4GUNA

Crystal structure of the k184r, l185p mutant manganese superoxide dismutase from candida albicans cytosol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
b'ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
molecule tags Oxidoreductase
source organism Candida albicans
publication title Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
rcsb
total genus 81
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4gunA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4gunA02
4JZGA 1QNMA 1N0NA 3AK2A 4F6EA 1MMMA 4YIPA 2P4KA 1SZXA 1AR5A 1BT8A 1KKCA 1Y67A 3K9SA 1GN3A 1EN6A 1ZUQA 1B06A 3CEIA 2AW9A 1N0JA 1VARA 2ADQB 1MNGA 1PM9A 1BS3A 3BFRA 2RCVA 1LUVA 1ZTEA 3KKYA 1ZSPA 1I0HA 1EM1A 3MDSA 1GN2A 1AP5A 4FFKA 3C3TA 4YIOA 2ADPA 1MA1A 3AK1A 2CDYA 1JR9A 1WB8A 3RN4A 1BSMA 1IX9A 1XREA 1XUQA 1ZLZA 1JA8A 1GN6A 1AP6A 1P7GA 1XILA 1XDCA 1D5NA 4GUNA 1GN4A 5A9GA 1IDSA 3DC6A 3LSUA 4C7UA 4JZ2A 5AG2A 3TJTA 1VEWA 4E4EA 2CE4A 4X9QA 3IC9A 4BR6A 3AK3A 3QVNA 1I08A 3C3SA 3DC5A 2QKCA 1WB7A 2GDSA 2QKAA 1EN5A 4JYYA 1MSDA 1AR4A 1IXBA 3EVKA 1LUWA 1PL4A 3OT7A 1AVMA 1EN4A
chains in the Genus database with same CATH superfamily
2Q0AA 3RYIB 4LH6A 1A32A 2H8PC 1CEZA 5LP6A 1M9NA 3ZCCA 5HFMA 2ZR3A 4GKKO 4G2KA 5EK0A 3AG4B 5IYBO 5EYPA 2RN9A 3OTOB 1FXKA 5TISZ 2EINC 4IHJB 5DECA 4TUYB 1AJQA 4OXSA 1H2SB 2E5LB 3ZJZA 2EZPA 1VMGA 4RQEA 2N04A 1H2NA 3FX7A 4UV8A 4N21A 2VQFB 1FS0G 5JVDB 3OD4A 2K9PA 3OTOO 3RYCB 3JD3A 3E8GA 1OCRB 5GONA 4PJ0Z 3STLC 3SYCA 4J9ZB 3OM3B 4IT5A 1Y76A 5FLXN 4GUNA 4RUFA 4RO2A 1IBLB 1K3EA 3DC6A 2UUBB 2M7WA 4JI6O 3OAAG 1QCEA 4JI3O 5LYJA 1KYOF 4LR3A 1M57B 4BW9A 4LF9O 3ZMSA 3JSNA 4ABMA 4ZOLB 1K4DC 1KECA 2Q68A 3RYHB 5KA5A 4WFFA 1K8AW 1K5QA 2BSKA 3D8CA 5CA3A 2AZ0A 2YIDA 2W0XA 5JQGA 2EULA 2VS0A 3CWBH 5C8YB 2WLJA 4NR1A 1IXBA 3EVKA 4U7OA 3JALB 1KKDA 4GKJO 1JMKC 2ATKC 5HFLA 4K8ZA 4GX5A 4G27B 2X6BA 3OR6C 5JQGB 5J9PC 3ZN1A 5KLVH 1DF5A 3QNEA 1TVKA 1F4MA 4HZ3A 4QPJA 2LJ2A 1VF5B 5EC1C 3GWKC 3W7TA 5KHGA 2DYSB 1GN3A 5LGTA 5BR8B 1VF6A 4DV7O 2WA3A 4JI1B 2ZDIC 3L74H 2DWDC 2PF4E 1VQ8V 5FPOA 3B09A 3CX5F 2EINB 5IWAB 3QF7A 4JYCA 4QIWF 1OCZC 2JK5C 5GTIZ 2CTPA 2YDEA 4Z2WA 2BTOA 3SR2C 4YJ2A 3RW0A 1GK9A 5B1BB 2OIGA 4JYAO 4JI7B 4BAYA 4O4HA 5IJ9A 1XBLA 3ICXA 5CBGA 1N34B 2XAQA 1H8EG 5KHKA 4DV7B 4JF3A 1Y4MA 1AI4A 4JYBA 4GX0A 1XI1A 3SJCC 1JX9A 4DR7O 3ZRXA 2ZNIA 3ABMC 3AG2B 2WLNA 1FKAO 2PI5A 1PD3A 1BQZA 1W59A 4I50B 1GM8A 4CC6A 3APOA 5LMNB 5LBQA 4EFEA 4FVMA 4I4TA 1YJNV 2VQEO 1YHQV 4MVOA 3H1IH 5DM6V 1IBKO 5IYZB 4U3FH 1RPRA 3T4ZA 4DV5O 1RSOA 3C3SA 2UXNA 1HNXO 5LHGA 2VWKA 1PV0A 2DOSA 5LMUB 2PI4A 3K04A 2H94A 4FK5C 3LDDA 2YI8A 3DSQA 1V54C 1R3LC 3AK2A 1URFA 4LFBO 2WSSG 4TV9B 3JD2A 2QWQB 2FYUH 2JEUA 3MHSC 1CXZB 3K9SA 3CEIA 1VQMV 4F6RB 2JS3A 1KD1W 2DQ0A 2JIZG 4X1IA 1KC8W 3BFRA 2Q4PA 3K5OA 2PZSA 2UXDO 2ZE6A 2IBZH 4K35A 1YEWA 3K5MA 5JCOC 4H33A 3OMNB 4NXNB 3HKEB 5BY1A 2UU9O 4O4JB 3RVYA 3HB3B 4PHZA 3CB2A 3P30A 4O2AA 4JI0O 3FB5C 3D3IA 5KMGB 4J11A 3CRMA 1G1XB 1XUQA 2Q0OC 1BMFG 4BIUA 1Q81W 1TVKB 3T2MA 2QM8A 3AG1C 4TSFG 3CE2A 4I5SA 1K9MW 3RYFA 3B2EE 4XDLA 1D2DA 3D36C 5ITZB 4X64O 3G67A 4LF6B 1P84F 1O9GA 1CPYA 2QA4V 3CRRA 3B8NA 2XASA 1NI8A 1XOUA 2EX3A 3ASNC 1IBKB 5FPRA 1WPBA 3QO5A 2XUMA 3AG3C 2JDIG 3HKBB 3RGBA 4LH7A 3ABKB 5CB4A 1YTFB 1PL4A 3JYCA 1SQFA 3E89A 1NZ6A 1QNMA 4KHPB 4UCOA 1JJOA 1R3KC 1IBMB 2LO1A 1BT8A 4K0KO 3FB8C 4AILC 4X65O 3DXRB 1EN6A 4KP4A 2IJKA 4I7ZB 1Y66A 2BOBC 3JATB 3AG3B 2NNUA 1M56B 3M7MX 2E75B 4KL1A 2UXXA 3B8MA 2UXCB 5B1AC 1K5SA 1LUVA 4PA3A 4NXMB 1I5YA 4B3TB 3G71V 2JRIA 2H3OA 2HJFC 3R65A 3ZHSA 1JJ2U 4YIOA 2QSAA 4GKKB 2RDCA 4JI6B 3CPWU 3B40A 3BEHA 4DXWA 1VQ7V 2Q7GA 4LNUA 4WBNA 4GX1A 1N8RW 3ABKC 3WG7C 3ZEDA 4B3RO 1D5NA 2YC0A 1H38A 1IDSA 2A3QA 4GYCB 2FB5A 2ZCEA 1GO3F 4PDRA 4B3MB 1DF4A 1IVSA 2ZT9B 2RMKB 4WFHA 4DR1B 3T1YO 3W7SA 2GV9A 1ZX3A 4X9QA 1SZTA 1P7BA 1R3JC 4UCSA 4UCTA 4I9QA 4IYIA 3ABLB 3ZHTA 4FFBB 1NR7A 4LF5B 4DV4B 4O2BA 3CRAA 4H37A 3CC2V 1LUWA 5BMVA 3EFFK 1YJ9V 4CH3A 4XBFA 3TXQA 1V54B 5IDJA 1GKFA 3ZBHA 2ZIOA 4IL6Z 1AB3A 1TAEA 1S72V 2P4KA 2EIJB 4FLVA 2QJ1A 3JCZA 4I55B 3JD4A 2ZR2A 2F93B 3JD0A 2Q7EA 