4GUNA

Crystal structure of the k184r, l185p mutant manganese superoxide dismutase from candida albicans cytosol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
publication title Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
rcsb
source organism Candida albicans
total genus 81
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4gunA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4gunA02
1AP6A 1AR5A 1EM1A 3C3SA 2QKCA 4F6EA 2ADPA 2AW9A 1GN6A 3QVNA 4GUNA 4E4EA 1MSDA 1ZTEA 1BS3A 2QKAA 1P7GA 1EN6A 1GN3A 2RCVA 5A9GA 2GDSA 1N0JA 1AR4A 3K9SA 1AP5A 1SZXA 4YIPA 1Y67A 1BT8A 1I0HA 1GN4A 1MA1A 3DC5A 3CEIA 3LSUA 1D5NA 1JA8A 3MDSA 3OT7A 1WB7A 3C3TA 1WB8A 3KKYA 1LUWA 1EN4A 4YIOA 4X9QA 1LUVA 4JZGA 1GN2A 1ZSPA 3AK1A 1IXBA 1B06A 2CE4A 1IDSA 1XUQA 1JR9A 3AK2A 1QNMA 3DC6A 3AK3A 1XILA 1MNGA 1MMMA 1BSMA 1ZLZA 3RN4A 1AVMA 1KKCA 1XDCA 1N0NA 1ZUQA 1PM9A 1XREA 3EVKA 3TJTA 2CDYA 1IX9A 2P4KA 4BR6A 1EN5A 4FFKA 5AG2A 3BFRA 1VARA 1I08A 3IC9A 1VEWA 4JYYA 4JZ2A 4C7UA 1PL4A 2ADQB
chains in the Genus database with same CATH superfamily
5LGNA 4FLUA 1R6TA 4DRXA 5IY5C 2JJ2G 1L0NH 1EZVH 4I4TB 4X66B 1P7GA 3OW2U 4D7TA 1H38A 3STZC 4LP8A 4UB6Z 2QM7A 5IY5B 3SPCA 5IJ0A 3FX7A 2LGQA 3M8AA 2P22C 3Q4HB 1BT8A 1XL6A 1MZEA 4EKWA 4B3TB 1I0HA 3HKCB 4ABMA 2VWKA 4JI0B 3T4DA 3QTCA 3LSUA 1Z5WA 3QF7A 4LFAB 4IL6Z 1YITV 2RN9A 1R6NA 1HNWB 2XUMA 4BIUA 1IBKB 5LP6A 1K92A 4OXSA 4JI5O 2QEXV 2EIKC 3JD3A 2X7RB 4HNAA 5EIBD 1FXHA 2YIBD 2JS3A 4ZI7B 3FB5C 3MAQA 2DN9A 4PI0A 4EB6A 1NR1A 1AI4A 4TWKA 2EIKB 3P32A 1R3JC 1FD9A 1JJOA 2XASA 1BHBA 1CPYA 2PF4E 4BIOA 3APQA 3D36A 4I50A 5J9PC 3T1YO 1J5EB 5BR8B 4DV4O 2W6JG 1URFA 3L70H 2HVKC 3H1LH 1OCZC 4KUMA 1HWYA 3D8CA 1IZ3A 1HP8A 4X1KB 1I7FA 1WP7A 2ZINA 3LNMB 5GTHZ 4MVUA 2QKSA 1KC8W 5GONB 1SQFA 1OCZB 5CN0A 3WB0A 3ABKB 2AZ0A 3DSQA 3CHXA 3J80N 2CTPA 1T5EA 3ZJZA 4XDLA 1F7YA 3FAVB 1E79G 1R1BA 1VQ4V 4FPPA 2X6CA 2QWPB 5FNVA 4CH4A 5CA1A 2EIJC 1YJ9V 3UQ8A 4CH5A 2XAFA 3GWKC 1Q6IA 5F2VO 4PD4F 1X59A 4K35A 4GKKB 1JA8A 5IYZB 4JAUA 1SQBH 3ZEDA 4NXMO 2A0LA 2YIBA 1O9HA 2K9PA 2EIJB 3RBZA 4DV0B 4MS2A 4O4JB 5IYDO 3JD1A 2L35A 3AK1A 4O4LA 1SQPH 5CB4B 2C2AA 2Q5ZA 3LNNA 3ZRVA 2P7TC 1MMMA 5LBQA 2WSSG 5JVDA 3R65A 1XNQB 3E8FA 4FVMA 4IYHA 4LNUA 1Q6UA 1WA8A 1G8MA 5L3FA 4DR1B 4DR7B 4XDJA 3UM7A 2VRZA 1SERA 4LF4O 1XEQA 2W0XA 1KUQA 3TXQA 2JIZG 2P6JA 1VMGA 4O2AA 4UVAA 3HKBA 4OGQB 4LH6A 1P7BA 2BE3A 1JQ0A 1UFIA 4C7UA 2JVDA 2Q8VA 4RUFA 3BHPA 2E3CA 2YICA 2PYJA 2QKAA 2WA3A 3A8TA 5JJNB 3BY6A 4X8AA 2GSMB 5LOVB 3RWRD 1AR1B 4MW8A 3CCQV 1W59A 4UCSA 2Q7HA 3D3QA 4RWUA 3ZMUA 2ZQMA 3ZN1A 4ZOLA 1N36B 4R50A 4P9PA 2ZE7A 3K03A 3T1HO 3H1IH 4YHHB 4KHPB 4GYCB 4PDMA 3K9AA 3RYCA 5LHGA 3JASA 1K4DC 1AI6A 2UXBO 5LGTA 4WF9V 1IDSA 4P2ZA 3W7XA 4LCUC 4FLYA 3D3IA 4WFEA 1BSMA 1DTOA 2LFRA 2DW4A 1H2NA 1SA0A 1XDCA 3VQVA 3F5TA 2N04A 4DK1A 1K73W 3KDRA 1TUEB 3NR7A 1B6QA 3B8MA 4D7SA 4WBNA 2GV9A 3EHBB 1NI8A 3F5WC 5B1AB 1SF9A 4DV6O 2P67A 3OTOO 3E89A 3OUSA 3SPHA 1S77D 1GMGA 2LJ2A 2MW2B 1I08A 4G27B 2ODMA 4JYYA 3L74H 4J7KA 4DK0A 4TSFG 1JJ2U 2HLDG 1AR5A 1AI7A 4JYCA 4JI5B 4YXWG 1XMQO 1EN6A 3I5DA 4NTWA 3RYHB 3CRCA 2R9IA 4LF9O 3ABUA 1N32O 2RQ6A 4CH6A 3ASNC 2UUBO 5KAFZ 3OGCC 1PP9H 2F1MA 3B2EE 3CE2A 4MTFA 4DR3B 1QBZA 2ZT9B 4PJ0Z 1RM1C 4JAVA 1B04A 3PJSK 2IJIA 1P84F 1SRYA 3T1CA 1K34A 5J2UB 3T1YB 3ASNB 4R7CA 2ETNA 1FPOA 1EBOA 4JI8O 3F7VC 4DV4B 1GKFA 3KCXA 2R70A 1TA8A 1G6UA 3SJQC 2F93B 4ZHQA 4UV9A 5C8YA 4UCVA 5KA6A 3P30A 3QO7A 4MT8A 5JQGB 2AHYA 4FZ0A 1AI5A 3H1HH 1IBMB 3DC6A 4I4TA 4CS2A 3G4SV 2IJKA 3E86A 4GX0A 3JALB 2IU0A 2UXDO 4LWSA 4FIPC 2CTRA 3Q4HA 1K4CC 4FLXA 1VQ6V 3HKCA 3ZS8C 3GVMA 1FXVA 3OM3B 4FFBB 3HKEB 3UO3A 4JTAB 1U96A 1H2LA 2BSKB 1YJNV 1NTMH 1XHXA 4O4HA 2KSDA 1K7DA 4NXMB 3N2KB 1UPGA 2QKCA 4X1YB 1XNRO 1H5WA 5K1PA 1HNZO 4DR2O 2RCVA 3GWOA 2DYSC 5JCOC 1Y74A 4ZI7A 3VOUA 4DR5B 4BW9A 4LF6O 1YSCA 1WN7A 2ZNIA 3ZRSA 3E8GA 2KG7B 4RAIA 3ZRXA 2DYSB 4D6TH 5HFMA 5L3BA 5CBGA 2LP7A 2HP8A 4TQDA 1PNLA 2VWJA 5BMVA 1DF4A 4NYKA 5LMUO 4LF4B 1F4NA 3ZMVA 1R6KA 5JH7B 1VQ5V 4ICGA 3CYOA 3TETA 4UB8Z 2YXHA 4X89A 1KU9A 1Q90D 3EFFK 1P4RA 3ZMSA 5GONA 3O9OA 