AK3A 1BSMA 3OT7A 1JR9A 5A9GA 1EN4A 2CE4A 2RCVA 2GDSA 3RN4A 1WB7A 4BR6A 1QNMA 1Y67A 4YIOA 1GN4A 4YIPA 1N0JA 1LUWA 2AW9A 1AR4A 3AK1A 1IXBA 1GN3A 1PL4A 3EVKA 3KDRA 1I08A 3DC6A 1IDSA 3C3SA 3MDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIL A;  1MNG A;  2QKA A;  2P4K A;  1XDC A;  1JA8 A;  4FFK A;  1KKC A;  1AR5 A;  3TJT A;  1VAR A;  3LSU A;  1AVM A;  4GUN A;  3K9S A;  4F6E A;  3DC5 A;  1BT8 A;  2CDY A;  1GN6 A;  4JZ2 A;  2ADP A;  1IX9 A;  1EN5 A;  3AK2 A;  1GN2 A;  1MMM A;  1LUV A;  1ZSP A;  4X9Q A;  1MA1 A;  1I0H A;  2QKC A;  1B06 A;  1VEW A;  1AP5 A;  3BFR A;  1EM1 A;  1MSD A;  3IC9 A;  1XUQ A;  1EN6 A;  3KKY A;  3QVN A;  4JZG A;  1WB8 A;  4JYY A;  1ZUQ A;  1AP6 A;  1D5N A;  3C3T A;  1XRE A;  1ZLZ A;  1SZX A;  5AG2 A;  3CEI A;  1P7G A;  1PM9 A;  1ZTE A;  1N0N A;  4C7U A;  2ADQ B;  4E4E A;  1BS3 A;  3AK3 A;  1BSM A;  3OT7 A;  1JR9 A;  5A9G A;  1EN4 A;  2CE4 A;  2RCV A;  2GDS A;  3RN4 A;  1WB7 A;  4BR6 A;  1QNM A;  1Y67 A;  4YIO A;  1GN4 A;  4YIP A;  1N0J A;  1LUW A;  2AW9 A;  1AR4 A;  3AK1 A;  1IXB A;  1GN3 A;  1PL4 A;  3EVK A;  1I08 A;  3DC6 A;  1IDS A;  3C3S A;  3MDS A; 
#chains in the Genus database with same CATH topology
 5KHG A;  3ZIA G;  3T4D A;  2ETN A;  5LP6 B;  2F23 A;  2CAZ C;  3TJT A;  2UUB B;  3LSU A;  1NS1 A;  4UB8 Z;  1XNR B;  2XAJ A;  1JMK C;  3QO8 A;  4K8Z A;  1QVF U;  3DXR A;  3OTO B;  5E79 Z;  2UXC B;  3CRQ A;  1Q6U A;  1ENV A;  3R66 A;  2YIB A;  3MHH C;  1JFF A;  1SA0 B;  3ABL C;  2H3O A;  1IXM A;  3BFR A;  3FB7 C;  5IWA B;  3CCL V;  2QE7 G;  3HR0 A;  5JWP A;  5JH7 A;  2E75 B;  2GTS A;  2QWR B;  5CA1 B;  4HZ3 A;  2F66 C;  4H37 A;  1D5N A;  4PA3 A;  2BOB C;  5AG2 A;  4JI7 O;  1TGO A;  2AHY A;  4DV4 O;  1Z5W A;  4JGS A;  5JCO A;  2AGA A;  1YTF D;  4R6Z A;  3J80 N;  1JX9 A;  2QDO A;  3T1Y O;  1ARO P;  3T4Z A;  1E1R G;  3LSQ A;  1BSM A;  2Y69 B;  2DYR B;  3H1I H;  4CZZ A;  3E35 A;  3JAL A;  1AI6 A;  3H01 A;  2Q7G A;  3PN1 A;  4X20 B;  5A9G A;  2RNB A;  2P22 C;  2RCV A;  5KA5 A;  3CD6 V;  3D36 A;  4B08 A;  4EB6 B;  4NR1 A;  1F23 A;  3EHB B;  3UM7 A;  1NR1 A;  4U3J B;  1D5A A;  2HP8 A;  2ILM A;  2X6B A;  4O2A A;  3CCS V;  3IAY A;  4MTF A;  4X65 B;  1GN3 A;  4JTD B;  4EKW A;  4J9Z B;  1XMO O;  2FL4 A;  2BTQ A;  3ABK B;  3MDS A;  4CS3 A;  2XAS A;  1MNG A;  3A8T A;  4KFM A;  4ABM A;  3G4S V;  4DR6 B;  4FM1 A;  4QNH B;  3N2K A;  4X1I B;  4IHJ A;  1AI7 A;  4PDR A;  1VQP V;  1VQ8 V;  