2P67A 2P5OA 5IYDO 4B3SO 1W0KG 3L9DA 1EFRG 5L3FA 1ZSPA 4F4LA 3EHBB 1WA8B 4ICGA 2HG5C 3TXSA 1S3JA 2EJ7A 3ML0A 1AP5A 2IU3A 2E3CA 4FZ1A 1MA1A 2Y4TA 4DUZB 1H2LA 1KBHA 1Q90D 3ZRVA 4MVQA 5KAFZ 3CMEV 2G38A 1W2BU 3CS5A 3UT5B 4B3SB 1P7GA 4DV2O 3BABA 5LOVA 4AHCA 4DR3O 2GTAA 4B08A 1SQBH 2O57A 4JYAB 1DGSA 3UM7A 3ASOB 2HJDA 1FFXA 2YIBA 4MVMA 4OX9O 1JFFA 3CSXA 1LNQA 2BTQB 1HNWB 4R7CA 1G4YB 4O2AB 2R72A 4MTOA 4JI2O 3BY6A 4QE9A 3K03A 4PDVA 2P90A 1XHXA 4DR3B 1HP8A 3QO7A 1EN5A 1H2KA 4IGGA 3K06A 2JJ2G 3UO3A 4FJCC 1AROP 1OCRC 3CCUV 1NTZH 3RYCA 1K33A 3IFXA 2X0LA 3CC7V 1QR9A 3CRCA 2N74A 4IYHA 4NB5A 1SRYA 4F6RA 1NU1H 2VQEB 3SJQC 4F6EA 5B3SB 2Y48A 5KHHA 1RM1B 1QVFU 1MMMA 5CA1A 4YXWG 3JAWB 1WAZA 4LWSB 3F7VC 3UKMA 4TOIA 4QGPA 4UCRA 4P30A 4JI3B 3CRQA 4YJ3B 2KB1A 1BS3A 3PN1A 5JJNB 1JVMA 3L71H 1SESA 1R1BA 3TK1A 1XMQO 3JAKA 2QWRB 1BHAA 2BSKB 3C90A 1S5HC 2GUZB 3N2GA 1V55C 2RQ6A 1KU9A 4PD4F 3AG1B 3QTCA 3K57A 3DXRA 1N34O 3N2GB 1XL4A 4DR7B 1JA8A 4J7KA 5LGUA 2LW7A 3T4DA 4UVBA 3T1HO 3RYHA 2LFRA 1IJGA 4PDLA 1KMIZ 3G6BA 4EB6B 1VQPV 4JI8B 4FFBA 4LP8A 2AGAA 3VQWA 1GH6A 5BR8O 3A0BZ 3ZHVA 2DWEC 2OWOA 1MG1A 4UUJC 4PA9A 4JI0B 4JI5B 1Q43A 3IC9A 5JVDA 4BR6A 1S0VA 4JAAA 2UUAB 4K8XA 3B4SA 2M6YA 1N33O 2KG7B 1ENVA 1IXMA 5GONB 5CA0B 4O4HB 5IJ9B 3GVMA 5IY5C 1NVPB 4CH4A 2HVJC 5LL6Y 4DR1O 3T1YB 1V55B 3ZRWA 1M5IA 3A2FA 3GWOA 1K7DA 2F23A 5L3GA 3J7AU 1FXKC 1B3QA 4DR2O 2F1MA 2ZQMA 5IY5B 3CCSV 3M8AA 1KKCA 4I50A 4NTXA 2LQTA 2MK3A 1VARA 5LP6C 4LC1A 4FLZA 1MNGA 4NVPA 5DEDA 1PM9A 4W4KA 4OX9B 4X1KB 3NXSA 3OR7C 4I4TB 1PNKA 3LSQA 4RUEA 5JH7A 1DK1A 1HNWO 2Q69A 2RCVA 3LSSA 1FXHA 3O9OA 1L0NH 3E83A 4J7ZA 1KUQA 3OEEG 2HHHB 2FTKA 4JV5O 3F7YC 3I5DA 1IBMO 1TUEB 3SYQA 2ZIMA 5L3BA 4MTXA 5KHJA 1WB8A 2F4VB 2Z0AA 3CP1A 3SDLA 5LGNA 3ETDA 2PYLA 4KUMA 1BGYH 2KG7A 4TV8A 5H5NA 3JAMN 2IM9A 1AP6A 3ABLC 3JASA 5B5EZ 2Y0IA 1HNXB 3CXCU 2DN9A 1Z5VA 1YVWA 4DV4O 1Y76B 4JV5B 2WAMA 2V7QG 5GW7A 1OCZB 4JZ2A 1TA8A 4Q20A 3BAAA 3TJTA 4H13B 3A0RA 4DK0A 3CCJV 1K92A 1I08A 2IU0A 3O65A 4B3RB 4RQFA 2QKAA 2VQFO 3WG7B 5H9CA 1QHTA 4QPKA 2N05A 1V9PA 5KMGA 4Q6GA 2JGDB 3UQ8A 2Q67A 1D5AA 3OT7A 1VQ6V 1COWG 4MTFA 1Q7YW 2FMLA 1EZJA 2ZM6O 4ZKIA 4FIPC 1KQSU 4YIPA 1VQ4V 4O4JA 4Z1MG 2E76B 4I9WA 4KXRA 4DR2B 1UJWB 2AHYA 5B1OA 2AW9A 1WA8A 2CTQA 1UPGA 1L0LH 2ZKOA 4J9YB 2QR4A 1EBOA 3W7UA 5LA6B 4NYKA 1Y74B 1IURA 5LHIA 1R6NA 1R73A 1N33B 1SF9A 3K59A 3BVOA 1BE3H 3MAQA 4PA7A 3MD0A 5KX5B 2QGNA 4DV3O 4DR6B 4DUYB 3AK1A 2CDYA 4W4LA 1JCHA 1YF2A 5KUKA 5KUMA 4D7TA 2XAGA 4LBEC 5KX5A 4YJ3A 2Y0PA 2Y69B 4L8JA 5D5QA 5K1XA 4DO2A 1HDJA 1OCCB 4RAIA 3ZHQA 1IBLO 2F66C 3ETGA 4JTDB 3E22B 1S5JA 5LYJB 4C7UA 1ORQC 2YXHA 3VQVA 4O4LA 4E4EA 2IH1C 2YEVA 5FNVB 3JARA 3N27A 2WLKA 2IH3C 1S76D 4OPHA 3CCEV 2HP8A 4WCEV 1I5XA 2DW4A 2QWPB 4JI7O 2HHHO 2YEVB 2ETNA 5KA6A 4EB6A 1M1KW 1JNBA 1YJWV 2XAHA 3VBBA 1MSDA 5H6QA 5L3DA 5JJEB 3RYFB 4PI0A 3SPHA 5ITZA 2WA4A 1WP7A 1N36B 3CC4V 1P49A 1N0NA 5FL7G 1OV9A 3W7XA 3KZIZ 1EZVH 1US6A 5B66Z 1YZBA 4NKGB 1M56C 4LF7B 4G28B 3OGCC 2ADQB 2Q73A 4PI2A 2XT9A 4CS3A 4FZ0A 1GTOA 4UCVA 2BOCC 3SYPA 1N32B 3ASNB 3P3NA 4DW1A 1F4NA 1GM9A 2VRZA 1EM1A 2YXYA 2K1EA 1RM1C 4MW3A 2AZ2A 1XNRO 4QNHB 1VQLV 3JARB 1NVPD 3J80N 2OTLV 1YIJV 2BE3A 3FAVA 1NJIW 4X1KA 2HFEC 1SC5B 3G6EV 4LFBB 1XILA 4LFCB 5K1PA 2CH7B 4MSWC 2QDOA 4JTAB 4RWUA 3LSUA 2JVDA 5CN0A 5B1NA 2ZE7A 3ABUA 3K08A 3DTUB 1VEWA 2IW5A 4CBCA 1SQVH 3CJHA 2GHYA 3IAYA 1RSOB 1MZEA 3HKCA 4TQDA 4LF4B 2JGUA 3T1HB 1Q3EA 4WFBV 3DC5A 1GM7A 4LNUB 4D7SA 1E1QG 1OCOB 3ABMB 4PV1B 4JI4O 1FJGB 1NR1A 4X65B 3E8FA 4DV6B 3JCUZ 4JYYA 4EKWA 2P22C 3Q4HB 4P2ZA 4J7JA 1QLEB 3IJ4A 5LHHA 4BWAA 1J5EB 2KSDA 2P06A 3HR0A 1AI5A 2F43G 5D5PA 1AJNA 1Q8IA 4X1YB 3K5LA 2DYRC 3PJSK 4DUZO 4MVRA 2XNDG 1MZFA 1ZUQA 4JI4B 1FFXB 1S77D 2QM7A 4UVCA 4A5UB 5JCOA 4LF6O 4JAUA 4U3JA 3HPLC 3KKYA 2QWOB 4ZI7A 1HWYA 3BHPA 4Z1VA 1B04A 1PNMA 4BIOA 3W7WA 1PKXA 4WF9V 4FFKA 1QVGU 3RFRA 3U0ZA 5E79Z 1H2GA 1QLEC 4E2LA 4DR5B 1XNQO 4B3MO 4ZI7B 1QU7A 3RN4A 3CJHB 4JI1O 3OMIB 1BSMA 4FPPA 4CZZA 1ZLZA 4I0XB 3WB0A 1WP8A 2GBOA 1HNZB 5IWAO 2D2CB 1VQ5V 3LDCA 2EJRA 5IJ0B 1ROPA 1Y74A 1MOFA 3H1LH 5EZYA 4LWSA 4OPAA 1NT2B 