4F4LA 4JV5O 1MNGA 5IT9N 1I5YA 1FFTB 3P3NA 2NNUA 4X64O 3BCCH 1YTFB 4I9QA 3JAWB 4E2LA 3K3WA 4DUZO 2OWOA 4LF8O 5B1OA 2NLJC 5LHHA 3BA9A 5KHIA 3ZN0A 3K57A 5DN6G 3P3PA 3ZRWB 4LFBB 1QU7A 5DECA 3K08A 2Q0OC 4I55B 5LYJB 4JGSA 2P4VA 3ZX6A 4TQFA 5IYZA 4MVRA 3T1HB 5KHJA 1VQ7V 2ZM6O 5KLVH 3BAAA 4JI1O 4DR4O 4JYBA 5FPRA 4O4JA 2DE0X 3MD0A 4TT3G 2ADPA 1SQQH 3CRQA 1FS0G 1ZTEA 2UXBB 5EK0A 3CCJV 5B1BC 3UT5B 1VQ8V 2LO1A 5CB4A 1V55C 3RVYA 3FB8C 2WLLB 1QQCA 3OUFA 3OD4A 2VS0A 1XOUA 4AI8A 1NR7A 5B1BB 2WLNA 4U3FH 1S3JA 1V55B 1X4TA 1N4CA 3W7WA 2YDEA 1ORQC 5KUMA 2UXNA 1SC5B 5EC1C 5B5EZ 3AEIA 4DV6B 4JAAA 5C93A 3OR6C 4B3MB 5IDJA 1CP9A 3CCMV 3JD0A 2FL4A 3OEHG 1HW7A 5KUKA 2WLHA 1PKXA 2GUZB 1XILA 2YXYA 2CUGA 1XMQB 2W0FC 2ILMA 1NTKH 3BRCA 5LOVA 1Q3EA 4R8CA 2Q6AA 4J7ZA 4LF9B 1SQGA 1JNBA 1THZA 3HB3B 3K06A 1N0NA 3J7AU 4NVPA 4YY3O 2UUBB 2L6LA 3CP1A 4OX9O 3VQYA 3JYCA 1VQ9V 4B7KA 2YEVA 1NTZH 4EFEA 2P4KA 3FFQA 2CTWA 1ZL8B 5IWAO 2KQXA 4PDLA 3BFRA 1Y4MA 2QM8A 1OJHA 4CH3A 4JI8B 1YF2A 1IURA 4DW1A 3S3WA 4QNHB 3ETQA 1PV0A 3FYIB 2GTAA 4XBFA 1YZBA 4JI2O 4DV1B 1Y6XA 2WLKA 2ZDIC 3LSQA 1M4UA 5IYBO 3S3XA 4JI4B 3TK1A 1NS1A 5B3SC 2QWNB 2CH7A 1RSOA 5KA5A 3K79A 3DTUB 3CS5A 2CGNA 4DV5O 1VQNV 4YIPA 1GO3F 3WG7C 2UXDB 1BZKA 2Y4TA 4OPHA 3LDCA 2QJ1A 2RJZA 4H0LB 1FYJA 5B3SB 4UCRA 2LQTA 2ZKOA 3T4ZA 3OMNB 4P30A 3WG7B 1G4YB 1LUWA 1RPOA 4IHJA 4JI6O 1JCHA 1WNSA 2IU3A 1ROPA 3CB2A 2ZR3A 3OR7C 1XL4A 3RYHA 1DF5A 1Z5VA 1XNRB 3K5MA 2XAJA 1HNZB 4DR2B 3CCRV 2G38A 3RN4A 1XMOO 4LF6B 4GKJO 1QHTA 4O2BB 1FJGO 1GM9A 4DV7O 3G80A 3HKDB 1NT2B 3SJBC 1M56C 4I0XB 3E83A 2LFSA 4DV3O 2B5UA 4ASUG 5J2UA 1OCRC 3CWBH 2O57A 1VQPV 4U3JB 1YXBA 4TV8B 3L72H 2RDCA 3CRRA 1M56B 4FLTA 1VEWA 3JATB 1QR9A 1Q5OA 5LMUB 4WFAV 2UU9O 1HR0O 1SS3A 1OCRB 4F6EA 4ZIBA 2WLIB 2F4VB 4GUNA 1GN6A 2QR4A 3CMAV 4PA9A 1BS3A 1KECA 4QPKA 3ZHRA 1QVFU 3SPIA 2GDSA 4JV5B 4B3RB 3X2QC 1N34B 4Q20A 4DRXB 4FM0A 4X64B 4IT5A 1AP5A 3RYFB 1R73A 2ZCEA 4NTXA 1I5XA 2ARHA 4J9ZB 4DUZB 5JJJB 4LF8B 5JWPA 1D5NA 5H5NA 3OT7A 4RQEA 4X65O 3QO8A 3B40A 2YIDA 4FFBA 3K04A 4NXNO 2HR3A 5CBHA 4I9WA 1KBHA 1VF5B 4WFHA 1PNKA 1K5SA 2Q9LA 5LP6C 5EZYB 1Y76A 4IYIA 1I94O 1LUVA 2XOKG 4K8ZA 2JRIA 4QGPA 3JD2A 4BW5A 2JJ1G 4JI1B 3N2KA 1JFFB 4DR4B 4UFZA 1AROP 4CC5A 3AK2A 3ETDA 5IJ9B 2R72A 3M7MX 5GW7A 2WAMA 2YS8A 4K0KO 4LBEC 5LA6A 4H33A 2OIEA 3WB2A 4WCEV 5DEDA 2LGWA 1WP8A 2ITDC 1SETA 4GZRB 2PY5A 2UXCO 4G2KA 4BIZA 2CDYA 5KHKA 1IX9A 3DXRB 4I7ZB 4DV2O 2WPDG 1GH6A 4EFBA 1RPRA 5AG2A 1FFXB 2Z5UA 1JPXA 1NJIW 1SZTA 5BY1A 3UO2A 5LL6Y 3W7TA 1Q7YW 5JH7A 1N8RW 3W7UA 4CC6A 4PA7A 4J41A 1GK9A 4O4IB 4E4EA 1W2BU 5EBLC 1VQLV 2Q68A 4PHZA 4NR1A 1E1QG 2BCCH 1IVSA 4LF7O 2QTOA 4FM1A 2BTQB 2LW7A 3MHSC 3JAWA 3G67A 3VBBA 5D5PA 4MW3A 1KMIZ 2WLMA 2OTLV 1KD1W 2YUAA 3ML0A 2H8PC 3CJHA 4OX9B 3ZRWA 1BQZA 5E1AC 4I55A 5LYJA 1Q81W 1HDJA 3A2FA 4PA4A 3E8HA 4H13B 5FNVB 4B3TO 5L3CA 5IWAB 1K8AW 3N2GB 4K8XA 3IAYA 1HNWO 2F95B 4PDVA 3C90A 2P90A 3FB6C 3LDDA 3GB7C 3UT5A 4JI2B 1ZWIC 1F23A 3ZMZA 3OGIB 2WLLA 3I56V 1RM1B 4N23A 2YIAA 2X6BA 5EBMC 2EJRA 4H37A 4XDKA 4O4LB 1PNMA 2DQ0A 3JD4A 4DV5B 4U7OA 4W4LA 3T2MA 4BR6A 1XQ8A 3RYIB 3SJAC 2QA4V 2DWDC 4LNUB 3CX5F 2QDOA 3ZBHA 1WA8B 1D5AA 1VQKV 1Q82W 1TVKB 4MTOA 3ICXA 2QM4A 1M9NA 2AW9A 3KG2A 4JI6B 1DLBA 3H1JH 2ZR2A 2F23A 4MVOA 5A9GA 1H2MA 4IGGA 5ITZB 2GUZA 4QE7A 2EINC 3FD9A 1M93A 1NZ6A 4X1IB 2FMLA 2N05A 2BOCC 2MK3A 2EX3A 1NU1H 3ZHVA 2Q0AA 2QE7G 2PI5A 2JGDB 5CA0B 2EULA 1OCCC 4EEQA 1SZXA 2FB5A 5LGUA 1XMOB 1XBLA 2B9ZA 2EINB 4GKJB 1H8EG 4PA3A 1FJGB 4DV7B 4HBNA 5DM6V 1QLEC 3CC4V 3WU2Z 3J81N 3ZHSA 3SYOA 2JDIG 1OCCB 4DV3B 1TUBB 1ZL8A 2DYRC 4LFCO 4MVMA 4ZOLB 2Y0PA 1Q86W 1ZSPA 3AG2C 3E22B 1SKVA 1NKDA 1R3IC 4DR6O 2UU9B 1AB3A 2DYRB 1G1XB 3AG2B 1JOYA 4X1KA 1P49A 1K3EA 1KKCA 1N33O 4TV9B 1ZUQA 1LNQA 4JASA 5FPOA 1BMFG 2AXTZ 1WPBA 2ZDIA 3MHHC 2WWWA 4MTGA 1IBLO 3FB7C 3K0GA 4PV1B 5KMGB 1YCIA 2DWEC 1XHZA 3CPWU 3BVOA 4L8JA 4B08A 3FAVA 2ZNJA 4FMTA 2ATKC 4PDRA 3HR0A 1GRJA 4QPJA 2Q4PA 3H1KH 2DJVA 4X65B 4DR7O 4NXNB 4FLWA 1PL4A 4J42A 3CCUV 4JYAO 1L8DA 2DOSA 3C3SA 4JI3O 2PI4A 3JARB 4KL1A 1DK1A 2YI8A 1L0LH 2X6AA 4UV8A 5KHGA 1MSWD 4UVCA 1N0JA 