4GUNA

Crystal structure of the k184r, l185p mutant manganese superoxide dismutase from candida albicans cytosol
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
205
structure length
205
Chain Sequence
ITENEKISLPKIDWALDALEPYISKEINDLHINKHHVAYVNGYNAAIDALEKAVGKRDLKSVVEIQQNIKFHGGGHTNHSLFWKNLAPVSKGGGKHPDTSSALGKQIVAQYGSVSNLIDITNSKLAGIQGSGWAFIVKNKQNGGALDVVTTANQDTISAPHLVPIIAIDAWEHAYYLQYQNVRPDYFKAIWNVINWAEAESRYSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the K184R, L185P mutant manganese superoxide dismutase from Candida albicans cytosol
rcsb
source organism Candida albicans
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase
total genus 81
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4gunA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4gunA02
3LSUA 3K9SA 1XDCA 2RCVA 4BR6A 3KKYA 1LUWA 1P7GA 3C3TA 1D5NA 1EN5A 3BFRA 4JZ2A 3EVKA 2ADPA 1WB7A 4YIOA 1ZTEA 1I0HA 1B06A 1BS3A 4E4EA 1JR9A 1GN2A 1IDSA 5AG2A 2ADQB 4JZGA 1GN3A 1MA1A 4FFKA 2QKAA 1VEWA 2P4KA 4GUNA 1AP6A 1VARA 1AP5A 1MNGA 1N0NA 3OT7A 1LUVA 3DC5A 1IXBA 2CDYA 1I08A 1AR5A 1ZLZA 4C7UA 1GN4A 3CEIA 4JYYA 3QVNA 1Y67A 1SZXA 2QKCA 3AK2A 1JA8A 1ZSPA 5A9GA 3DC6A 1AVMA 2CE4A 3IC9A 1BT8A 1N0JA 1XILA 3RN4A 2AW9A 1GN6A 1EM1A 1XREA 4X9QA 1PL4A 1MSDA 1ZUQA 1XUQA 1EN6A 4F6EA 1QNMA 3TJTA 1KKCA 2GDSA 1IX9A 1WB8A 3C3SA 4YIPA 3MDSA 1AR4A 1BSMA 3AK3A 1MMMA 1PM9A 1EN4A 3AK1A
chains in the Genus database with same CATH superfamily
4X62B 5H2FZ 4LF9O 4IHJA 5IYDO 3HB3B 2RCVA 2B1IA 5E79Z 5LOVA 3E22B 2YICA 4DR3B 1XQ8A 2EX3A 4JZ2A 4ZKIA 1HNWO 1K3EA 2QEXV 3K59A 4DO2A 1HWYA 5IYCO 4DV2O 4X1KA 1H2MA 3DXRA 4JYBA 3D8CA 5H9CA 1D5AA 1UFIA 4GX0A 1NQTA 5JJJB 4DUZB 2QSAA 4O4LA 1P49A 1YCIA 1ENVA 3K9AA 2EIKB 1QR8A 1AP5A 5GTHZ 4LFAO 4I4TA 3CB2A 2OWOA 1CXZB 