5LMUO 1BHBA 1XHZA 4DV3B 4DR6O 3CYOA 1Y6XA 2YUAA 4DR5O 1XNQB 2R9RB 4PELA 1SA0B 2UXCO 2UUAO 5CA0A 1KP3A 1N32O 3KCYA 3ASOC 2ZXWC 3HKBA 3K0GA 3QVNA 2Q9LA 2OTJV 2P4VA 3SPJA 2C2AA 5H6RA 3JSLA 1OCCC 3CMAV 1K4CC 1H2MA 4DRXA 1GRJA 3K0DA 4JGSA 3ZRWB 4DV6O 3MHHC 2X7RB 2Q6AA 2EIJC 3E22A 1U97A 2XTAA 2DYRB 5LMNO 1QLNA 4GKJB 3FD9A 1TUBA 4FLXA 1JOYA 3ABTA 1HW7A 5KHIA 2UU9B 2ITCC 4R50A 4DV5B 2FKXA 4JAVA 4MS2A 4NTWA 1VQ9V 1I94O 3ZMZA 1YTFD 2W0FC 2CUGA 3CXHF 3WB2A 2LGQA 1DLBA 3RVZA 4GX2A 1OHHG 1I0HA 4B7EA 3ZHRA 3ZS8C 3MDSA 4X89A 2R9AA 3AG2C 1OJHA 1X59A 5IT9N 3APQA 4FM0A 3SPGA 1I94B 4LF8O 3DGEA 1IX9A 2B1IA 3E35A 2QEXV 2QTSA 4U7NA 1GMGA 5J2UB 4IIJB 3SYAA 3F5WC 3M99B 3TGUH 4FLUA 5FNVA 2YXLA 2ZE8A 5LOVB 4IIJA 5EIBD 2XOKG 1SQGA 4L87A 3ETEA 2Q7HA 4MVUA 3B77A 2OIEA 4GLXA 4DV0B 4O2BB 5IYCO 1NQTA 2Q8VA 1MSWD 4O4IA 2GDSA 1H8HG 4MTGA 5BMVB 5IYZA 2DJVA 2OCCB 4UB6Z 1AR4A 3OUSA 2JS5A 3ZMTA 5JH7B 2ARHA 2R70A 3K58A 1EN4A 5IJ0A 2QM4A 3KG2A 4X20A 4YY3B 1WJZA 2EBOA 2PUSA 2HKOA 4GT1A 1AR5A 4EEQA 1E1RG 4TV9A 3X2QC 1YXBA 4X20B 1K34A 3HKDB 4R6ZA 2XAFA 4MT8A 2PYJA 3EXAA 4X62B 3Q4HA 4X1IB 2QWNB 5CMUA 2YICA 1X4TA 2KQXA 4DYLA 2CK3G 4KHPO 4XDJA 3K79A 3S3XA 1RP3B 3C3TA 4CH6A 3GB7C 4MW8A 1L8DA 3OMAB 2CGOA 3SGIA 3UT5A 1NS1A 4JASA 1SA0A 2PTMA 3AEIA 2OCCC 1FOUA 4DV1O 3KDRA 3RYIA 4YHHO 2PY5A 4U3JB 2RNBA 3OGIB 4LFAO 1JFFB 1FFTB 5A9GA 2QE7G 4ZHQA 3QO8A 2AXTZ 4UFZA 2WLLB 2XAJA 3AG7A 1WPXA 2HR3A 4CS4A 3UCSC 2JGDA 4X64B 4TUYA 5JWPA 3FYEB 2HVKC 4IHJA 4LCUC 1YI2V 1BZKA 4DK1A 1IZ3A 1E79G 3L73H 3SPCA 2LFSA 2QKCA 1WB7A 1Z2GA 4DV0O 3K3WA 4WFEA 2WLIA 3H01A 1XNRB 4DUYO 2Y4UA 1K73W 3VQXA 3A8TA 3N2KB 5LXTB 3BRCA 1JPXA 1NH2B 4J80A 5B1BC 4ZBMA 4UB8Z 1SQQH 1HR0B 4TQFA 1SQPH 3ETQA 2AHZA 2NN4A 1N0JA 1VF6C 4CS2A 2A79B 3JAKB 1OZ0A 3X2QB 1AI6A 3CCQV 4UXNA 5BZBA 1XMQB 2EIMC 4DV2B 1FPOA 3OUFA 3ZN0A 2WLMA 1TUBB 4R8CA 4NXMO 1AR1B 3RT3C 3E86A 4ZHQB 3ZMUA 2ADPA 2Z3YA 1HR0O 5EBLC 3FKSG 2UUCO 1N4CA 1R6TA 2CH7A 2IJIA 1XMOO 3E2EA 3SPIA 1PPJH 3R66A 3STZC 3H1HH 4H44B 3NR7A 3G4SV 2JJ1G 2QKSA 1F7YA 1FYJA 3CHXA 4TV8B 3E8BA 4YJ2B 1PP9H 1R3IC 4YHHB 2UUBO 5KAIZ 2A06H 4JPRA 2YIBD 4HYOA 3N2KA 3BCCH 3QG5A 4X66O 3SYOA 4ASUG 2NLJC 1VQKV 2CTRA 3SJBC 2IJJA 2FL4A 2YS8A 1XMOB 2L35A 4FLTA 2A9HA 4WFAV 1T5EA 2CTWA 3OTFA 4KFMA 1G6UA 2E74B 2DMXA 2E5LO 3FAVB 1AVMA 1GAXA 3SJAC 1YITV 2EIKB 4CC5A 1YCIA 2ZE5A 1Q86W 5C8YA 3RWRD 2ZDIA 4DV1B 3I56V 4B7KA 2UXBB 3VOUA 2R9IA 1I7FA 4JI2B 2YIAA 3JATA 2P7TC 1ZWIC 3WB1A 1O9HA 5LP6B 1TGOA 4H0LB 1YDXA 2ZINA 2ZNJA 1RFYA 2BTQA 3IGAC 1J95A 2GTSA 5EC2C 3P3PA 3ZRSA 1FXKB 4PA4A 3AG4C 2P6JA 1GN2A 1AJPA 2Z5UA 2X6CA 2UXBO 1THZA 3A0HZ 4MVZA 5B3SC 1ZL8B 3L75H 1P4RA 1W0JG 3I55V 4HAMA 2OT5A 1G8MA 1SETA 2OCHA 1M93A 3BA9A 2OYQA 2EILB 2UUCB 1F23A 3FB6C 4JI5O 4LF9B 1HNZO 1WNSA 4FLYA 1WN7A 4TWKA 4PA6A 5EBMC 2UXDB 1NBMG 4XDKA 2ZXWB 2W6IG 1FXVA 1QBZA 3HKEA 2EILC 5CA1B 3CD6V 3JAWA 4AQYB 3H9VA 3BA8A 2CGNA 2HEPA 3BPZA 3G80A 1XEQA 4O4IB 4FM2A 3LNMB 4LF8B 1FD9A 4J41A 5L3EA 1AI7A 3AK3A 4ZIBA 3U11A 5EYPB 2DYSC 1NTMH 2GUZA 4JI8O 3FFQA 1M4UA 4AQYO 3FB7C 4ZOLA 3IC7A 4TT3G 3ZIAG 2Y69C 2XHBA 1ZAUA 4X62O 1BL8A 4B3TO 4FM1A 3HKDA 3D36A 1JQ0A 3OW2U 3K9AA 2RJZA 3CCMV 2EIMB 3LNNA 4FMTA 1YSCA 4MVSA 1Y67A 2V1DA 3KCXA 2WLIB 1FJGO 4LF5O 1Q6IA 3TCUA 3J81N 4WFGA 2F4VO 4J10A 3L72H 1OCOC 1H5WA 1WLEA 1QR8A 1J5EO 3P32A 4QE7A 3K5NA 4K3AA 1Q6HA 4NXNO 1SQXH 4DR4O 2EIKC 4D6TH 5EZYB 4HNAA 1SERA 3CCRV 4X1YA 1VQOV 2DQ3A 5EBWC 1XL6A 5F2VO 2NR5A 4EFBA 1JR9A 2CAZC 3F5TA 5JJJB 3OE7G 4P9PA 1XREA 2D3OW 5CB4B 4FLWA 4LF4O 2JEXA 2WLLA 2BCCH 3U10A 1LR1A 1F51A 2B5UA 2V4DA 1GN4A 1B6QA 4O4LB 3THOA 4DRXB 1KB9F 2ILMA 5L3CA 4JTCB 5AG2A 2IJHA 1U96A 1NH2D 5LA6A 2YI9A 3WU2Z 2ZM6B 2MW2B 4BIZA 3T1CA 5DN6G 4WBNB 2L6LA 4AI8A 2EZOA 4I0XA 3H1KH 1Q82W 3HKCB 1Z5WA 4J42A 4NTYA 4LFAB 1NTKH 2YSUB 1SS3A 3FYIB 2W6JG 5EIBC 5IE9A 2VWJA 1N36O 1NKDA 4X88A 5CBHA 3CCVV 4JZGA 3LUTB 5BXZA 2Q5ZA 4BW5A 1QQCA 1K97A 2QTOA 1KP2A 2A0LA 4HNAB 4K0KB 3VQYA 4GZRB 1SZXA 1PNLA 2LP7A 1Q5OA 2GSMB 2WPDG 3LDEA 4GCZA 1B06A 3TETA 1M90W 2LGWA 5B1AB 3OFNG 4PDMA 5C93A 3L70H 3JALA 1Q6UA 2ZD9A 1M57C 3JD1A 4UV9A 1ZTEA 5J2UA 5J2TB 1VIBA 3ZX6A 2ITDC 1MABG 4DR4B 1CP9A 5GTHZ 1R6KA 4CH5A 5H2FZ 5J2TA 1FAFA 3H1JH 4UCUA 3UO2A 4X66B 3D3QA 3WFVA 2B1GA 1GN6A 2X6AA 4LFCO 3ZHUA 2A7WA 1XDCA 4YY3O 1VP7A 3RBZA 1BQ0A 1PL0A 2ODMA 1RPOA 3JASB 1DTOA 2KKWA 3S3WA 4I55A 3CCLV 4QJFB 4P9OA 2PGGA 1ZL8A 4N23A 2CE4A 1AILA 1L1FA 1VF7A 4UVAA 1UFIA 3E8HA 2DE0X 4OGQB 4HBNA 1S5LZ 2WWWA 2LW1A 3ZMVA 1XQ8A 5CBFA 4LF7O 3OEHG 2WLHA 1BCCH 5E1AC 5LXTA 5A2QN 1VQNV 1SKVA 4DW0A 2F95B 2B9ZA 2HLDG 4X8AA