2IW5A 3ETGA 5J2TB 2KKWA 2OTJV 5BXZA 3SYQA 3CXCU 3M99B 2Q7GA 1MABG 4K0KB 3RFRA 4O2BA 4KXRA 3HKDA 4YJ3B 3CEIA 1M5IA 4I0XA 2NR5A 2HKOA 1JVMA 1KP2A 3A0RA 1Z2GA 4KP4A 4F6RB 4DV2B 1D2DA 3G71V 4TV8A 2H3OA 1WB8A 4BWAA 1N36O 1EN4A 3PN1A 3CMEV 2UUAO 1GM7A 4YIOA 2QWOB 1BGYH 1Y66A 3B77A 3IFXA 1DGSA 2FTKA 2CE4A 1VF6C 3A0BZ 4YHHO 1QLNA 4X62O 2WLIA 3K0DA 4FLVA 2WA4A 3BA8A 3OTFA 2VQFO 1YI2V 1H8HG 3APOA 1EZJA 3OTOB 2ITCC 1RP3B 1CXZB 1UJWB 3CD6V 1PM9A 4LF7B 3RVZA 1S5JA 2K1EA 3RYFA 3UKMA 4A5UB 2AHZA 2A3QA 2QGNA 3KCYA 2PTMA 4DW0A 3LUTB 4JTDB 2IJHA 2UXXA 1ENVA 3L73H 3K59A 5H9CA 4YJ2B 3JAMN 3LSSA 4NKGB 3KZIZ 5LMNO 5EYPB 4LWSB 3B09A 2ZIMA 4H44B 2Y48A 1GAXA 4AQYO 4AHCA 1N32B 1BQ0A 1K97A 5EZYA 2ADQB 2Y0IA 1MG1A 3ZHUA 3ZMTA 4WFFA 2A7WA 2GBOA 3CC2V 1JFFA 3ETEA 3G6BA 5IJ9A 5H6QA 2XHBA 3L71H 4UXNA 3OEEG 1YEWA 1S72V 2EZOA 2OT5A 4LF5O 5LXTB 4O4HB 1R3LC 5EBWC 2UUCO 2IM9A 3FKSG 2M6YA 3CSXA 2P06A 2FKXA 2AZ2A 3DC5A 1MA1A 1Y74B 1FOUA 3DXRA 4KFMA 1K5QA 5KX5B 1YDXA 4J10A 4JI7O 4GLXA 4DR3O 1YHQV 1FFXA 2ZE6A 3JSLA 5B1NA 2Y4UA 3ABLC 2HG5C 3ABTA 3BABA 4R6ZA 1IXBA 1B06A 4J9YB 3CRAA 1NVPB 3R66A 4O4IA 5BMVB 2IH1C 1B3QA 1JMKC 1RFYA 3ABMC 3ABLB 3ABKC 5FL7G 1WLEA 1ZLZA 3HPLC 5L3EA 2ZD9A 2BTQA 2NN4A 1JX9A 5BZBA 3JAKB 2A79B 1ZX3A 1IBMO 3EVKA 2Y69C 2HHHO 3ABMB 4U7NA 3ZHQA 1QR8A 4X20B 1LR1A 2HVJC 2AGAA 1M90W 2CAZC 4TUYB 2XT9A 3I55V 1TAEA 3E2EA 1V9PA 4FM2A 3AG4C 4FK5C 1W0KG 5H6RA 4B3SO 3UCSC 1GM8A 4RO2A 2Y69B 2ZE5A 4FLZA 2OCCC 4JZ2A 1EN5A 1S5LZ 5KHHA 4LFCB 1F4MA 1EM1A 4WFGA 3N2GA 2JS5A 3AG4B 3CRMA 2V1DA 1K33A 2E76B 4RUEA 4HZ3A 1CEZA 4CS4A 2OCCB 2H94A 4DR6B 2E74B 3SYPA 2QSAA 2Q67A 4JPRA 3BPZA 1PD3A 3CCSV 4NB5A 1NH2B 1FXKC 1VIBA 1N33B 4DR5O 3F7YC 3H9VA 1WAZA 1H2KA 3K5NA 2E5LO 5JQGA 2V4DA 1BE3H 1IBLB 1NBMG 5EC2C 2QTSA 2A9HA 2OIGA 4HYOA 1Q6HA 3C3TA 3RYIA 1FXKB 3OFNG 4IIJB 3JALA 1S0VA 2IBZH 2HJFC 2ZE8A 3QO5A 4GX1A 1TVKA 1J95A 4UVBA 1OCOC 5IE9A 4JYAB 1YTFD 3STLC 1QNMA 1VP7A 3K58A 4JI3B 4DUYO 3X2QB 5ITZA 3JCUZ 5IJ0B 2JEXA 4X1IA 3HKEA 1FAFA 1L1FA 2YXLA 3OAAG 2BSKA 1OCOB 3AG3C 4UCOA 2LW1A 2JGDA 1SQXH 5CMUA 1PPJH 5CA0A 2XAGA 2ZM6B 3W7SA 3FYEB 4MVQA 4DO2A 4X1YA 1SQVH 1OV9A 3RGBA 5LP6B 3AG3B 3CXHF 4FFKA 4PA6A 5K1XA 3TXSA 1TUBA 3IC9A 2OCHA 1F51A 2W6IG 4HNAB 4LFBO 2HFEC 3D36C 2YEVB 2UUAB 2KG7A 2JGUA 3QVNA 5JCOA 5JJEB 3LDEA 2ZXWC 3E22A 3IJ4A 4PELA 2Q7EA 1GN3A 5TISZ 3K5OA 4EB6B 3L9DA 4N21A 4X62B 1E1RG 2YI9A 4I50B 3N27A 3K9SA 2VQFB 2ZXWB 3WB1A 3CCVV 4TV9A 1H2SB 4UCUA 3IGAC 2Q69A 1GN4A 3OMIB 5KMGA 3AG1C 3OMAB 2VQEO 2QWRB 3CCEV 3ZHTA 1HNXO 5B1AC 2CH7B 1M57C 2PGGA 3SYCA 1RSOB 2CK3G 4MVZA 1XI1A 1V54C 3U11A 5LMNB 3IC7A 4WFBV 4P9OA 4X66O 1R3KC 3AG1B 2YSUB 4AQYB 2B1GA 2XAQA 4LH7A 2GHYA 1M57B 4CS3A 4YY3B 3G6EV 2Z3YA 3JARA 2EIMC 4FJCC 4B7EA 4B3MO 5H2FZ 1V54B 2Q73A 3QG5A 4IHJB 5CA3A 1YIJV 5EIBC 3DGEA 5J2TA 4LF5B 5CA1B 4JI0O 3ZIAG 2BTOA 1YVWA 5L3DA 3BEHA 2EIMB 4LFAO 2JEUA 2UUCB 4QIWF 3O65A 3TJTA 3AG7A 5GTIZ 3SPGA 4L87A 2EJ7A 4YJ3A 1IBKO 3NXSA 4CBCA 1MZFA 1WJZA 1TGOA 4LR3A 1KYOF 2D2CB 4F6RA 2XNDG 2BOBC 1EFRG 1S5HC 2IJJA 4JI7B 3ASOC 1MOFA 4FZ1A 3CC7V 1US6A 2KB1A 2EILC 4I5SA 1MSDA 3B8NA 4K3AA 3THOA 1Q43A 1Q8IA 4GX2A 2CTQA 5JVDB 3VQWA 2E75B 3ASOB 3E35A 4LC1A 5B66Z 4Z1VA 1S76D 2X0LA 1J5EO 5BR8O 1NVPD 1ZAUA 2EILB 2Z0AA 3E8BA 1VF6A 4Z1MG 5LHIA 4DV1O 4CZZA 4ZKIA 2RMKB 2D3OW 2OYQA 4JI4O 4QE9A 5HFLA 4UUJC 2HHHB 3H01A 3MDSA 3SR2C 3L75H 4O2AB 2QWQB 3HKBB 5A2QN 2DMXA 3RW0A 4YJ2A 1PL0A 1COWG 4JTCB 1NQTA 3CCLV 2FYUH 5EYPA 4QJFB 2WLJA 4X9QA 4DXWA 2HEPA 4B3SB 4TOIA 2XTAA 2P5OA 3VQXA 1SESA 4RQFA 3QNEA 1XUQA 1JR9A 1AILA 2R9AA 4DYLA 2EZPA 2V7QG 4MVSA 1VQMV 1Y76B 2EBOA 1H2GA 4W4KA 5LXTA 4J80A 3EXAA 4GCZA 1AJNA 4J7JA 3RT3C 4Z2WA 1XREA 1BHAA 1QLEB 3SPJA 4GKKO 4NTYA 3A0HZ 2PUSA 4OPAA 2GTSA 4J11A 3ZCCA 1HR0B 1YJWV 4DV0O 5KX5A 1NH2D 5CBFA 3OE7G 5KAIZ 2E5LB 5LA6B 5E79Z 4PI2A 2RNBA 2R9RB 1A32A 3RYCB 1VARA 3JASB 1O9GA 4BAYA 1AP6A 4JF3A 4Q6GA 1BCCH 2N74A 2HJDA 2PZSA 5L3GA 1KB9F 1XNQO 1OHHG 3SYAA 5FLXN 1AJQA 4X88A 1SA0B 1AR4A 3TGUH 4DUYB 2M7WA 4DR1O 2F4VO 3JSNA 1KKDA 1VQOV 5IYCO 2B1IA 4WBNB 1Y67A 3WFVA 3JAKA 4AILC 2A06H 1I94B 3SGIA 1QCEA 4X20A 1AJPA 4B3RO 1N34O 4TUYA 1WB7A 1KP3A 1K9MW 4HAMA 3SDLA 2F43G 2ZIOA 2XAHA 3KKYA 2PYLA 2CGOA 4JZGA 1GN2A 2IH3C 1WPXA 3CJHB 1IJGA 4GT1A 3AK3A 1W0JG 2UXCB 5D5QA 1FKAO 1OZ0A 3U10A 4MSWC 4G28B 3JCZA 4UCTA 2DQ3A 4U3JA 1AVMA 1QVGU 3K5LA 1U97A 1VF7A 3SJCC 2JK5C 3JATA 4MTXA 1KQSU 1M1KW 3TCUA 1IXMA 1GTOA 4KHPO 2F66C 2YC0A 3U0ZA 4ZBMA 2VQEB 4ZHQB 3B4SA 1HNXB 1FXKA 4GX5A 1BL8A 5C8YB 4IIJA