4LF8 O;  3CC4 V;  1VQ9 V;  1K4D C;  2W6I G;  4P9P A;  3OMN B;  4YJ2 B;  4AIL C;  2Y4U A;  4JAU A;  5KAI Z;  3HKC A;  4PDL A;  1ORQ C;  1QR9 A;  5JVD A;  4JI1 B;  5B3S B;  2ZR2 A;  3L75 H;  1FJG O;  2Q8V A;  4J41 A;  1YIT V;  1RPO A;  1H2N A;  5HFL A;  4JI0 O;  5KHK A;  3N2G B;  1MZE A;  1ZAU A;  3BA9 A;  4U3F H;  2YIB D;  3SYC A;  5LHI A;  2CTQ A;  2JGU A;  4UXN A;  4NB5 A;  4DR1 O;  3CP1 A;  4QJF B;  2P5O A;  1K3E A;  4PJ0 Z;  4JI7 B;  1KKD A;  3CCR V;  4DV4 B;  4NVP A;  3ZMS A;  1ZUQ A;  2Z0A A;  1L8D A;  4LNU B;  5GON A;  4F6R A;  3T1Y B;  1MG1 A;  1WA8 B;  2QKS A;  4DV5 O;  3E8B A;  2PYJ A;  3JAR B;  1XOU A;  1HR0 B;  1S5L Z;  2GV9 A;  3QF7 A;  3ETD A;  2CE4 A;  3SGI A;  3DSQ A;  3OR6 C;  2O57 A;  1THZ A;  2QM8 A;  3LSS A;  1FD9 A;  4HNA B;  4R50 A;  1NH2 B;  2ARH A;  5KLV H;  1XMO B;  1Q90 D;  1YEW A;  4P30 A;  3CWB H;  4X1K B;  1M57 B;  4TUY B;  1M9N A;  1FS0 G;  1JOY A;  5FL7 G;  3UT5 B;  1U96 A;  3EVK A;  2W0X A;  3CRM A;  5KAF Z;  3ZHU A;  2WAM A;  1SQV H;  2JEX A;  1OCZ B;  1VF5 B;  1F51 A;  5DEC A;  3QNE A;  3K0G A;  4TV9 A;  1QR8 A;  2UXX A;  2XHB A;  3BRC A;  3CCV V;  4Q20 A;  5B1O A;  4UFZ A;  2WA4 A;  3DC5 A;  2Q73 A;  3E8G A;  3JD4 A;  1FJG B;  1O9H A;  3KCY A;  4XDK A;  4JI0 B;  2Q4P A;  1EN5 A;  4O4J A;  3K5O A;  2EBO A;  4DR1 B;  3L9D A;  5IJ9 B;  2QEX V;  3K5N A;  3D3I A;  1B04 A;  2DN9 A;  3G6E V;  5J2U A;  3E8H A;  3ABM C;  1AJQ A;  1Y66 A;  5B1A B;  4DRX A;  4CS2 A;  2X0L A;  4I55 B;  3JAW A;  4DV5 B;  1Q86 W;  1PNM A;  3CCQ V;  4TV8 B;  4MTO A;  3APO A;  4I0X B;  4Z1M G;  1NVP B;  3FB8 C;  4WF9 V;  3K5L A;  4OPA A;  1EBO A;  4DR2 O;  2Z5U A;  5KHH A;  3I55 V;  5GTH Z;  4BW5 A;  1JJO A;  1Y76 A;  4FIP C;  4LFA O;  5IYZ B;  1NR7 A;  3ZHV A;  1Y74 B;  1RFY A;  3ZRW A;  5J2T A;  3K59 A;  3AG3 C;  5IT9 N;  1Q6H A;  1BQ0 A;  2LJ2 A;  4MSW C;  3D3Q A;  2JEU A;  1V55 B;  1RSO A;  4H44 B;  2F43 G;  5CBF A;  1K5Q A;  2E74 B;  3AG4 B;  2JDI G;  1KB9 F;  4JV5 O;  1WPX A;  4DR3 O;  1YHQ V;  1DF4 A;  3DTU B;  4E2L A;  3S3X A;  1S5H C;  1M56 C;  3VQX A;  2X6C A;  1UFI A;  3BCC H;  1VIB A;  1SKV A;  2EX3 A;  1BT8 A;  1DGS A;  5EZY A;  3NXS A;  1BHB A;  2OCC B;  2KG7 A;  3C90 A;  2XOK G;  1NTZ H;  4DUY B;  1H8H G;  1BMF G;  1I0H A;  2ODM A;  3VQV A;  3UQ8 A;  5FNV B;  1AP5 A;  3AG1 C;  1S3J A;  3JD3 A;  3K0D A;  4LWS B;  4UCS A;  3JSL A;  2HG5 C;  5CA0 A;  4WCE V;  1GO3 F;  3QO5 A;  2IJK A;  