chains in the Genus database with same CATH topology
4JZGA 1QNMA 1N0NA 3AK2A 4F6EA 1MMMA 4YIPA 2P4KA 1SZXA 1AR5A 1BT8A 1KKCA 1Y67A 3K9SA 1GN3A 1EN6A 1ZUQA 1B06A 3CEIA 2AW9A 1N0JA 1VARA 2ADQB 1MNGA 1PM9A 1BS3A 3BFRA 2RCVA 1LUVA 1ZTEA 3KKYA 1ZSPA 1I0HA 1EM1A 3MDSA 1GN2A 1AP5A 4FFKA 3C3TA 4YIOA 2ADPA 1MA1A 3AK1A 2CDYA 1JR9A 1WB8A 3RN4A 1BSMA 1IX9A 1XREA 1XUQA 1ZLZA 1JA8A 1GN6A 1AP6A 1P7GA 1XILA 1XDCA 3KDRA 1D5NA 4GUNA 1GN4A 5A9GA 1IDSA 3DC6A 3LSUA 4C7UA 4JZ2A 5AG2A 3TJTA 1VEWA 4E4EA 2CE4A 4X9QA 3IC9A 4BR6A 3AK3A 3QVNA 1I08A 3C3SA 3DC5A 2QKCA 1WB7A 2GDSA 2QKAA 1EN5A 4JYYA 1MSDA 1AR4A 1IXBA 3EVKA 1LUWA 1PL4A 3OT7A 1AVMA 1EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZG A;  1QNM A;  1N0N A;  3AK2 A;  4F6E A;  1MMM A;  4YIP A;  2P4K A;  1SZX A;  1AR5 A;  1BT8 A;  1KKC A;  1Y67 A;  3K9S A;  1GN3 A;  1EN6 A;  1ZUQ A;  1B06 A;  3CEI A;  2AW9 A;  1N0J A;  1VAR A;  2ADQ B;  1MNG A;  1PM9 A;  1BS3 A;  3BFR A;  2RCV A;  1LUV A;  1ZTE A;  3KKY A;  1ZSP A;  1I0H A;  1EM1 A;  3MDS A;  1GN2 A;  1AP5 A;  4FFK A;  3C3T A;  4YIO A;  2ADP A;  1MA1 A;  3AK1 A;  2CDY A;  1JR9 A;  1WB8 A;  3RN4 A;  1BSM A;  1IX9 A;  1XRE A;  1XUQ A;  1ZLZ A;  1JA8 A;  1GN6 A;  1AP6 A;  1P7G A;  1XIL A;  1XDC A;  1D5N A;  4GUN A;  1GN4 A;  5A9G A;  1IDS A;  3DC6 A;  3LSU A;  4C7U A;  4JZ2 A;  5AG2 A;  3TJT A;  1VEW A;  4E4E A;  2CE4 A;  4X9Q A;  3IC9 A;  4BR6 A;  3AK3 A;  3QVN A;  1I08 A;  3C3S A;  3DC5 A;  2QKC A;  1WB7 A;  2GDS A;  2QKA A;  1EN5 A;  4JYY A;  1MSD A;  1AR4 A;  1IXB A;  3EVK A;  1LUW A;  1PL4 A;  3OT7 A;  1AVM A;  1EN4 A; 
#chains in the Genus database with same CATH topology
 2Q0A A;  3RYI B;  4LH6 A;  1A32 A;  2H8P C;  1CEZ A;  5LP6 A;  1M9N A;  3ZCC A;  5HFM A;  2ZR3 A;  4GKK O;  4G2K A;  5EK0 A;  3AG4 B;  5IYB O;  5EYP A;  2RN9 A;  3OTO B;  1FXK A;  5TIS Z;  2EIN C;  4IHJ B;  5DEC A;  4TUY B;  1AJQ A;  4OXS A;  1H2S B;  2E5L B;  3ZJZ A;  2EZP A;  1VMG A;  4RQE A;  2N04 A;  1H2N A;  3FX7 A;  4UV8 A;  4N21 A;  2VQF B;  1FS0 G;  5JVD B;  3OD4 A;  2K9P A;  3OTO O;  3RYC B;  3JD3 A;  3E8G A;  1OCR B;  5GON A;  4PJ0 Z;  3STL C;  3SYC A;  4J9Z B;  3OM3 B;  4IT5 A;  1Y76 A;  5FLX N;  4GUN A;  4RUF A;  4RO2 A;  1IBL B;  1K3E A;  3DC6 A;  2UUB B;  2M7W A;  4JI6 O;  3OAA G;  1QCE A;  4JI3 O;  5LYJ A;  1KYO F;  4LR3 A;  1M57 B;  4BW9 A;  4LF9 O;  3ZMS A;  3JSN A;  4ABM A;  4ZOL B;  1K4D C;  1KEC A;  2Q68 A;  3RYH B;  5KA5 A;  4WFF A;  1K8A W;  1K5Q A;  2BSK A;  3D8C A;  5CA3 A;  2AZ0 A;  2YID A;  2W0X A;  5JQG A;  2EUL A;  2VS0 A;  3CWB H;  5C8Y B;  2WLJ A;  4NR1 A;  1IXB A;  3EVK A;  4U7O A;  3JAL B;  1KKD A;  4GKJ O;  1JMK C;  2ATK C;  5HFL A;  4K8Z A;  4GX5 A;  4G27 B;  2X6B A;  3OR6 C;  5JQG B;  5J9P C;  3ZN1 A;  5KLV H;  1DF5 A;  3QNE A;  1TVK A;  1F4M A;  4HZ3 A;  4QPJ A;  2LJ2 A;  1VF5 B;  5EC1 C;  3GWK C;  3W7T A;  5KHG A;  2DYS B;  1GN3 A;  5LGT A;  5BR8 B;  1VF6 A;  4DV7 O;  2WA3 A;  4JI1 B;  2ZDI C;  3L74 H;  2DWD C;  2PF4 E;  1VQ8 V;  5FPO A;  3B09 A;  3CX5 F;  2EIN B;  5IWA B;  3QF7 A;  4JYC A;  4QIW F;  1OCZ C;  2JK5 C;  5GTI Z;  2CTP A;  2YDE A;  4Z2W A;  2BTO A;  3SR2 C;  4YJ2 A;  3RW0 A;  1GK9 A;  5B1B B;  2OIG A;  4JYA O;  4JI7 B;  4BAY A;  4O4H A;  5IJ9 A;  1XBL A;  3ICX A;  5CBG A;  1N34 B;  2XAQ A;  1H8E G;  5KHK A;  4DV7 B;  4JF3 A;  1Y4M A;  1AI4 A;  4JYB A;  4GX0 A;  1XI1 A;  3SJC C;  1JX9 A;  4DR7 O;  3ZRX A;  2ZNI A;  3ABM C;  3AG2 B;  2WLN A;  1FKA O;  2PI5 A;  1PD3 A;  1BQZ A;  1W59 A;  4I50 B;  1GM8 A;  4CC6 A;  3APO A;  5LMN B;  5LBQ A;  4EFE A;  4FVM A;  4I4T A;  1YJN V;  2VQE O;  1YHQ V;  4MVO A;  3H1I H;  5DM6 