chains in the Genus database with same CATH topology
1AP6A 1AR5A 1EM1A 3C3SA 2QKCA 4F6EA 2ADPA 2AW9A 1GN6A 3QVNA 4GUNA 4E4EA 1MSDA 1ZTEA 1BS3A 2QKAA 1P7GA 1EN6A 1GN3A 2RCVA 5A9GA 2GDSA 1N0JA 1AR4A 3K9SA 1AP5A 1SZXA 4YIPA 1Y67A 1BT8A 1I0HA 1GN4A 1MA1A 3DC5A 3CEIA 3LSUA 1D5NA 1JA8A 3MDSA 3OT7A 1WB7A 3C3TA 1WB8A 3KKYA 1LUWA 1EN4A 4YIOA 4X9QA 1LUVA 4JZGA 1GN2A 1ZSPA 3AK1A 1IXBA 1B06A 2CE4A 1IDSA 1XUQA 1JR9A 3AK2A 1QNMA 3DC6A 3AK3A 1XILA 1MNGA 1MMMA 1BSMA 1ZLZA 3RN4A 1AVMA 1KKCA 1XDCA 1N0NA 1ZUQA 1PM9A 3KDRA 1XREA 3EVKA 3TJTA 2CDYA 1IX9A 2P4KA 4BR6A 1EN5A 4FFKA 5AG2A 3BFRA 1VARA 1I08A 3IC9A 1VEWA 4JYYA 4JZ2A 4C7UA 1PL4A 2ADQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AP6 A;  1AR5 A;  1EM1 A;  3C3S A;  2QKC A;  4F6E A;  2ADP A;  2AW9 A;  1GN6 A;  3QVN A;  4GUN A;  4E4E A;  1MSD A;  1ZTE A;  1BS3 A;  2QKA A;  1P7G A;  1EN6 A;  1GN3 A;  2RCV A;  5A9G A;  2GDS A;  1N0J A;  1AR4 A;  3K9S A;  1AP5 A;  1SZX A;  4YIP A;  1Y67 A;  1BT8 A;  1I0H A;  1GN4 A;  1MA1 A;  3DC5 A;  3CEI A;  3LSU A;  1D5N A;  1JA8 A;  3MDS A;  3OT7 A;  1WB7 A;  3C3T A;  1WB8 A;  3KKY A;  1LUW A;  1EN4 A;  4YIO A;  4X9Q A;  1LUV A;  4JZG A;  1GN2 A;  1ZSP A;  3AK1 A;  1IXB A;  1B06 A;  2CE4 A;  1IDS A;  1XUQ A;  1JR9 A;  3AK2 A;  1QNM A;  3DC6 A;  3AK3 A;  1XIL A;  1MNG A;  1MMM A;  1BSM A;  1ZLZ A;  3RN4 A;  1AVM A;  1KKC A;  1XDC A;  1N0N A;  1ZUQ A;  1PM9 A;  1XRE A;  3EVK A;  3TJT A;  2CDY A;  1IX9 A;  2P4K A;  4BR6 A;  1EN5 A;  4FFK A;  5AG2 A;  3BFR A;  1VAR A;  1I08 A;  3IC9 A;  1VEW A;  4JYY A;  4JZ2 A;  4C7U A;  1PL4 A;  2ADQ B; 
#chains in the Genus database with same CATH topology
 5LGN A;  4FLU A;  1R6T A;  4DRX A;  5IY5 C;  2JJ2 G;  1L0N H;  1EZV H;  4I4T B;  4X66 B;  1P7G A;  3OW2 U;  4D7T A;  1H38 A;  3STZ C;  4LP8 A;  4UB6 Z;  2QM7 A;  5IY5 B;  3SPC A;  5IJ0 A;  3FX7 A;  2LGQ A;  3M8A A;  2P22 C;  3Q4H B;  1BT8 A;  1XL6 A;  1MZE A;  4EKW A;  4B3T B;  1I0H A;  3HKC B;  4ABM A;  2VWK A;  4JI0 B;  3T4D A;  3QTC A;  3LSU A;  1Z5W A;  3QF7 A;  4LFA B;  4IL6 Z;  1YIT V;  2RN9 A;  1R6N A;  1HNW B;  2XUM A;  4BIU A;  1IBK B;  5LP6 A;  1K92 A;  4OXS A;  4JI5 O;  2QEX V;  2EIK C;  3JD3 A;  2X7R B;  4HNA A;  5EIB D;  1FXH A;  2YIB D;  2JS3 A;  4ZI7 B;  3FB5 C;  3MAQ A;  2DN9 A;  4PI0 A;  4EB6 A;  1NR1 A;  1AI4 A;  4TWK A;  2EIK B;  3P32 A;  1R3J C;  1FD9 A;  1JJO A;  2XAS A;  1BHB A;  1CPY A;  2PF4 E;  4BIO A;  3APQ A;  3D36 A;  4I50 A;  5J9P C;  3T1Y O;  1J5E B;  5BR8 B;  4DV4 O;  2W6J G;  1URF A;  3L70 H;  2HVK C;  3H1L H;  1OCZ C;  4KUM A;  1HWY A;  3D8C A;  1IZ3 A;  1HP8 A;  4X1K B;  1I7F A;  1WP7 A;  2ZIN A;  3LNM B;  5GTH Z;  4MVU A;  2QKS A;  1KC8 W;  5GON B;  1SQF A;  1OCZ B;  5CN0 A;  3WB0 A;  3ABK B;  2AZ0 A;  3DSQ A;  3CHX A;  3J80 N;  2CTP A;  1T5E A;  3ZJZ A;  4XDL A;  1F7Y A;  3FAV B;  1E79 G;  1R1B A;  1VQ4 V;  4FPP A;  2X6C A;  2QWP B;  5FNV A;  4CH4 A;  5CA1 A;  2EIJ C;  1YJ9 V;  3UQ8 A;  4CH5 A;  2XAF A;  3GWK C;  1Q6I A;  5F2V O;  4PD4 F;  1X59 A;  4K35 A;  4GKK B;  1JA8 A;  5IYZ B;  4JAU A;  1SQB H;  3ZED A;  4NXM O;  2A0L A;  2YIB A;  1O9H A;  2K9P A;  2EIJ B;  3RBZ A;  4DV0 B;  4MS2 A;  4O4J B;  5IYD O;  3JD1 A;  2L35 A;  3AK1 A;  4O4L A;  1SQP H;  5CB4 B;  2C2A A;  2Q5Z A;  3LNN A;  3ZRV A;  2P7T C;  1MMM A;  5LBQ A;  2WSS G;  5JVD A;  3R65 A;  1XNQ B;  3E8F A;  4FVM A;  4IYH A;  4LNU A;  1Q6U A;  1WA8 A;  1G8M A;  5L3F A;  4DR1 B;  4DR7 B;  4XDJ A;  3UM7 A;  2VRZ A;  1SER A;  4LF4 O;  1XEQ A;  2W0X A;  1KUQ A;  3TXQ A;  2JIZ G;  2P6J A;  1VMG A;  4O2A A;  4UVA A;  3HKB A;  4OGQ B;  4LH6 A;  1P7B A;  2BE3 A;  1JQ0 A;  1UFI A;  4C7U A;  2JVD A;  2Q8V A;  4RUF A;  