4DR2 B;  3X2Q C;  2QM4 A;  4B3T O;  2ZT9 B;  4NTX A;  1N0N A;  4QE9 A;  1QCE A;  3MAQ A;  1K9M W;  3ZHS A;  2ADQ B;  4FVM A;  1I7F A;  3RYI A;  4E4E A;  1VMG A;  4LFA B;  1XHX A;  2PUS A;  5EIB D;  4O2B A;  1SES A;  2BCC H;  3GB7 C;  2WPD G;  3SYQ A;  1YXB A;  5BMV A;  1EN4 A;  1HDJ A;  4GLX A;  1VQO V;  1S5J A;  5EBL C;  4RQF A;  1NI8 A;  1EZV H;  1O9G A;  5LXT A;  4ZHQ A;  1OCR C;  1MZF A;  4IIJ B;  5JCO C;  5KUK A;  3CC7 V;  1R6N A;  3U11 A;  4P2Z A;  5KHI A;  4BIU A;  3LNM B;  1UJW B;  4DR3 B;  1N33 O;  2XTA A;  5EC2 C;  1FXH A;  2DWD C;  2AZ0 A;  3B2E E;  1KP3 A;  2QA4 V;  4DV6 O;  4KXR A;  3D36 C;  2R9I A;  4GUN A;  2CTW A;  3AG2 B;  2R70 A;  2XND G;  3GWK C;  2QTO A;  4PDM A;  4EFB A;  1LUV A;  2A06 H;  1KQS U;  4J42 A;  4X1Y B;  3LDC A;  4I4T A;  1KUQ A;  4UV9 A;  3AEI A;  4FLU A;  1BL8 A;  2ZE6 A;  4MVS A;  3CSX A;  2QSA A;  4DR4 B;  4J11 A;  1EM1 A;  4OPH A;  4MVM A;  5H2F Z;  3M8A A;  3M99 B;  3ABL B;  2ZKO A;  2A3Q A;  4KHP O;  5L3F A;  2PZS A;  2OT5 A;  2B5U A;  2Z3Y A;  3W7X A;  3ZMU A;  4J10 A;  5LYJ A;  2UU9 B;  4B3T B;  2XUM A;  5LOV A;  3A0B Z;  2VQF B;  3OD4 A;  4MVO A;  4QPJ A;  3CXC U;  3RVY A;  2WLN A;  4DRX B;  4L8J A;  3CE2 A;  1Q7Y W;  2BSK A;  2QJ1 A;  3JAW B;  1MOF A;  3CCE V;  3CC2 V;  2HEP A;  1BE3 H;  1JR9 A;  5IWA O;  2F4V O;  5LA6 A;  5KMG B;  4U7N A;  4UCT A;  1U97 A;  3UO2 A;  3SJB C;  1H8E G;  4ICG A;  3RFR A;  4RUF A;  1GN4 A;  1SC5 B;  2EIK C;  2XAQ A;  2JJ1 G;  4LF9 O;  1N33 B;  1ZL8 A;  2QR4 A;  5LGT A;  1IBL B;  1K7D A;  2IBZ H;  4FM0 A;  3E22 A;  2VWJ A;  4G27 B;  2Q9L A;  1EFR G;  2VRZ A;  3HKD A;  2DJV A;  1XDC A;  1W0J G;  4LFC O;  4RUE A;  3U0Z A;  2D2C B;  3OW2 U;  2UUC O;  2HJD A;  3FAV A;  1XL6 A;  4X62 O;  4KP4 A;  5KHJ A;  2BOC C;  5L3G A;  1NT2 B;  3SPI A;  2CH7 B;  5LL6 Y;  1IZ3 A;  2XT9 A;  1N8R W;  3R65 A;  2P7T C;  4DV7 O;  4UUJ C;  3ZRS A;  3LDE A;  4KHP B;  5LMU O;  2R72 A;  4O4H B;  1ROP A;  4OX9 O;  3AG2 C;  1PD3 A;  4PDV A;  4CH4 A;  4DR6 O;  1BZK A;  3RYF B;  1M4U A;  2WLK A;  3RYH B;  3TGU H;  3K06 A;  4O4L B;  4LP8 A;  1M1K W;  4KUM A;  3ETE A;  1AJN A;  4NXN O;  1ZLZ A;  3W7U A;  3CEI A;  3GWO A;  2Q68 A;  3TK1 A;  4BIZ A;  3WFV A;  2XAH A;  4UCV A;  2E5L O;  2RN9 A;  4JI1 O;  3RYC A;  1S0V A;  1K5S A;  2HFE C;  1P84 F;  1K97 A;  2F4V B;  3ETG A;  1ZWI C;  1OCC C;  3LUT B;  4B3S B;  2YS8 A;  3SYA A;  2DWE C;  5JJJ B;  4L87 A;  1KMI