V;  1IBK O;  5IYZ B;  4U3F H;  1RPR A;  3T4Z A;  4DV5 O;  1RSO A;  3C3S A;  2UXN A;  1HNX O;  5LHG A;  2VWK A;  1PV0 A;  2DOS A;  5LMU B;  2PI4 A;  3K04 A;  2H94 A;  4FK5 C;  3LDD A;  2YI8 A;  3DSQ A;  1V54 C;  1R3L C;  3AK2 A;  1URF A;  4LFB O;  2WSS G;  4TV9 B;  3JD2 A;  2QWQ B;  2FYU H;  2JEU A;  3MHS C;  1CXZ B;  3K9S A;  3CEI A;  1VQM V;  4F6R B;  2JS3 A;  1KD1 W;  2DQ0 A;  2JIZ G;  4X1I A;  1KC8 W;  3BFR A;  2Q4P A;  3K5O A;  2PZS A;  2UXD O;  2ZE6 A;  2IBZ H;  4K35 A;  1YEW A;  3K5M A;  5JCO C;  4H33 A;  3OMN B;  4NXN B;  3HKE B;  5BY1 A;  2UU9 O;  4O4J B;  3RVY A;  3HB3 B;  4PHZ A;  3CB2 A;  3P30 A;  4O2A A;  4JI0 O;  3FB5 C;  3D3I A;  5KMG B;  4J11 A;  3CRM A;  1G1X B;  1XUQ A;  2Q0O C;  1BMF G;  4BIU A;  1Q81 W;  1TVK B;  3T2M A;  2QM8 A;  3AG1 C;  4TSF G;  3CE2 A;  4I5S A;  1K9M W;  3RYF A;  3B2E E;  4XDL A;  1D2D A;  3D36 C;  5ITZ B;  4X64 O;  3G67 A;  4LF6 B;  1P84 F;  1O9G A;  1CPY A;  2QA4 V;  3CRR A;  3B8N A;  2XAS A;  1NI8 A;  1XOU A;  2EX3 A;  3ASN C;  1IBK B;  5FPR A;  1WPB A;  3QO5 A;  2XUM A;  3AG3 C;  2JDI G;  3HKB B;  3RGB A;  4LH7 A;  3ABK B;  5CB4 A;  1YTF B;  1PL4 A;  3JYC A;  1SQF A;  3E89 A;  1NZ6 A;  1QNM A;  4KHP B;  4UCO A;  1JJO A;  1R3K C;  1IBM B;  2LO1 A;  1BT8 A;  4K0K O;  3FB8 C;  4AIL C;  4X65 O;  3DXR B;  1EN6 A;  4KP4 A;  2IJK A;  4I7Z B;  1Y66 A;  2BOB C;  3JAT B;  3AG3 B;  2NNU A;  1M56 B;  3M7M X;  2E75 B;  4KL1 A;  2UXX A;  3B8M A;  2UXC B;  5B1A C;  1K5S A;  1LUV A;  4PA3 A;  4NXM B;  1I5Y A;  4B3T B;  3G71 V;  2JRI A;  2H3O A;  2HJF C;  3R65 A;  3ZHS A;  1JJ2 U;  4YIO A;  2QSA A;  4GKK B;  2RDC A;  4JI6 B;  3CPW U;  3B40 A;  3BEH A;  4DXW A;  1VQ7 V;  2Q7G A;  4LNU A;  4WBN A;  4GX1 A;  1N8R W;  3ABK C;  3WG7 C;  3ZED A;  4B3R O;  1D5N A;  2YC0 A;  1H38 A;  1IDS A;  2A3Q A;  4GYC B;  2FB5 A;  2ZCE A;  1GO3 F;  4PDR A;  4B3M B;  1DF4 A;  1IVS A;  2ZT9 B;  2RMK B;  4WFH A;  4DR1 B;  3T1Y O;  3W7S A;  2GV9 A;  1ZX3 A;  4X9Q A;  1SZT A;  1P7B A;  1R3J C;  4UCS A;  4UCT A;  4I9Q A;  4IYI A;  3ABL B;  3ZHT A;  4FFB B;  1NR7 A;  4LF5 B;  4DV4 B;  4O2B A;  3CRA A;  4H37 A;  3CC2 V;  1LUW A;  5BMV A;  3EFF K;  1YJ9 V;  4CH3 A;  4XBF A;  3TXQ A;  1V54 B;  5IDJ A;  1GKF A;  3ZBH A;  2ZIO A;  4IL6 Z;  1AB3 A;  1TAE A;  1S72 V;  2P4K A;  2EIJ B;  4FLV A;  2QJ1 A;  3JCZ A;  4I55 B;  3JD4 A;  2ZR2 A;  2F93 B;  3JD0 A;  2Q7E A;  2P67 A;  2P5O A;  5IYD O;  4B3S O;  1W0K G;  3L9D A;  1EFR G;  5L3F A;  1ZSP A;  4F4L A;  3EHB B;  1WA8 B;  4ICG A;  2HG5 C;  3TXS A;  1S3J A;  2EJ7 A;  3ML0 A;  1AP5 A;  2IU3 A;  2E3C A;  4FZ1 A;  1MA1 A;  2Y4T A;  4DUZ B;  1H2L A;  1KBH A;  1Q90 D;  3ZRV A;  4MVQ A;  5KAF Z;  3CME V;  2G38 A;  1W2B U;  3CS5 A;  3UT5 B;  4B3S B;  1P7G A;  4DV2 O;  3BAB A;  5LOV A;  4AHC A;  4DR3 O;  2GTA A;  4B08 A;  1SQB H;  2O57 A;  4JYA B;  1DGS A;  3UM7 A;  3ASO B;  2HJD A;  1FFX A;  2YIB A;  4MVM A;  4OX9 O;  1JFF A;  3CSX A;  1LNQ A;  2BTQ B;  1HNW B;  4R7C A;  1G4Y B;  4O2A B;  2R72 A;  4MTO A;  4JI2 O;  3BY6 A;  4QE9 A;  3K03 A;  4PDV A;  2P90 A;  1XHX A;  4DR3 B;  1HP8 A;  3QO7 A;  1EN5 A;  1H2K A;  4IGG A;  3K06 A;  2JJ2 G;  3UO3 A;  4FJC C;  1ARO P;  1OCR C;  3CCU V;  1NTZ H;  3RYC A;  1K33 A;  3IFX A;  2X0L A;  3CC7 V;  1QR9 A;  3CRC A;  2N74 A;  4IYH A;  4NB5 A;  1SRY A;  4F6R A;  1NU1 H;  2VQE B;  3SJQ C;  4F6E A;  5B3S B;  2Y48 A;  5KHH A;  1RM1 B;  1QVF U;  1MMM A;  5CA1 A;  4YXW G;  3JAW B;  1WAZ A;  4LWS B;  3F7V C;  3UKM A;  4TOI A;  4QGP A;  4UCR A;  4P30 A;  4JI3 B;  3CRQ A;  4YJ3 B;  2KB1 A;  1BS3 A;  3PN1 A;  5JJN B;  1JVM A;  3L71 H;  1SES A;  1R1B A;  3TK1 A;  1XMQ O;  3JAK A;  2QWR B;  1BHA A;  2BSK B;  3C90 A;  1S5H C;  2GUZ B;  3N2G A;  1V55 C;  2RQ6 A;  1KU9 A;  4PD4 F;  3AG1 B;  3QTC A;  3K57 A;  3DXR A;  1N34 O;  3N2G B;  1XL4 A;  4DR7 B;  1JA8 A;  4J7K A;  5LGU A;  2LW7 A;  3T4D A;  4UVB A;  3T1H O;  3RYH A;  2LFR A;  1IJG A;  4PDL A;  1KMI Z;  3G6B A;  4EB6 B;  1VQP V;  4JI8 B;  4FFB A;  4LP8 A;  2AGA A;  3VQW A;  1GH6 A;  5BR8 O;  3A0B Z;  3ZHV A;  2DWE C;  2OWO A;  1MG1 