3BHP A;  2E3C A;  2YIC A;  2PYJ A;  2QKA A;  2WA3 A;  3A8T A;  5JJN B;  3BY6 A;  4X8A A;  2GSM B;  5LOV B;  3RWR D;  1AR1 B;  4MW8 A;  3CCQ V;  1W59 A;  4UCS A;  2Q7H A;  3D3Q A;  4RWU A;  3ZMU A;  2ZQM A;  3ZN1 A;  4ZOL A;  1N36 B;  4R50 A;  4P9P A;  2ZE7 A;  3K03 A;  3T1H O;  3H1I H;  4YHH B;  4KHP B;  4GYC B;  4PDM A;  3K9A A;  3RYC A;  5LHG A;  3JAS A;  1K4D C;  1AI6 A;  2UXB O;  5LGT A;  4WF9 V;  1IDS A;  4P2Z A;  3W7X A;  4LCU C;  4FLY A;  3D3I A;  4WFE A;  1BSM A;  1DTO A;  2LFR A;  2DW4 A;  1H2N A;  1SA0 A;  1XDC A;  3VQV A;  3F5T A;  2N04 A;  4DK1 A;  1K73 W;  3KDR A;  1TUE B;  3NR7 A;  1B6Q A;  3B8M A;  4D7S A;  4WBN A;  2GV9 A;  3EHB B;  1NI8 A;  3F5W C;  5B1A B;  1SF9 A;  4DV6 O;  2P67 A;  3OTO O;  3E89 A;  3OUS A;  3SPH A;  1S77 D;  1GMG A;  2LJ2 A;  2MW2 B;  1I08 A;  4G27 B;  2ODM A;  4JYY A;  3L74 H;  4J7K A;  4DK0 A;  4TSF G;  1JJ2 U;  2HLD G;  1AR5 A;  1AI7 A;  4JYC A;  4JI5 B;  4YXW G;  1XMQ O;  1EN6 A;  3I5D A;  4NTW A;  3RYH B;  3CRC A;  2R9I A;  4LF9 O;  3ABU A;  1N32 O;  2RQ6 A;  4CH6 A;  3ASN C;  2UUB O;  5KAF Z;  3OGC C;  1PP9 H;  2F1M A;  3B2E E;  3CE2 A;  4MTF A;  4DR3 B;  1QBZ A;  2ZT9 B;  4PJ0 Z;  1RM1 C;  4JAV A;  1B04 A;  3PJS K;  2IJI A;  1P84 F;  1SRY A;  3T1C A;  1K34 A;  5J2U B;  3T1Y B;  3ASN B;  4R7C A;  2ETN A;  1FPO A;  1EBO A;  4JI8 O;  3F7V C;  4DV4 B;  1GKF A;  3KCX A;  2R70 A;  1TA8 A;  1G6U A;  3SJQ C;  2F93 B;  4ZHQ A;  4UV9 A;  5C8Y A;  4UCV A;  5KA6 A;  3P30 A;  3QO7 A;  4MT8 A;  5JQG B;  2AHY A;  4FZ0 A;  1AI5 A;  3H1H H;  1IBM B;  3DC6 A;  4I4T A;  4CS2 A;  3G4S V;  2IJK A;  3E86 A;  4GX0 A;  3JAL B;  2IU0 A;  2UXD O;  4LWS A;  4FIP C;  2CTR A;  3Q4H A;  1K4C C;  4FLX A;  1VQ6 V;  3HKC A;  3ZS8 C;  3GVM A;  1FXV A;  3OM3 B;  4FFB B;  3HKE B;  3UO3 A;  4JTA B;  1U96 A;  1H2L A;  2BSK B;  1YJN V;  1NTM H;  1XHX A;  4O4H A;  2KSD A;  1K7D A;  4NXM B;  3N2K B;  1UPG A;  2QKC A;  4X1Y B;  1XNR O;  1H5W A;  5K1P A;  1HNZ O;  4DR2 O;  2RCV A;  3GWO A;  2DYS C;  5JCO C;  1Y74 A;  4ZI7 A;  3VOU A;  4DR5 B;  4BW9 A;  4LF6 O;  1YSC A;  1WN7 A;  2ZNI A;  3ZRS A;  3E8G A;  2KG7 B;  4RAI A;  3ZRX A;  2DYS B;  4D6T H;  5HFM A;  5L3B A;  5CBG A;  2LP7 A;  2HP8 A;  4TQD A;  1PNL A;  2VWJ A;  5BMV A;  1DF4 A;  4NYK A;  5LMU O;  4LF4 B;  1F4N A;  3ZMV A;  1R6K A;  5JH7 B;  1VQ5 V;  4ICG A;  3CYO A;  3TET A;  4UB8 Z;  2YXH A;  4X89 A;  1KU9 A;  1Q90 D;  3EFF K;  1P4R A;  3ZMS A;  5GON A;  3O9O A;  4F4L A;  4JV5 O;  1MNG A;  5IT9 N;  1I5Y A;  1FFT B;  3P3N A;  2NNU A;  4X64 O;  3BCC H;  1YTF B;  4I9Q A;  3JAW B;  4E2L A;  3K3W A;  4DUZ O;  2OWO A;  4LF8 O;  5B1O A;  2NLJ C;  5LHH A;  3BA9 A;  5KHI A;  3ZN0 A;  3K57 A;  5DN6 G;  3P3P A;  3ZRW B;  4LFB B;  1QU7 A;  5DEC A;  3K08 A;  2Q0O C;  4I55 B;  5LYJ B;  4JGS A;  2P4V A;  3ZX6 A;  4TQF A;  5IYZ A;  4MVR A;  3T1H B;  5KHJ A;  1VQ7 V;  2ZM6 O;  5KLV H;  3BAA A;  4JI1 O;  4DR4 O;  4JYB A;  5FPR A;  4O4J A;  2DE0 X;  3MD0 A;  4TT3 G;  2ADP A;  1SQQ H;  3CRQ A;  1FS0 G;  1ZTE A;  2UXB B;  5EK0 A;  3CCJ V;  5B1B C;  3UT5 B;  1VQ8 V;  2LO1 A;  5CB4 A;  1V55 C;  3RVY A;  3FB8 C;  2WLL B;  1QQC A;  3OUF A;  3OD4 A;  2VS0 A;  1XOU A;  4AI8 A;  1NR7 A;  5B1B B;  2WLN A;  4U3F H;  1S3J A;  1V55 B;  1X4T A;  1N4C A;  3W7W A;  2YDE A;  1ORQ C;  5KUM A;  2UXN A;  1SC5 B;  5EC1 C;  5B5E Z;  3AEI A;  4DV6 B;  4JAA A;  5C93 A;  3OR6 C;  4B3M B;  5IDJ A;  1CP9 A;  3CCM V;  3JD0 A;  2FL4 A;  3OEH G;  1HW7 A;  5KUK A;  2WLH A;  1PKX A;  2GUZ B;  1XIL A;  2YXY A;  2CUG A;  1XMQ B;  2W0F C;  2ILM A;  1NTK H;  3BRC A;  5LOV A;  1Q3E A;  4R8C A;  2Q6A A;  4J7Z A;  4LF9 B;  1SQG A;  1JNB A;  1THZ A;  3HB3 B;  3K06 A;  1N0N A;  3J7A U;  4NVP A;  4YY3 O;  2UUB B;  2L6L A;  3CP1 A;  4OX9 O;  3VQY A;  3JYC A;  1VQ9 V;  4B7K A;  2YEV A;  1NTZ H;  4EFE A;  2P4K A;  3FFQ A;  2CTW A;  1ZL8 B;  5IWA O;  2KQX A;  4PDL A;  3BFR A;  1Y4M A;  2QM8 A;  1OJH A;  4CH3 A;  4JI8 B;  1YF2 A;  1IUR A;  4DW1 A;  3S3W A;  4QNH B;  3ETQ A;  1PV0 A;  3FYI B;  2GTA A;  4XBF A;  1YZB A;  4JI2 O;  4DV1 B;  