Z;  2ZE8 A;  1H2G A;  4F4L A;  1HNX O;  4JI5 O;  4JI6 O;  1YIJ V;  4AQY O;  3QG5 A;  4FLX A;  4LF9 B;  5BY1 A;  4GKJ O;  4R8C A;  4AHC A;  3ZED A;  2WLI B;  5JQG A;  1N0J A;  3B8N A;  1WN7 A;  4QIW F;  5L3E A;  2X7R B;  3VQW A;  3BHP A;  2Q67 A;  2OIG A;  3FYE B;  2YI8 A;  4D7S A;  5LXT B;  4WBN A;  1TVK A;  3KZI Z;  4LFC B;  5C8Y B;  1I5Y A;  1TUE B;  3JAT B;  3HKE A;  1HR0 O;  2UUC B;  2UXD O;  2LW1 A;  3H1K H;  3ZRV A;  2Q6A A;  4X62 B;  4MVR A;  5IJ0 A;  3FB6 C;  1GM9 A;  4YJ3 A;  1KC8 W;  3TXQ A;  5LHH A;  1YJ9 V;  4IL6 Z;  4JAS A;  2BE3 A;  4FLY A;  4LCU C;  3RWR D;  4DV7 B;  2EJR A;  4GT1 A;  2HLD G;  4DXW A;  4Q6G A;  2DYS C;  2V1D A;  5LMU B;  3CXH F;  2AHZ A;  2ATK C;  4OX9 B;  1VEW A;  3J81 N;  1YCI A;  2YXL A;  4WFB V;  1Q5O A;  3L73 H;  4FPP A;  2F1M A;  2Q0A A;  5CB4 A;  4NXN B;  3TCU A;  3VOU A;  4DV1 O;  3A0H Z;  2E5L B;  3ABM B;  4GX5 A;  3STZ C;  4ZOL B;  5K1P A;  3WU2 Z;  4CH3 A;  1P7G A;  4PA4 A;  5ITZ B;  1NTK H;  2RMK B;  3ABT A;  1WNS A;  1GTO A;  3P30 A;  4K8X A;  2OCH A;  1TUB A;  2JS5 A;  4FZ1 A;  4JI5 B;  4JI6 B;  1R3J C;  1HNX B;  4AQY B;  3ZHT A;  2FTK A;  1Y4M A;  3CJH A;  5HFM A;  1N34 O;  2QWO B;  4DR5 O;  4TOI A;  4GKJ B;  1V9P A;  2GDS A;  2NN4 A;  3OMI B;  5A2Q N;  1WLE A;  1RPR A;  2UXN A;  2GUZ B;  4P9O A;  1F4N A;  1H2S B;  3RW0 A;  1LUW A;  2AW9 A;  3CME V;  4MW3 A;  3OEH G;  1FFX B;  3OFN G;  2UXD B;  2YEV B;  4HAM A;  3BY6 A;  1I08 A;  3AG3 B;  5IYB O;  2ZM6 O;  2WLL A;  5EBW C;  1IUR A;  1FXK A;  5B5E Z;  4XDL A;  4D7T A;  3OM3 B;  4EEQ A;  2QKA A;  5EC1 C;  4D6T H;  4LF7 O;  1L0N H;  2UUA O;  3JAK A;  4JAA A;  1IBK O;  5DN6 G;  1OCO C;  3EXA A;  2EZO A;  1M90 W;  4GCZ A;  4DV2 B;  3JAS B;  2CDY A;  1M56 B;  2JGD B;  2EIJ B;  2A9H A;  4FLT A;  3HB3 B;  3LDD A;  1EZJ A;  4DK0 A;  4FFB B;  1K92 A;  4DUZ O;  2ITD C;  1R6T A;  3JYC A;  2OYQ A;  4JI3 O;  1B06 A;  1SQP H;  1L0L H;  3BAA A;  2YIA A;  1NQT A;  1IVS A;  4DV1 B;  1YDX A;  4QPK A;  1S77 D;  3QVN A;  3AG1 B;  4I9W A;  1Q8I A;  2E3C A;  1WB8 A;  3CCJ V;  3Q4H A;  1AP6 A;  3B8M A;  3C3T A;  2YC0 A;  2RQ6 A;  1H2K A;  4LH6 A;  4W4K A;  5H6R A;  2L35 A;  2K1E A;  3DXR B;  4A5U B;  2F93 B;  3WG7 C;  4BIO A;  2QWP B;  1N34 B;  4DUY O;  4DR5 B;  1H2L A;  3CB2 A;  3T2M A;  3X2Q B;  2B9Z A;  1HNW B;  2R9A A;  1JFF B;  1NBM G;  4X66 O;  4PA7 A;  4LC1 A;  1AR1 B;  1BQZ A;  2OTJ V;  4U7O A;  5JH7 B;  4JYA O;  1Y67 