A;  4UUJ C;  4PA9 A;  4JI0 B;  4JI5 B;  1Q43 A;  3IC9 A;  5JVD A;  4BR6 A;  1S0V A;  4JAA A;  2UUA B;  4K8X A;  3B4S A;  2M6Y A;  1N33 O;  2KG7 B;  1ENV A;  1IXM A;  5GON B;  5CA0 B;  4O4H B;  5IJ9 B;  3GVM A;  5IY5 C;  1NVP B;  4CH4 A;  2HVJ C;  5LL6 Y;  4DR1 O;  3T1Y B;  1V55 B;  3ZRW A;  1M5I A;  3A2F A;  3GWO A;  1K7D A;  2F23 A;  5L3G A;  3J7A U;  1FXK C;  1B3Q A;  4DR2 O;  2F1M A;  2ZQM A;  5IY5 B;  3CCS V;  3M8A A;  1KKC A;  4I50 A;  4NTX A;  2LQT A;  2MK3 A;  1VAR A;  5LP6 C;  4LC1 A;  4FLZ A;  1MNG A;  4NVP A;  5DED A;  1PM9 A;  4W4K A;  4OX9 B;  4X1K B;  3NXS A;  3OR7 C;  4I4T B;  1PNK A;  3LSQ A;  4RUE A;  5JH7 A;  1DK1 A;  1HNW O;  2Q69 A;  2RCV A;  3LSS A;  1FXH A;  3O9O A;  1L0N H;  3E83 A;  4J7Z A;  1KUQ A;  3OEE G;  2HHH B;  2FTK A;  4JV5 O;  3F7Y C;  3I5D A;  1IBM O;  1TUE B;  3SYQ A;  2ZIM A;  5L3B A;  4MTX A;  5KHJ A;  1WB8 A;  2F4V B;  2Z0A A;  3CP1 A;  3SDL A;  5LGN A;  3ETD A;  2PYL A;  4KUM A;  1BGY H;  2KG7 A;  4TV8 A;  5H5N A;  3JAM N;  2IM9 A;  1AP6 A;  3ABL C;  3JAS A;  5B5E Z;  2Y0I A;  1HNX B;  3CXC U;  2DN9 A;  1Z5V A;  1YVW A;  4DV4 O;  1Y76 B;  4JV5 B;  2WAM A;  2V7Q G;  5GW7 A;  1OCZ B;  4JZ2 A;  1TA8 A;  4Q20 A;  3BAA A;  3TJT A;  4H13 B;  3A0R A;  4DK0 A;  3CCJ V;  1K92 A;  1I08 A;  2IU0 A;  3O65 A;  4B3R B;  4RQF A;  2QKA A;  2VQF O;  3WG7 B;  5H9C A;  1QHT A;  4QPK A;  2N05 A;  1V9P A;  5KMG A;  4Q6G A;  2JGD B;  3UQ8 A;  2Q67 A;  1D5A A;  3OT7 A;  1VQ6 V;  1COW G;  4MTF A;  1Q7Y W;  2FML A;  1EZJ A;  2ZM6 O;  4ZKI A;  4FIP C;  1KQS U;  4YIP A;  1VQ4 V;  4O4J A;  4Z1M G;  2E76 B;  4I9W A;  4KXR A;  4DR2 B;  1UJW B;  2AHY A;  5B1O A;  2AW9 A;  1WA8 A;  2CTQ A;  1UPG A;  1L0L H;  2ZKO A;  4J9Y B;  2QR4 A;  1EBO A;  3W7U A;  5LA6 B;  4NYK A;  1Y74 B;  1IUR A;  5LHI A;  1R6N A;  1R73 A;  1N33 B;  1SF9 A;  3K59 A;  3BVO A;  1BE3 H;  3MAQ A;  4PA7 A;  3MD0 A;  5KX5 B;  2QGN A;  4DV3 O;  4DR6 B;  4DUY B;  3AK1 A;  2CDY A;  4W4L A;  1JCH A;  1YF2 A;  5KUK A;  5KUM A;  4D7T A;  2XAG A;  4LBE C;  5KX5 A;  4YJ3 A;  2Y0P A;  2Y69 B;  4L8J A;  5D5Q A;  5K1X A;  4DO2 A;  1HDJ A;  1OCC B;  4RAI A;  3ZHQ A;  1IBL O;  2F66 C;  3ETG A;  4JTD B;  3E22 B;  1S5J A;  5LYJ B;  4C7U A;  1ORQ C;  2YXH A;  3VQV A;  4O4L A;  4E4E A;  2IH1 C;  2YEV A;  5FNV B;  3JAR A;  3N27 A;  2WLK A;  2IH3 C;  1S76 D;  4OPH A;  3CCE V;  2HP8 A;  4WCE V;  1I5X A;  2DW4 A;  2QWP B;  4JI7 O;  2HHH O;  2YEV B;  2ETN A;  5KA6 A;  4EB6 A;  1M1K W;  1JNB A;  1YJW V;  2XAH A;  3VBB A;  1MSD A;  5H6Q A;  5L3D A;  5JJE B;  3RYF B;  4PI0 A;  3SPH A;  5ITZ A;  2WA4 A;  1WP7 A;  1N36 B;  3CC4 V;  1P49 A;  1N0N A;  5FL7 G;  1OV9 A;  3W7X A;  3KZI Z;  1EZV H;  1US6 A;  5B66 Z;  1YZB A;  4NKG B;  1M56 C;  4LF7 B;  4G28 B;  3OGC C;  2ADQ B;  2Q73 A;  4PI2 A;  2XT9 A;  4CS3 A;  4FZ0 A;  1GTO A;  4UCV A;  2BOC C;  3SYP A;  1N32 B;  3ASN B;  3P3N A;  4DW1 A;  1F4N A;  1GM9 A;  2VRZ A;  1EM1 A;  2YXY A;  2K1E A;  1RM1 C;  4MW3 A;  2AZ2 A;  1XNR O;  4QNH B;  1VQL V;  3JAR B;  1NVP D;  3J80 N;  2OTL V;  1YIJ V;  2BE3 A;  3FAV A;  1NJI W;  4X1K A;  2HFE C;  1SC5 B;  3G6E V;  4LFB B;  1XIL A;  4LFC B;  5K1P A;  2CH7 B;  4MSW C;  2QDO A;  4JTA B;  4RWU A;  3LSU A;  2JVD A;  5CN0 A;  5B1N A;  2ZE7 A;  3ABU A;  3K08 A;  3DTU B;  1VEW A;  2IW5 A;  4CBC A;  1SQV H;  3CJH A;  2GHY A;  3IAY A;  1RSO B;  1MZE A;  3HKC A;  4TQD A;  4LF4 B;  2JGU A;  3T1H B;  1Q3E A;  4WFB V;  3DC5 A;  1GM7 A;  4LNU B;  4D7S A;  1E1Q G;  1OCO B;  3ABM B;  4PV1 B;  4JI4 O;  1FJG B;  1NR1 A;  4X65 B;  3E8F A;  4DV6 B;  3JCU Z;  4JYY A;  4EKW A;  2P22 C;  3Q4H B;  4P2Z A;  4J7J A;  1QLE B;  3IJ4 A;  5LHH A;  4BWA A;  1J5E B;  2KSD A;  2P06 A;  3HR0 A;  1AI5 A;  2F43 G;  5D5P A;  1AJN A;  1Q8I A;  4X1Y B;  3K5L A;  2DYR C;  3PJS K;  4DUZ O;  4MVR A;  2XND G;  1MZF A;  1ZUQ A;  4JI4 B;  1FFX B;  1S77 D;  2QM7 A;  4UVC A;  4A5U B;  5JCO A;  4LF6 O;  4JAU A;  4U3J A;  3HPL C;  3KKY A;  2QWO B;  4ZI7 A;  1HWY A;  3BHP A;  4Z1V A;  1B04 A;  1PNM A;  4BIO A;  3W7W A;  1PKX A;  4WF9 V;  4FFK A;  1QVG U;  3RFR