1Y6X A;  2WLK A;  2ZDI C;  3LSQ A;  1M4U A;  5IYB O;  3S3X A;  4JI4 B;  3TK1 A;  1NS1 A;  5B3S C;  2QWN B;  2CH7 A;  1RSO A;  5KA5 A;  3K79 A;  3DTU B;  3CS5 A;  2CGN A;  4DV5 O;  1VQN V;  4YIP A;  1GO3 F;  3WG7 C;  2UXD B;  1BZK A;  2Y4T A;  4OPH A;  3LDC A;  2QJ1 A;  2RJZ A;  4H0L B;  1FYJ A;  5B3S B;  4UCR A;  2LQT A;  2ZKO A;  3T4Z A;  3OMN B;  4P30 A;  3WG7 B;  1G4Y B;  1LUW A;  1RPO A;  4IHJ A;  4JI6 O;  1JCH A;  1WNS A;  2IU3 A;  1ROP A;  3CB2 A;  2ZR3 A;  3OR7 C;  1XL4 A;  3RYH A;  1DF5 A;  1Z5V A;  1XNR B;  3K5M A;  2XAJ A;  1HNZ B;  4DR2 B;  3CCR V;  2G38 A;  3RN4 A;  1XMO O;  4LF6 B;  4GKJ O;  1QHT A;  4O2B B;  1FJG O;  1GM9 A;  4DV7 O;  3G80 A;  3HKD B;  1NT2 B;  3SJB C;  1M56 C;  4I0X B;  3E83 A;  2LFS A;  4DV3 O;  2B5U A;  4ASU G;  5J2U A;  1OCR C;  3CWB H;  2O57 A;  1VQP V;  4U3J B;  1YXB A;  4TV8 B;  3L72 H;  2RDC A;  3CRR A;  1M56 B;  4FLT A;  1VEW A;  3JAT B;  1QR9 A;  1Q5O A;  5LMU B;  4WFA V;  2UU9 O;  1HR0 O;  1SS3 A;  1OCR B;  4F6E A;  4ZIB A;  2WLI B;  2F4V B;  4GUN A;  1GN6 A;  2QR4 A;  3CMA V;  4PA9 A;  1BS3 A;  1KEC A;  4QPK A;  3ZHR A;  1QVF U;  3SPI A;  2GDS A;  4JV5 B;  4B3R B;  3X2Q C;  1N34 B;  4Q20 A;  4DRX B;  4FM0 A;  4X64 B;  4IT5 A;  1AP5 A;  3RYF B;  1R73 A;  2ZCE A;  4NTX A;  1I5X A;  2ARH A;  4J9Z B;  4DUZ B;  5JJJ B;  4LF8 B;  5JWP A;  1D5N A;  5H5N A;  3OT7 A;  4RQE A;  4X65 O;  3QO8 A;  3B40 A;  2YID A;  4FFB A;  3K04 A;  4NXN O;  2HR3 A;  5CBH A;  4I9W A;  1KBH A;  1VF5 B;  4WFH A;  1PNK A;  1K5S A;  2Q9L A;  5LP6 C;  5EZY B;  1Y76 A;  4IYI A;  1I94 O;  1LUV A;  2XOK G;  4K8Z A;  2JRI A;  4QGP A;  3JD2 A;  4BW5 A;  2JJ1 G;  4JI1 B;  3N2K A;  1JFF B;  4DR4 B;  4UFZ A;  1ARO P;  4CC5 A;  3AK2 A;  3ETD A;  5IJ9 B;  2R72 A;  3M7M X;  5GW7 A;  2WAM A;  2YS8 A;  4K0K O;  4LBE C;  5LA6 A;  4H33 A;  2OIE A;  3WB2 A;  4WCE V;  5DED A;  2LGW A;  1WP8 A;  2ITD C;  1SET A;  4GZR B;  2PY5 A;  2UXC O;  4G2K A;  4BIZ A;  2CDY A;  5KHK A;  1IX9 A;  3DXR B;  4I7Z B;  4DV2 O;  2WPD G;  1GH6 A;  4EFB A;  1RPR A;  5AG2 A;  1FFX B;  2Z5U A;  1JPX A;  1NJI W;  1SZT A;  5BY1 A;  3UO2 A;  5LL6 Y;  3W7T A;  1Q7Y W;  5JH7 A;  1N8R W;  3W7U A;  4CC6 A;  4PA7 A;  4J41 A;  1GK9 A;  4O4I B;  4E4E A;  1W2B U;  5EBL C;  1VQL V;  2Q68 A;  4PHZ A;  4NR1 A;  1E1Q G;  2BCC H;  1IVS A;  4LF7 O;  2QTO A;  4FM1 A;  2BTQ B;  2LW7 A;  3MHS C;  3JAW A;  3G67 A;  3VBB A;  5D5P A;  4MW3 A;  1KMI Z;  2WLM A;  2OTL V;  1KD1 W;  2YUA A;  3ML0 A;  2H8P C;  3CJH A;  4OX9 B;  3ZRW A;  1BQZ A;  5E1A C;  4I55 A;  5LYJ A;  1Q81 W;  1HDJ A;  3A2F A;  4PA4 A;  3E8H A;  4H13 B;  5FNV B;  4B3T O;  5L3C A;  5IWA B;  1K8A W;  3N2G B;  4K8X A;  3IAY A;  1HNW O;  2F95 B;  4PDV A;  3C90 A;  2P90 A;  3FB6 C;  3LDD A;  3GB7 C;  3UT5 A;  4JI2 B;  1ZWI C;  1F23 A;  3ZMZ A;  3OGI B;  2WLL A;  3I56 V;  1RM1 B;  4N23 A;  2YIA A;  2X6B A;  5EBM C;  2EJR A;  4H37 A;  4XDK A;  4O4L B;  1PNM A;  2DQ0 A;  3JD4 A;  4DV5 B;  4U7O A;  4W4L A;  3T2M A;  4BR6 A;  1XQ8 A;  3RYI B;  3SJA C;  2QA4 V;  2DWD C;  4LNU B;  3CX5 F;  2QDO A;  3ZBH A;  1WA8 B;  1D5A A;  1VQK V;  1Q82 W;  1TVK B;  4MTO A;  3ICX A;  2QM4 A;  1M9N A;  2AW9 A;  3KG2 A;  4JI6 B;  1DLB A;  3H1J H;  2ZR2 A;  2F23 A;  4MVO A;  5A9G A;  1H2M A;  4IGG A;  5ITZ B;  2GUZ A;  4QE7 A;  2EIN C;  3FD9 A;  1M93 A;  1NZ6 A;  4X1I B;  2FML A;  2N05 A;  2BOC C;  2MK3 A;  2EX3 A;  1NU1 H;  3ZHV A;  2Q0A A;  2QE7 G;  2PI5 A;  2JGD B;  5CA0 B;  2EUL A;  1OCC C;  4EEQ A;  1SZX A;  2FB5 A;  5LGU A;  1XMO B;  1XBL A;  2B9Z A;  2EIN B;  4GKJ B;  1H8E G;  4PA3 A;  1FJG B;  4DV7 B;  4HBN A;  5DM6 V;  1QLE C;  3CC4 V;  3WU2 Z;  3J81 N;  3ZHS A;  3SYO A;  2JDI G;  1OCC B;  4DV3 B;  1TUB B;  1ZL8 A;  2DYR C;  4LFC O;  4MVM A;  4ZOL B;  2Y0P A;  1Q86 W;  1ZSP A;  3AG2 C;  3E22 B;  1SKV A;  1NKD A;  1R3I C;  4DR6 O;  2UU9 B;  1AB3 A;  2DYR B;  1G1X B;  3AG2 B;  1JOY A;  4X1K A;  1P49 A;  1K3E A;  1KKC A;  1N33 O;  4TV9 B;  1ZUQ A;  1LNQ A;  4JAS A;  5FPO A;  1BMF G;  2AXT Z;  1WPB A;  2ZDI A;  3MHH C;  2WWW A;  4MTG A;  1IBL O;  