A;  4J7K A;  2ZM6 B;  2IU3 A;  3CYO A;  1OCR B;  4BW9 A;  1PL0 A;  3APQ A;  4WFA V;  2DE0 X;  2KKW A;  1YF2 A;  4LF7 B;  3PJS K;  2UUA B;  3AG7 A;  1FXV A;  4DW1 A;  1IBK B;  4GX1 A;  2GTA A;  2DW4 A;  1JNB A;  1K34 A;  4IGG A;  3THO A;  3JAL B;  4ZI7 A;  2LFR A;  2LFS A;  1URF A;  3ASN C;  2HJF C;  1N36 O;  2JK5 C;  2N74 A;  4YHH O;  5H9C A;  4NYK A;  5EYP A;  5IDJ A;  4DUZ B;  1PP9 H;  3OUS A;  3ZMZ A;  1GN6 A;  2Y48 A;  5TIS Z;  4JI3 B;  4YXW G;  5IY5 C;  1XI1 A;  3AK2 A;  5LMN B;  4MVZ A;  1VQ5 V;  1MMM A;  3HKB A;  4B7E A;  4O2A B;  2A79 B;  1SQG A;  1V54 C;  1FKA O;  4DR7 O;  2DOS A;  4O4I A;  1N4C A;  3KG2 A;  2QTS A;  2M7W A;  2BTQ B;  2M6Y A;  4MW8 A;  2EIJ C;  3CS5 A;  2PTM A;  4NXM O;  1Y6X A;  3DGE A;  4DV3 O;  2HR3 A;  3N2K B;  4DYL A;  3ZHR A;  4IHJ B;  2X6A A;  5B1B C;  2WLH A;  5KX5 A;  2A7W A;  5KUM A;  2P6J A;  3P32 A;  3B09 A;  2VWK A;  4I50 A;  2N04 A;  1IJG A;  4QE7 A;  2DQ0 A;  3HKC B;  2XAF A;  3B77 A;  5JVD B;  5LP6 A;  1HW7 A;  1YJW V;  4X66 B;  3BA8 A;  4DR4 O;  1XHZ A;  3H1H H;  1J95 A;  3SYP A;  4JYA B;  3ASO C;  4J9Y B;  2FML A;  5LBQ A;  3JD2 A;  3I5D A;  5IYD O;  1NZ6 A;  2UU9 O;  4FLV A;  1Q6I A;  4WFG A;  2EJ7 A;  5GON B;  5K1X A;  1G8M A;  2VQF O;  4F6R B;  3SR2 C;  3OAA G;  3SPJ A;  2EIK B;  1SA0 A;  1Q43 A;  1GKF A;  2IU0 A;  1WAZ A;  4GZR B;  1GRJ A;  1IDS A;  2OWO A;  5J9P C;  4TQF A;  3D8C A;  4JAV A;  1M93 A;  3UO3 A;  1N36 B;  5CA1 A;  3ZHQ A;  4YHH B;  4ZBM A;  4FFK A;  1RM1 C;  1H5W A;  3T1H O;  1G1X B;  2Q0O C;  4JTA B;  5GW7 A;  1Q3E A;  3ETQ A;  3CCM V;  4X88 A;  3CRC A;  2D3O W;  4JZ2 A;  3QTC A;  1IX9 A;  4DR7 B;  4YY3 O;  5KA6 A;  1AI5 A;  2IM9 A;  4LFB O;  1IBL O;  4FLZ A;  4X20 A;  3JD1 A;  4NXM B;  3K5M A;  4DV3 B;  3ZMV A;  1XUQ A;  4UVA A;  4EB6 A;  2CTR A;  3KKY A;  4TV9 B;  4U3J A;  4PI0 A;  2P4V A;  5C93 A;  2LO1 A;  1OJH A;  5DED A;  2YUA A;  3BPZ A;  1VF6 A;  1HNZ O;  1W2B U;  5JJN B;  4BAY A;  2ITC C;  4Z2W A;  1ZTE A;  4CH5 A;  5D5P A;  2MK3 A;  4FK5 C;  2Y0P A;  4Z1V A;  3JSN A;  4B3R O;  4O4J B;  3JAM N;  4X1I A;  1FPO A;  2YID A;  1AJP A;  1OCC B;  2P90 A;  3NR7 A;  5IE9 A;  1WB7 A;  5J2U B;  2ZCE A;  4BR6 A;  4YJ2 A;  1L1F A;  1FAF A;  3UCS C;  4LF6 O;  2VQE B;  2W0F C;  5L3B A;  1XL4 A;  3FYI B;  1KP2 A;  2NR5 A;  3N2G A;  3H1J H;  3O65 A;  3KDR A;  2JVD A;  4DW0 A;  1P4R A;  3IJ4 A;  3CX5 F;  1PPJ H;  4ZIB A;  1ZX3 A;  3T1H B;  4X8A