A;  3U0Z A;  5E79 Z;  1H2G A;  1QLE C;  4E2L A;  4DR5 B;  1XNQ O;  4B3M O;  4ZI7 B;  1QU7 A;  3RN4 A;  3CJH B;  4JI1 O;  3OMI B;  1BSM A;  4FPP A;  4CZZ A;  1ZLZ A;  4I0X B;  3WB0 A;  1WP8 A;  2GBO A;  1HNZ B;  5IWA O;  2D2C B;  1VQ5 V;  3LDC A;  2EJR A;  5IJ0 B;  1ROP A;  1Y74 A;  1MOF A;  3H1L H;  5EZY A;  4LWS A;  4OPA A;  1NT2 B;  5LMU O;  1BHB A;  1XHZ A;  4DV3 B;  4DR6 O;  3CYO A;  1Y6X A;  2YUA A;  4DR5 O;  1XNQ B;  2R9R B;  4PEL A;  1SA0 B;  2UXC O;  2UUA O;  5CA0 A;  1KP3 A;  1N32 O;  3KCY A;  3ASO C;  2ZXW C;  3HKB A;  3K0G A;  3QVN A;  2Q9L A;  2OTJ V;  2P4V A;  3SPJ A;  2C2A A;  5H6R A;  3JSL A;  1OCC C;  3CMA V;  1K4C C;  1H2M A;  4DRX A;  1GRJ A;  3K0D A;  4JGS A;  3ZRW B;  4DV6 O;  3MHH C;  2X7R B;  2Q6A A;  2EIJ C;  3E22 A;  1U97 A;  2XTA A;  2DYR B;  5LMN O;  1QLN A;  4GKJ B;  3FD9 A;  1TUB A;  4FLX A;  1JOY A;  3ABT A;  1HW7 A;  5KHI A;  2UU9 B;  2ITC C;  4R50 A;  4DV5 B;  2FKX A;  4JAV A;  4MS2 A;  4NTW A;  1VQ9 V;  1I94 O;  3ZMZ A;  1YTF D;  2W0F C;  2CUG A;  3CXH F;  3WB2 A;  2LGQ A;  1DLB A;  3RVZ A;  4GX2 A;  1OHH G;  1I0H A;  4B7E A;  3ZHR A;  3ZS8 C;  3MDS A;  4X89 A;  2R9A A;  3AG2 C;  1OJH A;  1X59 A;  5IT9 N;  3APQ A;  4FM0 A;  3SPG A;  1I94 B;  4LF8 O;  3DGE A;  1IX9 A;  2B1I A;  3E35 A;  2QEX V;  2QTS A;  4U7N A;  1GMG A;  5J2U B;  4IIJ B;  3SYA A;  3F5W C;  3M99 B;  3TGU H;  4FLU A;  5FNV A;  2YXL A;  2ZE8 A;  5LOV B;  4IIJ A;  5EIB D;  2XOK G;  1SQG A;  4L87 A;  3ETE A;  2Q7H A;  4MVU A;  3B77 A;  2OIE A;  4GLX A;  4DV0 B;  4O2B B;  5IYC O;  1NQT A;  2Q8V A;  1MSW D;  4O4I A;  2GDS A;  1H8H G;  4MTG A;  5BMV B;  5IYZ A;  2DJV A;  2OCC B;  4UB6 Z;  1AR4 A;  3OUS A;  2JS5 A;  3ZMT A;  5JH7 B;  2ARH A;  2R70 A;  3K58 A;  1EN4 A;  5IJ0 A;  2QM4 A;  3KG2 A;  4X20 A;  4YY3 B;  1WJZ A;  2EBO A;  2PUS A;  2HKO A;  4GT1 A;  1AR5 A;  4EEQ A;  1E1R G;  4TV9 A;  3X2Q C;  1YXB A;  4X20 B;  1K34 A;  3HKD B;  4R6Z A;  2XAF A;  4MT8 A;  2PYJ A;  3EXA A;  4X62 B;  3Q4H A;  4X1I B;  2QWN B;  5CMU A;  2YIC A;  1X4T A;  2KQX A;  4DYL A;  2CK3 G;  4KHP O;  4XDJ A;  3K79 A;  3S3X A;  1RP3 B;  3C3T A;  4CH6 A;  3GB7 C;  4MW8 A;  1L8D A;  3OMA B;  2CGO A;  3SGI A;  3UT5 A;  1NS1 A;  4JAS A;  1SA0 A;  2PTM A;  3AEI A;  2OCC C;  1FOU A;  4DV1 O;  3KDR A;  3RYI A;  4YHH O;  2PY5 A;  4U3J B;  2RNB A;  3OGI B;  4LFA O;  1JFF B;  1FFT B;  5A9G A;  2QE7 G;  4ZHQ A;  3QO8 A;  2AXT Z;  4UFZ A;  2WLL B;  2XAJ A;  3AG7 A;  1WPX A;  2HR3 A;  4CS4 A;  3UCS C;  2JGD A;  4X64 B;  4TUY A;  5JWP A;  3FYE B;  2HVK C;  4IHJ A;  4LCU C;  1YI2 V;  1BZK A;  4DK1 A;  1IZ3 A;  1E79 G;  3L73 H;  3SPC A;  2LFS A;  2QKC A;  1WB7 A;  1Z2G A;  4DV0 O;  3K3W A;  4WFE A;  2WLI A;  3H01 A;  1XNR B;  4DUY O;  2Y4U A;  1K73 W;  3VQX A;  3A8T A;  3N2K B;  5LXT B;  3BRC A;  1JPX A;  1NH2 B;  4J80 A;  5B1B C;  4ZBM A;  4UB8 Z;  1SQQ H;  1HR0 B;  4TQF A;  1SQP H;  3ETQ A;  2AHZ A;  2NN4 A;  1N0J A;  1VF6 C;  4CS2 A;  2A79 B;  3JAK B;  1OZ0 A;  3X2Q B;  1AI6 A;  3CCQ V;  4UXN A;  5BZB A;  1XMQ B;  2EIM C;  4DV2 B;  1FPO A;  3OUF A;  3ZN0 A;  2WLM A;  1TUB B;  4R8C A;  4NXM O;  1AR1 B;  3RT3 C;  3E86 A;  4ZHQ B;  3ZMU A;  2ADP A;  2Z3Y A;  1HR0 O;  5EBL C;  3FKS G;  2UUC O;  1N4C A;  1R6T A;  2CH7 A;  2IJI A;  1XMO O;  3E2E A;  3SPI A;  1PPJ H;  3R66 A;  3STZ C;  3H1H H;  4H44 B;  3NR7 A;  3G4S V;  2JJ1 G;  2QKS A;  1F7Y A;  1FYJ A;  3CHX A;  4TV8 B;  3E8B A;  4YJ2 B;  1PP9 H;  1R3I C;  4YHH B;  2UUB O;  5KAI Z;  2A06 H;  4JPR A;  2YIB D;  4HYO A;  3N2K A;  3BCC H;  3QG5 A;  4X66 O;  3SYO A;  4ASU G;  2NLJ C;  1VQK V;  2CTR A;  3SJB C;  2IJJ A;  2FL4 A;  2YS8 A;  1XMO B;  2L35 A;  4FLT A;  2A9H A;  4WFA V;  1T5E A;  2CTW A;  3OTF A;  4KFM A;  1G6U A;  2E74 B;  2DMX A;  2E5L O;  3FAV B;  1AVM A;  1GAX A;  3SJA C;  1YIT V;  2EIK B;  4CC5 A;  1YCI A;  2ZE5 A;  1Q86 W;  5C8Y A;  3RWR D;  2ZDI A;  4DV1 B;  3I56 V;  4B7K A;  2UXB B;  3VOU A;  2R9I A;  1I7F A;  4JI2 B;  2YIA A;  3JAT A;  2P7T C;  1ZWI C;  3WB1 A;  1O9H A;  5LP6 B;  1TGO A;  4H0L B;  1YDX A;  2ZIN A;  2ZNJ A;  1RFY