3FB7 C;  3K0G A;  4PV1 B;  5KMG B;  1YCI A;  2DWE C;  1XHZ A;  3CPW U;  3BVO A;  4L8J A;  4B08 A;  3FAV A;  2ZNJ A;  4FMT A;  2ATK C;  4PDR A;  3HR0 A;  1GRJ A;  4QPJ A;  2Q4P A;  3H1K H;  2DJV A;  4X65 B;  4DR7 O;  4NXN B;  4FLW A;  1PL4 A;  4J42 A;  3CCU V;  4JYA O;  1L8D A;  2DOS A;  3C3S A;  4JI3 O;  2PI4 A;  3JAR B;  4KL1 A;  1DK1 A;  2YI8 A;  1L0L H;  2X6A A;  4UV8 A;  5KHG A;  1MSW D;  4UVC A;  1N0J A;  2IW5 A;  3ETG A;  5J2T B;  2KKW A;  2OTJ V;  5BXZ A;  3SYQ A;  3CXC U;  3M99 B;  2Q7G A;  1MAB G;  4K0K B;  3RFR A;  4O2B A;  4KXR A;  3HKD A;  4YJ3 B;  3CEI A;  1M5I A;  4I0X A;  2NR5 A;  2HKO A;  1JVM A;  1KP2 A;  3A0R A;  1Z2G A;  4KP4 A;  4F6R B;  4DV2 B;  1D2D A;  3G71 V;  4TV8 A;  2H3O A;  1WB8 A;  4BWA A;  1N36 O;  1EN4 A;  3PN1 A;  3CME V;  2UUA O;  1GM7 A;  4YIO A;  2QWO B;  1BGY H;  1Y66 A;  3B77 A;  3IFX A;  1DGS A;  2FTK A;  2CE4 A;  1VF6 C;  3A0B Z;  4YHH O;  1QLN A;  4X62 O;  2WLI A;  3K0D A;  4FLV A;  2WA4 A;  3BA8 A;  3OTF A;  2VQF O;  1YI2 V;  1H8H G;  3APO A;  1EZJ A;  3OTO B;  2ITC C;  1RP3 B;  1CXZ B;  1UJW B;  3CD6 V;  1PM9 A;  4LF7 B;  3RVZ A;  1S5J A;  2K1E A;  3RYF A;  3UKM A;  4A5U B;  2AHZ A;  2A3Q A;  2QGN A;  3KCY A;  2PTM A;  4DW0 A;  3LUT B;  4JTD B;  2IJH A;  2UXX A;  1ENV A;  3L73 H;  3K59 A;  5H9C A;  4YJ2 B;  3JAM N;  3LSS A;  4NKG B;  3KZI Z;  5LMN O;  5EYP B;  4LWS B;  3B09 A;  2ZIM A;  4H44 B;  2Y48 A;  1GAX A;  4AQY O;  4AHC A;  1N32 B;  1BQ0 A;  1K97 A;  5EZY A;  2ADQ B;  2Y0I A;  1MG1 A;  3ZHU A;  3ZMT A;  4WFF A;  2A7W A;  2GBO A;  3CC2 V;  1JFF A;  3ETE A;  3G6B A;  5IJ9 A;  5H6Q A;  2XHB A;  3L71 H;  4UXN A;  3OEE G;  1YEW A;  1S72 V;  2EZO A;  2OT5 A;  4LF5 O;  5LXT B;  4O4H B;  1R3L C;  5EBW C;  2UUC O;  2IM9 A;  3FKS G;  2M6Y A;  3CSX A;  2P06 A;  2FKX A;  2AZ2 A;  3DC5 A;  1MA1 A;  1Y74 B;  1FOU A;  3DXR A;  4KFM A;  1K5Q A;  5KX5 B;  1YDX A;  4J10 A;  4JI7 O;  4GLX A;  4DR3 O;  1YHQ V;  1FFX A;  2ZE6 A;  3JSL A;  5B1N A;  2Y4U A;  3ABL C;  2HG5 C;  3ABT A;  3BAB A;  4R6Z A;  1IXB A;  1B06 A;  4J9Y B;  3CRA A;  1NVP B;  3R66 A;  4O4I A;  5BMV B;  2IH1 C;  1B3Q A;  1JMK C;  1RFY A;  3ABM C;  3ABL B;  3ABK C;  5FL7 G;  1WLE A;  1ZLZ A;  3HPL C;  5L3E A;  2ZD9 A;  2BTQ A;  2NN4 A;  1JX9 A;  5BZB A;  3JAK B;  2A79 B;  1ZX3 A;  1IBM O;  3EVK A;  2Y69 C;  2HHH O;  3ABM B;  4U7N A;  3ZHQ A;  1QR8 A;  4X20 B;  1LR1 A;  2HVJ C;  2AGA A;  1M90 W;  2CAZ C;  4TUY B;  2XT9 A;  3I55 V;  1TAE A;  3E2E A;  1V9P A;  4FM2 A;  3AG4 C;  4FK5 C;  1W0K G;  5H6R A;  4B3S O;  3UCS C;  1GM8 A;  4RO2 A;  2Y69 B;  2ZE5 A;  4FLZ A;  2OCC C;  4JZ2 A;  1EN5 A;  1S5L Z;  5KHH A;  4LFC B;  1F4M A;  1EM1 A;  4WFG A;  3N2G A;  2JS5 A;  3AG4 B;  3CRM A;  2V1D A;  1K33 A;  2E76 B;  4RUE A;  4HZ3 A;  1CEZ A;  4CS4 A;  2OCC B;  2H94 A;  4DR6 B;  2E74 B;  3SYP A;  2QSA A;  2Q67 A;  4JPR A;  3BPZ A;  1PD3 A;  3CCS V;  4NB5 A;  1NH2 B;  1FXK C;  1VIB A;  1N33 B;  4DR5 O;  3F7Y C;  3H9V A;  1WAZ A;  1H2K A;  3K5N A;  2E5L O;  5JQG A;  2V4D A;  1BE3 H;  1IBL B;  1NBM G;  5EC2 C;  2QTS A;  2A9H A;  2OIG A;  4HYO A;  1Q6H A;  3C3T A;  3RYI A;  1FXK B;  3OFN G;  4IIJ B;  3JAL A;  1S0V A;  2IBZ H;  2HJF C;  2ZE8 A;  3QO5 A;  4GX1 A;  1TVK A;  1J95 A;  4UVB A;  1OCO C;  5IE9 A;  4JYA B;  1YTF D;  3STL C;  1QNM A;  1VP7 A;  3K58 A;  4JI3 B;  4DUY O;  3X2Q B;  5ITZ A;  3JCU Z;  5IJ0 B;  2JEX A;  4X1I A;  3HKE A;  1FAF A;  1L1F A;  2YXL A;  3OAA G;  2BSK A;  1OCO B;  3AG3 C;  4UCO A;  2LW1 A;  2JGD A;  1SQX H;  5CMU A;  1PPJ H;  5CA0 A;  2XAG A;  2ZM6 B;  3W7S A;  3FYE B;  4MVQ A;  4DO2 A;  4X1Y A;  1SQV H;  1OV9 A;  3RGB A;  5LP6 B;  3AG3 B;  3CXH F;  4FFK A;  4PA6 A;  5K1X A;  3TXS A;  1TUB A;  3IC9 A;  2OCH A;  1F51 A;  2W6I G;  4HNA B;  4LFB O;  2HFE C;  3D36 C;  2YEV B;  2UUA B;  2KG7 A;  2JGU A;  3QVN A;  5JCO A;  5JJE B;  3LDE A;  2ZXW C;  3E22 A;  3IJ4 A;  4PEL A;  2Q7E A;  1GN3 A;  5TIS Z;  3K5O A;  4EB6 B;  3L9D A;  4N21 A;  4X62 B;  1E1R G;  2YI9 A;  4I50 B;  3N27 A;  3K9S A;  2VQF B;  2ZXW B;  3WB1 A;  3CCV V;  4TV9 A;  