A;  4B3S O;  1E79 G;  1X59 A;  2KB1 A;  4J7J A;  4NTY A;  5E1A C;  4LNU A;  3U10 A;  1XMQ O;  4UVC A;  2LQT A;  1Y76 B;  2QM7 A;  4JI8 O;  4YY3 B;  3K3W A;  3O9O A;  1WA8 A;  2JRI A;  4LFB B;  3JAR A;  3ZRW B;  1QLN A;  2ZDI A;  2ADP A;  2JJ2 G;  5J2T B;  2EIM B;  1NU1 H;  2ZXW C;  1FXK C;  3I56 V;  2DYS B;  2V7Q G;  5BR8 O;  3KCX A;  2BTO A;  1YI2 V;  5IYC O;  1RSO B;  3H9V A;  3F5T A;  3A2F A;  2QWN B;  3W7S A;  1TAE A;  2QGN A;  4HNA A;  1HNZ B;  1VP7 A;  4X89 A;  4G28 B;  4X1K A;  1QLE C;  3EFF K;  4CS4 A;  4TUY A;  3JCU Z;  4NKG B;  3MHS C;  4JF3 A;  2WLJ A;  3UT5 A;  1FYJ A;  3OUF A;  1BCC H;  5F2V O;  5EZY B;  4B3R B;  5GTI Z;  3WB2 A;  2KG7 B;  1UPG A;  2ZE7 A;  3AK3 A;  4FMT A;  4JYB A;  3OT7 A;  1D2D A;  1AB3 A;  1K4C C;  1K73 W;  1S72 V;  2ZIM A;  1VQM V;  4LF6 B;  3OGC C;  2ZIO A;  4MVQ A;  4GX0 A;  5CA0 B;  4CC5 A;  1YJN V;  2KQX A;  1R3I C;  2CGN A;  4LF5 O;  1VQ4 V;  3K58 A;  5EBM C;  3OTF A;  1KBH A;  1R1B A;  5IJ9 A;  3DC6 A;  3B40 A;  1QQC A;  2FYU H;  3ICX A;  4KL1 A;  5CBH A;  4IYH A;  2RDC A;  5LGN A;  1XMQ B;  1K33 A;  2P4K A;  3RYI B;  1F7Y A;  1SQF A;  4O2B B;  4JI8 B;  2Y4T A;  4I55 A;  4CC6 A;  1VAR A;  1GAX A;  3K9S A;  5BMV B;  2JIZ G;  4K3A A;  5H6Q A;  2IJI A;  1KU9 A;  1P7B A;  4TV8 A;  2WSS G;  4I0X A;  2K9P A;  3LNN A;  2IH3 C;  5DM6 V;  1OCO B;  2V4D A;  5EIB C;  4PHZ A;  4ZHQ B;  4HYO A;  1YZB A;  5BR8 B;  1CPY A;  1GN2 A;  1TA8 A;  1SQB H;  4X9Q A;  3SJA C;  3IC7 A;  1DLB A;  5IYZ A;  3BAB A;  3E89 A;  5H5N A;  2RJZ A;  1Y74 A;  2CK3 G;  2OTL V;  4XBF A;  2EIM C;  1R3K C;  4B3M O;  1NH2 D;  4WFH A;  1X4T A;  3SDL A;  1MAB G;  3K9A A;  3RT3 C;  2VS0 A;  4DV2 O;  2P06 A;  3W7W A;  1H2M A;  3A0R A;  3E83 A;  1PM9 A;  4MTG A;  5L3D A;  1M5I A;  4N21 A;  5EK0 A;  2G38 A;  4OXS A;  5BZB A;  4FLW A;  5JJE B;  3WG7 B;  3ZS8 C;  3CRR A;  3STL C;  2W6J G;  2A0L A;  3P3N A;  2EIN C;  1GM7 A;  4I4T B;  3FX7 A;  3RN4 A;  3SYO A;  2ZD9 A;  1BHA A;  1SER A;  2H94 A;  4TSF G;  4JI4 O;  2ZQM A;  4LF5 B;  1QVG U;  2XAG A;  4TQD A;  5LYJ B;  4BWA A;  5LHG A;  5LOV B;  4DV0 O;  3E86 A;  2YXY A;  5FNV A;  3K03 A;  1F4M A;  5LP6 C;  1PKX A;  2BSK B;  4B7K A;  3N27 A;  1CEZ A;  2HHH O;  2PGG A;  3HPL C;  4LWS A;  2ZIN A;  1HNW O;  1HP8 A;  3G67 A;  4LBE C;  4UB6 Z;  3ABU A;  5FPO A;  1KKC A;  1IBM O;  4K0K O;  1G6U A;  4H0L B;  5LGU A;  1BGY H;  1R73 A;  5B1N A;  4F6E A;  5LA6 B;  