3OMNB 2LW1A 4DRXB 3STZC 3JSLA 1EZJA 2CDYA 3ZRWB 5K1XA 3TCUA 3VQYA 2QWPB 2LFSA 5JJNB 2ZNIA 3OUSA 3SPGA 3T1HO 3ABLC 2E5LB 4LF6B 3K04A 1IBMB 4I55B 2UUCO 4O2BA 2W6IG 1R1BA 2YI9A 2PGGA 1BT8A 4OPHA 4DR7B 1U97A 2QM8A 2Q68A 4GT1A 1GN6A 3AG4C 3ZRXA 4I0XA 4PDRA 1V54B 2OCCB 4Q6GA 1FOUA 1ZL8A 2YDEA 1EN6A 2N05A 3SPIA 2ZINA 3B09A 4TWKA 4JI7B 1FXKC 1RSOB 3RVYA 1XNQB 3ETQA 1FXVA 4TQDA 3OGIB 3OAAG 3SYOA 4JYAO 4UB6Z 1IBLO 4LWSB 3WB0A 2CTPA 2ZE7A 5C93A 1N32B 3K58A 3PJSK 1OCZB 1EFRG 1FPOA 2Y69B 4DV4O 4LF4B 3VQWA 5J2UB 4X66B 4IIJB 3B40A 3SJQC 2Z5UA 3KKYA 3P3PA 5DEDA 4NXNO 3OW2U 2HJFC 1SF9A 4H0LB 3BFRA 1SC5B 2XAQA 1Q81W 4ZBMA 1YHQV 2QA4V 1RSOA 2HEPA 5IWAO 3RW0A 5C8YB 3TXSA 5EBMC 1K92A 2EZOA 3EXAA 3ZMVA 3TETA 4F4LA 3CCVV 3K57A 5IJ0A 3LDCA 1NI8A 2AZ0A 4RQEA 3T1YO 3H9VA 3Q4HA 3AG3B 3EHBB 2DWDC 1SQFA 3CE2A 3JARB 4DR1B 3HKBA 1Q6HA 5GTIZ 3ZEDA 1D2DA 4Q20A 4JAVA 5KA6A 3ABMC 2F66C 1N36B 4O4HB 4MW8A 2CUGA 4CS2A 2ZM6B 1XNQO 4B3SB 4B3MB 4JAAA 4X64B 4FLXA 2X7RB 3FYIB 3D3IA 3F7YC 2QKCA 2IBZH 1AVMA 3NXSA 2ATKC 4BIZA 4DR5O 1SZTA 3OTOB 5EC2C 5L3GA 4TQFA 1NBMG 1WA8B 1F4MA 1X59A 3G67A 3T1YB 1YITV 1PL4A 1B6QA 4O4HA 4UVBA 2UUBO 4YY3O 2WLLB 3IJ4A 3JAMN 2Y69C 1IX9A 1VQ6V 1Y76B 5LOVB 4B3MO 1TUBB 2WPDG 2E75B 3JAKA 2ZXWC 5KAIZ 4WF9V 4RUFA 1DGSA 1LR1A 2UXCB 5JQGB 3LDDA 4LFCO 4DV0B 4FLYA 4H33A 2YEVB 3DXRB 2OT5A 4JF3A 4JI3O 3A0HZ 3L70H 1N8RW 2R9RB 2GTSA 2QM4A 1PV0A 3CRRA 4UV9A 5KHGA 2DWEC 1G4YB 3BAAA 4F6RB 5IDJA 4O4JB 1Q82W 4PELA 4W4KA 5FNVB 2KB1A 4I5SA 3F5TA 4YXWG 4E4EA 1K4CC 1R3LC 5BY1A 4OX9O 2UXDB 2W6JG 4DR7O 2KSDA 5K1PA 1KP3A 4LR3A 1US6A 3ZMZA 1XMQO 1OZ0A 4GKJB 4B3SO 1QLEC 4N23A 2P06A 5L3BA 1UPGA 1SETA 1VARA 1F23A 4O2AA 3P30A 4U7NA 1XHZA 3I5DA 1DTOA 3J80N 4FLVA 4QE9A 3UO2A 1MZFA 3LSQA 4KL1A 2A9HA 2N74A 1YI2V 3QVNA 3KCYA 2EILB 1JA8A 