A;  2BTQ A;  3IGA C;  1J95 A;  2GTS A;  5EC2 C;  3P3P A;  3ZRS A;  1FXK B;  4PA4 A;  3AG4 C;  2P6J A;  1GN2 A;  1AJP A;  2Z5U A;  2X6C A;  2UXB O;  1THZ A;  3A0H Z;  4MVZ A;  5B3S C;  1ZL8 B;  3L75 H;  1P4R A;  1W0J G;  3I55 V;  4HAM A;  2OT5 A;  1G8M A;  1SET A;  2OCH A;  1M93 A;  3BA9 A;  2OYQ A;  2EIL B;  2UUC B;  1F23 A;  3FB6 C;  4JI5 O;  4LF9 B;  1HNZ O;  1WNS A;  4FLY A;  1WN7 A;  4TWK A;  4PA6 A;  5EBM C;  2UXD B;  1NBM G;  4XDK A;  2ZXW B;  2W6I G;  1FXV A;  1QBZ A;  3HKE A;  2EIL C;  5CA1 B;  3CD6 V;  3JAW A;  4AQY B;  3H9V A;  3BA8 A;  2CGN A;  2HEP A;  3BPZ A;  3G80 A;  1XEQ A;  4O4I B;  4FM2 A;  3LNM B;  4LF8 B;  1FD9 A;  4J41 A;  5L3E A;  1AI7 A;  3AK3 A;  4ZIB A;  3U11 A;  5EYP B;  2DYS C;  1NTM H;  2GUZ A;  4JI8 O;  3FFQ A;  1M4U A;  4AQY O;  3FB7 C;  4ZOL A;  3IC7 A;  4TT3 G;  3ZIA G;  2Y69 C;  2XHB A;  1ZAU A;  4X62 O;  1BL8 A;  4B3T O;  4FM1 A;  3HKD A;  3D36 A;  1JQ0 A;  3OW2 U;  3K9A A;  2RJZ A;  3CCM V;  2EIM B;  3LNN A;  4FMT A;  1YSC A;  4MVS A;  1Y67 A;  2V1D A;  3KCX A;  2WLI B;  1FJG O;  4LF5 O;  1Q6I A;  3TCU A;  3J81 N;  4WFG A;  2F4V O;  4J10 A;  3L72 H;  1OCO C;  1H5W A;  1WLE A;  1QR8 A;  1J5E O;  3P32 A;  4QE7 A;  3K5N A;  4K3A A;  1Q6H A;  4NXN O;  1SQX H;  4DR4 O;  2EIK C;  4D6T H;  5EZY B;  4HNA A;  1SER A;  3CCR V;  4X1Y A;  1VQO V;  2DQ3 A;  5EBW C;  1XL6 A;  5F2V O;  2NR5 A;  4EFB A;  1JR9 A;  2CAZ C;  3F5T A;  5JJJ B;  3OE7 G;  4P9P A;  1XRE A;  2D3O W;  5CB4 B;  4FLW A;  4LF4 O;  2JEX A;  2WLL A;  2BCC H;  3U10 A;  1LR1 A;  1F51 A;  2B5U A;  2V4D A;  1GN4 A;  1B6Q A;  4O4L B;  3THO A;  4DRX B;  1KB9 F;  2ILM A;  5L3C A;  4JTC B;  5AG2 A;  2IJH A;  1U96 A;  1NH2 D;  5LA6 A;  2YI9 A;  3WU2 Z;  2ZM6 B;  2MW2 B;  4BIZ A;  3T1C A;  5DN6 G;  4WBN B;  2L6L A;  4AI8 A;  2EZO A;  4I0X A;  3H1K H;  1Q82 W;  3HKC B;  1Z5W A;  4J42 A;  4NTY A;  4LFA B;  1NTK H;  2YSU B;  1SS3 A;  3FYI B;  2W6J G;  5EIB C;  5IE9 A;  2VWJ A;  1N36 O;  1NKD A;  4X88 A;  5CBH A;  3CCV V;  4JZG A;  3LUT B;  5BXZ A;  2Q5Z A;  4BW5 A;  1QQC A;  1K97 A;  2QTO A;  1KP2 A;  2A0L A;  4HNA B;  4K0K B;  3VQY A;  4GZR B;  1SZX A;  1PNL A;  2LP7 A;  1Q5O A;  2GSM B;  2WPD G;  3LDE A;  4GCZ A;  1B06 A;  3TET A;  1M90 W;  2LGW A;  5B1A B;  3OFN G;  4PDM A;  5C93 A;  3L70 H;  3JAL A;  1Q6U A;  2ZD9 A;  1M57 C;  3JD1 A;  4UV9 A;  1ZTE A;  5J2U A;  5J2T B;  1VIB A;  3ZX6 A;  2ITD C;  1MAB G;  4DR4 B;  1CP9 A;  5GTH Z;  1R6K A;  4CH5 A;  5H2F Z;  5J2T A;  1FAF A;  3H1J H;  4UCU A;  3UO2 A;  4X66 B;  3D3Q A;  3WFV A;  2B1G A;  1GN6 A;  2X6A A;  4LFC O;  3ZHU A;  2A7W A;  1XDC A;  4YY3 O;  1VP7 A;  3RBZ A;  1BQ0 A;  1PL0 A;  2ODM A;  1RPO A;  3JAS B;  1DTO A;  2KKW A;  3S3W A;  4I55 A;  3CCL V;  4QJF B;  4P9O A;  2PGG A;  1ZL8 A;  4N23 A;  2CE4 A;  1AIL A;  1L1F A;  1VF7 A;  4UVA A;  1UFI A;  3E8H A;  2DE0 X;  4OGQ B;  4HBN A;  1S5L Z;  2WWW A;  2LW1 A;  3ZMV A;  1XQ8 A;  5CBF A;  4LF7 O;  3OEH G;  2WLH A;  1BCC H;  5E1A C;  5LXT A;  5A2Q N;  1VQN V;  1SKV A;  4DW0 A;  2F95 B;  2B9Z A;  2HLD G;  4X8A A; 
#chains in the Genus database with same CATH homology
 4JZG A;  1QNM A;  1N0N A;  3AK2 A;  4F6E A;  1MMM A;  4YIP A;  2P4K A;  1SZX A;  1AR5 A;  1BT8 A;  1KKC A;  1Y67 A;  3K9S A;  1GN3 A;  1EN6 A;  1ZUQ A;  1B06 A;  3CEI A;  2AW9 A;  1N0J A;  1VAR A;  2ADQ B;  1MNG A;  1PM9 A;  1BS3 A;  3BFR A;  2RCV A;  1LUV A;  1ZTE A;  3KKY A;  1ZSP A;  1I0H A;  1EM1 A;  3MDS A;  1GN2 A;  1AP5 A;  4FFK A;  3C3T A;  4YIO A;  2ADP A;  1MA1 A;  3AK1 A;  2CDY A;  1JR9 A;  1WB8 A;  3RN4 A;  1BSM A;  1IX9 A;  1XRE A;  1XUQ A;  1ZLZ A;  1JA8 A;  1GN6 A;  1AP6 A;  1P7G A;  1XIL A;  1XDC A;  3KDR A;  1D5N A;  4GUN A;  1GN4 A;  5A9G A;  1IDS A;  3DC6 A;  3LSU A;  4C7U A;  4JZ2 A;  5AG2 A;  3TJT A;  1VEW A;  4E4E A;  2CE4 A;  4X9Q A;  3IC9 A;  4BR6 A;  3AK3 A;  3QVN A;  1I08 A;  3C3S A;  3DC5 A;  2QKC A;  1WB7 A;  2GDS A;  2QKA A;  1EN5 A;  4JYY A;  1MSD A;  1AR4 A;  1IXB A;  3EVK A;  1LUW A;  1PL4 A;  3OT7 A;  1AVM A;  1EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...