1YTF B;  2EZP A;  3ML0 A;  3ASN B;  3FKS G;  1YSC A;  2CTP A;  3VQY A;  2Y0I A;  1NVP D;  1XNQ O;  1B6Q A;  3SPC A;  2WA3 A;  1DTO A;  5IY5 B;  1ZL8 B;  3CHX A;  1OV9 A;  1MSD A;  3E22 B;  4B3M B;  1V54 B;  3ZJZ A;  4JZG A;  3HKD B;  3W7T A;  4ZKI A;  1Z2G A;  4IIJ A;  1N32 O;  1Q81 W;  3VBB A;  3FAV B;  5B1B B;  3ZCC A;  4TT3 G;  2LGQ A;  5LMN O;  1VQ7 V;  2Y69 C;  2DYR C;  2C2A A;  4C7U A;  1NJI W;  1GMG A;  3S3W A;  1SS3 A;  4I9Q A;  3E8F A;  4JI4 B;  4AI8 A;  1JQ0 A;  4LF8 B;  3CPW U;  1GM8 A;  4LF4 O;  1A32 A;  1QNM A;  3ASO B;  1VF6 C;  2YSU B;  4DV0 B;  4PD4 F;  3L72 H;  3ZRX A;  2YDE A;  2PF4 E;  3IFX A;  4X64 O;  1IXB A;  4X1Y A;  3ABK C;  4J7Z A;  2HHH B;  5CN0 A;  3H1L H;  1VQN V;  3OE7 G;  1W0K G;  1IBM B;  2LP7 A;  4K0K B;  3RYC B;  3M7M X;  5CMU A;  3F7Y C;  4QGP A;  4PV1 B;  1T5E A;  4IYI A;  3K04 A;  1AVM A;  4FM2 A;  4MT8 A;  1SET A;  1NKD A;  1J5E O;  3UKM A;  4J80 A;  3B4S A;  1RM1 B;  4FJC C;  1XNQ B;  3ZN0 A;  5B3S C;  1JVM A;  5JQG B;  3SJQ C;  1CP9 A;  1CXZ B;  2PYL A;  4JI2 O;  2WLM A;  4RQE A;  3GVM A;  4UCO A;  3SPH A;  1QBZ A;  1R3L C;  2HKO A;  3FD9 A;  2R9R B;  4WBN B;  4GKK O;  1TVK B;  4OGQ B;  3IC9 A;  1LNQ A;  1N32 B;  1Q82 W;  5KMG A;  2B1G A;  3HKE B;  1FOU A;  4JYY A;  4UVB A;  5IJ0 B;  1I94 O;  1P49 A;  1XRE A;  4YJ3 B;  2Q7H A;  2NLJ C;  2ZDI C;  2AXT Z;  1KEC A;  3J7A U;  4N23 A;  1BS3 A;  2HVK C;  2L6L A;  4LF4 B;  1R6K A;  2HVJ C;  2EIL B;  4NTW A;  1WP7 A;  5BXZ A;  2CUG A;  5CB4 B;  1GK9 A;  1M57 C;  1JPX A;  4X64 B;  2CH7 A;  4RAI A;  5CBG A;  2FKX A;  1E1Q G;  4YIP A;  1YVW A;  4RWU A;  1RP3 B;  3L74 H;  3WB0 A;  1SZT A;  1OCZ C;  4O4H A;  1PNK A;  2LGW A;  2DQ3 A;  3TET A;  3BEH A;  3RYF A;  5L3C A;  3RYH A;  1J5E B;  1TUB B;  4O4L A;  2Q69 A;  2GBO A;  5FPR A;  3G80 A;  4DK1 A;  3CJH B;  1AR5 A;  5FLX N;  3L70 H;  3G6B A;  1B3Q A;  4H13 B;  2FB5 A;  2ZE5 A;  1KYO F;  4JI2 B;  4MVU A;  2ZR3 A;  1H38 A;  4LH7 A;  4FZ0 A;  2VQE O;  1OZ0 A;  3CRA A;  4GKK B;  2IH1 C;  4JPR A;  2LW7 A;  1PNL A;  2YI9 A;  3F7V C;  5B1A C;  1VF7 A;  2WLL B;  4PI2 A;  2ZXW B;  3K79 A;  4MS2 A;  1FXK B;  4EFE A;  1I94 B;  1QU7 A;  2YXH A;  2E76 B;  3MD0 A;  2MW2 B;  4W4L A;  2WLI A;  3RGB A;  1HWY A;  1OHH G;  4K35 A;  3JAK B;  4PA9 A;  1NTM H;  3F5W C;  1SZX A;  4CBC A;  1KD1 W;  1PV0 A;  1COW G;  1QLE B;  3OR7 C;  5C8Y A;  3JAT A;  1DF5 A;  2PI4 A;  3JCZ A;  2H8P C;  3ZMT A;  