1H2S B;  4UCU A;  3IGA C;  2Q69 A;  1GN4 A;  3OMI B;  5KMG A;  3AG1 C;  3OMA B;  2VQE O;  2QWR B;  3CCE V;  3ZHT A;  1HNX O;  5B1A C;  2CH7 B;  1M57 C;  2PGG A;  3SYC A;  1RSO B;  2CK3 G;  4MVZ A;  1XI1 A;  1V54 C;  3U11 A;  5LMN B;  3IC7 A;  4WFB V;  4P9O A;  4X66 O;  1R3K C;  3AG1 B;  2YSU B;  4AQY B;  2B1G A;  2XAQ A;  4LH7 A;  2GHY A;  1M57 B;  4CS3 A;  4YY3 B;  3G6E V;  2Z3Y A;  3JAR A;  2EIM C;  4FJC C;  4B7E A;  4B3M O;  5H2F Z;  1V54 B;  2Q73 A;  3QG5 A;  4IHJ B;  5CA3 A;  1YIJ V;  5EIB C;  3DGE A;  5J2T A;  4LF5 B;  5CA1 B;  4JI0 O;  3ZIA G;  2BTO A;  1YVW A;  5L3D A;  3BEH A;  2EIM B;  4LFA O;  2JEU A;  2UUC B;  4QIW F;  3O65 A;  3TJT A;  3AG7 A;  5GTI Z;  3SPG A;  4L87 A;  2EJ7 A;  4YJ3 A;  1IBK O;  3NXS A;  4CBC A;  1MZF A;  1WJZ A;  1TGO A;  4LR3 A;  1KYO F;  2D2C B;  4F6R A;  2XND G;  2BOB C;  1EFR G;  1S5H C;  2IJJ A;  4JI7 B;  3ASO C;  1MOF A;  4FZ1 A;  3CC7 V;  1US6 A;  2KB1 A;  2EIL C;  4I5S A;  1MSD A;  3B8N A;  4K3A A;  3THO A;  1Q43 A;  1Q8I A;  4GX2 A;  2CTQ A;  5JVD B;  3VQW A;  2E75 B;  3ASO B;  3E35 A;  4LC1 A;  5B66 Z;  4Z1V A;  1S76 D;  2X0L A;  1J5E O;  5BR8 O;  1NVP D;  1ZAU A;  2EIL B;  2Z0A A;  3E8B A;  1VF6 A;  4Z1M G;  5LHI A;  4DV1 O;  4CZZ A;  4ZKI A;  2RMK B;  2D3O W;  2OYQ A;  4JI4 O;  4QE9 A;  5HFL A;  4UUJ C;  2HHH B;  3H01 A;  3MDS A;  3SR2 C;  3L75 H;  4O2A B;  2QWQ B;  3HKB B;  5A2Q N;  2DMX A;  3RW0 A;  4YJ2 A;  1PL0 A;  1COW G;  4JTC B;  1NQT A;  3CCL V;  2FYU H;  5EYP A;  4QJF B;  2WLJ A;  4X9Q A;  4DXW A;  2HEP A;  4B3S B;  4TOI A;  2XTA A;  2P5O A;  3VQX A;  1SES A;  4RQF A;  3QNE A;  1XUQ A;  1JR9 A;  1AIL A;  2R9A A;  4DYL A;  2EZP A;  2V7Q G;  4MVS A;  1VQM V;  1Y76 B;  2EBO A;  1H2G A;  4W4K A;  5LXT A;  4J80 A;  3EXA A;  4GCZ A;  1AJN A;  4J7J A;  3RT3 C;  4Z2W A;  1XRE A;  1BHA A;  1QLE B;  3SPJ A;  4GKK O;  4NTY A;  3A0H Z;  2PUS A;  4OPA A;  2GTS A;  4J11 A;  3ZCC A;  1HR0 B;  1YJW V;  4DV0 O;  5KX5 A;  1NH2 D;  5CBF A;  3OE7 G;  5KAI Z;  2E5L B;  5LA6 B;  5E79 Z;  4PI2 A;  2RNB A;  2R9R B;  1A32 A;  3RYC B;  1VAR A;  3JAS B;  1O9G A;  4BAY A;  1AP6 A;  4JF3 A;  4Q6G A;  1BCC H;  2N74 A;  2HJD A;  2PZS A;  5L3G A;  1KB9 F;  1XNQ O;  1OHH G;  3SYA A;  5FLX N;  1AJQ A;  4X88 A;  1SA0 B;  1AR4 A;  3TGU H;  4DUY B;  2M7W A;  4DR1 O;  2F4V O;  3JSN A;  1KKD A;  1VQO V;  5IYC O;  2B1I A;  4WBN B;  1Y67 A;  3WFV A;  3JAK A;  4AIL C;  2A06 H;  1I94 B;  3SGI A;  1QCE A;  4X20 A;  1AJP A;  4B3R O;  1N34 O;  4TUY A;  1WB7 A;  1KP3 A;  1K9M W;  4HAM A;  3SDL A;  2F43 G;  2ZIO A;  2XAH A;  3KKY A;  2PYL A;  2CGO A;  4JZG A;  1GN2 A;  2IH3 C;  1WPX A;  3CJH B;  1IJG A;  4GT1 A;  3AK3 A;  1W0J G;  2UXC B;  5D5Q A;  1FKA O;  1OZ0 A;  3U10 A;  4MSW C;  4G28 B;  3JCZ A;  4UCT A;  2DQ3 A;  4U3J A;  1AVM A;  1QVG U;  3K5L A;  1U97 A;  1VF7 A;  3SJC C;  2JK5 C;  3JAT A;  4MTX A;  1KQS U;  1M1K W;  3TCU A;  1IXM A;  1GTO A;  4KHP O;  2F66 C;  2YC0 A;  3U0Z A;  4ZBM A;  2VQE B;  4ZHQ B;  3B4S A;  1HNX B;  1FXK A;  4GX5 A;  1BL8 A;  5C8Y B;  4IIJ A; 
#chains in the Genus database with same CATH homology
 1AP6 A;  1AR5 A;  1EM1 A;  3C3S A;  2QKC A;  4F6E A;  2ADP A;  2AW9 A;  1GN6 A;  3QVN A;  4GUN A;  4E4E A;  1MSD A;  1ZTE A;  1BS3 A;  2QKA A;  1P7G A;  1EN6 A;  1GN3 A;  2RCV A;  5A9G A;  2GDS A;  1N0J A;  1AR4 A;  3K9S A;  1AP5 A;  1SZX A;  4YIP A;  1Y67 A;  1BT8 A;  1I0H A;  1GN4 A;  1MA1 A;  3DC5 A;  3CEI A;  3LSU A;  1D5N A;  1JA8 A;  3MDS A;  3OT7 A;  1WB7 A;  3C3T A;  1WB8 A;  3KKY A;  1LUW A;  1EN4 A;  4YIO A;  4X9Q A;  1LUV A;  4JZG A;  1GN2 A;  1ZSP A;  3AK1 A;  1IXB A;  1B06 A;  2CE4 A;  1IDS A;  1XUQ A;  1JR9 A;  3AK2 A;  1QNM A;  3DC6 A;  3AK3 A;  1XIL A;  1MNG A;  1MMM A;  1BSM A;  1ZLZ A;  3RN4 A;  1AVM A;  1KKC A;  1XDC A;  1N0N A;  1ZUQ A;  1PM9 A;  3KDR A;  1XRE A;  3EVK A;  3TJT A;  2CDY A;  1IX9 A;  2P4K A;  4BR6 A;  1EN5 A;  4FFK A;  5AG2 A;  3BFR A;  1VAR A;  1I08 A;  3IC9 A;  1VEW A;  4JYY A;  4JZ2 A;  4C7U A;  1PL4 A;  2ADQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...