4MTX A;  3OMA B;  1I5X A;  4R7C A;  3E2E A;  2B1I A;  4JV5 B;  2JS3 A;  1JJ2 U;  1JCH A;  4DO2 A;  4UCU A;  1LR1 A;  4GYC B;  2Q7E A;  3G71 V;  1SQQ H;  3QO7 A;  1VQ6 V;  3JD0 A;  3FB5 C;  2Q5Z A;  4YIO A;  3CCU V;  3L71 H;  1GH6 A;  3Q4H B;  2AZ2 A;  4JYC A;  2UXB O;  1V55 C;  4I5S A;  1XEQ A;  2EIL C;  4ASU G;  1QHT A;  1VQL V;  1Z5V A;  1K8A W;  3AG4 C;  4JTC B;  2KSD A;  3C3S A;  1SQX H;  2N05 A;  1XIL A;  2CGO A;  1WJZ A;  3FFQ A;  1US6 A;  2F95 B;  1JA8 A;  4ZOL A;  3ZBH A;  2OCC C;  3BVO A;  2UUB O;  5ITZ A;  3CMA V;  1XNR O;  3ZX6 A;  3RVZ A;  3SPG A;  4CH6 A;  3P3P A;  3K57 A;  1ZSP A;  1MA1 A;  3OTO O;  1SRY A;  2EUL A;  3ZN1 A;  2QKC A;  2UXC O;  4PA6 A;  2ZNI A;  5B66 Z;  2IJJ A;  2IW5 A;  1WP8 A;  2WWW A;  1EN6 A;  1WPB A;  2OIE A;  2GHY A;  4HBN A;  4UCR A;  4I7Z B;  2GUZ A;  4TWK A;  1MSW D;  4ZI7 B;  4G2K A;  4LR3 A;  3T1C A;  3SJC C;  1FFX A;  2ZNJ A;  4H33 A;  1SF9 A;  2YEV A;  1AI4 A;  4WFE A;  5EYP B;  5D5Q A;  4GX2 A;  2PY5 A;  1VQK V;  2NNU A;  2GSM B;  3HKB B;  2IJH A;  3OEE G;  4PEL A;  1AIL A;  2PI5 A;  4DV6 B;  4O4I B;  2QWQ B;  3OGI B;  1DK1 A;  4WFF A;  2EIN B;  1XQ8 A;  2UXB B;  3JAS A;  2JGD A;  2DMX A;  3RBZ A;  1W59 A;  1XBL A;  4UV8 A;  5CA3 A;  4FFB A;  2P67 A;  3K08 A;  3TXS A;  1AR4 A;  3AK1 A;  1G4Y B;  4IT5 A;  5KX5 B;  3WB1 A;  1PL4 A;  3IGA C;  1FFT B;  4I50 B;  4XDJ A;  4X65 O;  4RO2 A;  2YIC A;  1S76 D; 
#chains in the Genus database with same CATH homology
 1XIL A;  1MNG A;  2QKA A;  2P4K A;  1XDC A;  1JA8 A;  4FFK A;  1KKC A;  1AR5 A;  3TJT A;  1VAR A;  3LSU A;  1AVM A;  4GUN A;  3K9S A;  4F6E A;  3DC5 A;  1BT8 A;  2CDY A;  1GN6 A;  4JZ2 A;  2ADP A;  1IX9 A;  1EN5 A;  3AK2 A;  1GN2 A;  1MMM A;  1LUV A;  1ZSP A;  4X9Q A;  1MA1 A;  1I0H A;  2QKC A;  1B06 A;  1VEW A;  1AP5 A;  3BFR A;  1EM1 A;  1MSD A;  3IC9 A;  1XUQ A;  1EN6 A;  3KKY A;  3QVN A;  4JZG A;  1WB8 A;  4JYY A;  1ZUQ A;  1AP6 A;  1D5N A;  3C3T A;  1XRE A;  1ZLZ A;  1SZX A;  5AG2 A;  3CEI A;  1P7G A;  1PM9 A;  1ZTE A;  1N0N A;  4C7U A;  2ADQ B;  4E4E A;  1BS3 A;  3AK3 A;  1BSM A;  3OT7 A;  1JR9 A;  5A9G A;  1EN4 A;  2CE4 A;  2RCV A;  2GDS A;  3RN4 A;  1WB7 A;  4BR6 A;  1QNM A;  1Y67 A;  4YIO A;  1GN4 A;  4YIP A;  1N0J A;  1LUW A;  2AW9 A;  1AR4 A;  3AK1 A;  1IXB A;  1GN3 A;  1PL4 A;  3EVK A;  3KDR A;  1I08 A;  3DC6 A;  1IDS A;  3C3S A;  3MDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...