3RYCA 2HG5C 3H1KH 2BCCH 4FFBA 4B3TB 1G8MA 5LP6B 2JGDA 4QGPA 4IYHA 3UT5A 1ROPA 2R72A 4MT8A 2UXBB 1JFFB 1KKCA 4ZOLA 1V9PA 4U7OA 1I5XA 3ZRVA 1GRJA 3ABTA 2RQ6A 1TGOA 2H3OA 1AJNA 1VQ9V 1H5WA 4HBNA 4DR4B 2BTOA 4G2KA 5H5NA 1FXHA 1S76D 1VQMV 3QTCA 3CCJV 3JAKB 3EVKA 2GSMB 1IVSA 3ASNB 1KB9F 5B1OA 4DR3O 4UCVA 3W7XA 3G80A 3JATB 2DYSB 4CC6A 3CD6V 4LNUB 2HVKC 4F6RA 4D7TA 1AI6A 1XMOO 4UB8Z 5JCOC 2NR5A 4N21A 1VP7A 1VF6A 5EK0A 4WFBV 5KHIA 4P9PA 5F2VO 1SESA 4J7KA 4I50B 1NH2B 3RYFA 3H1IH 3SYAA 2E5LO 3K5OA 4XDKA 2BSKA 3N2GA 5KX5A 2VQEB 1A32A 3E86A 1VQ5V 2ZIOA 5IYZB 3C90A 3CWBH 3E8HA 2YEVA 5LGNA 4X65O 2Q7EA 4J10A 1FXKA 2QWRB 1N4CA 5JVDA 1ZAUA 3CRQA 3LSSA 5J2TA 1IBKB 2EBOA 1I7FA 2R9IA 3ZRSA 1Y76A 1BMFG 2YXHA 1S72V 3E89A 2YIDA 5KHKA 3A0BZ 2IJKA 2XHBA 1AI5A 5FPRA 3ZCCA 3OM3B 3ZJZA 4DV1O 4YIPA 4IGGA 3AK3A 4GX5A 4NVPA 4RUEA 1NTZH 1H2LA 2PTMA 4Z1MG 4CH3A 4DV3O 1HDJA 2ZR3A 4DW0A 1N33O 1XDCA 4FLUA 4PDLA 4KHPO 1FFTB 2Q7HA 2HVJC 5CN0A 2Q67A 2WLMA 2WLHA 1Q43A 2FKXA 3RVZA 3C3TA 1PNMA 5IWAB 4RQFA 1R3JC 1GK9A 1XHXA 4TUYB 1THZA 3DSQA 4DR6B 2BOBC 3W7UA 1CPYA 4PA7A 2Q0AA 2WLJA 4JTDB 5AG2A 1BGYH 4AQYO 2WA3A 4EFEA 1FFXB 1Y74A 3STLC 4NYKA 1FD9A 1XI1A 2P4VA 4GUNA 5LMUB 4IIJA 4MVQA 3CCQV 1I94O 4QNHB 3OR6C 4RAIA 5L3CA 3MAQA 5B3SC 5CB4A 1AI7A 4JI8B 5LBQA 2IH1C 1GM9A 1PKXA 3BHPA 3CC7V 3OGCC 4DV1B 5ITZB 1AI4A 5EZYB 3L71H 1RPRA 5FL7G 1Y67A 1AILA 1WP8A 1KD1W 1VMGA 4WFGA 1L8DA 4Z1VA 3R66A 2RNBA 2VWJA 2PY5A 4UCSA 2CTQA 2EILC 3OTOO 1SQVH 3OR7C 3S3XA 4YJ3A 4YHHB 4LBEC 3LNMB 1H2NA 2GBOA 3ZHTA 2R70A 1IZ3A 4FLZA 1PD3A 2A79B 3CXHF 3J81N 1FAFA 1M56B 3CRMA 2PUSA 1YTFD 1GAXA 4JI6O 5B66Z 1Q8IA 3H1LH 4DV0O 1IXMA 1IJGA 1Q6UA 1EN4A 4DR4O 1Z5VA 5EYPA 4MTFA 4ABMA 3A2FA 3R65A 2VWKA 4DV5O 1S5LZ 3X2QB 4X1YB 3AG2C 1FJGO 5BMVA 3ZHVA 5A2QN 2KKWA 1GM8A 5LYJB 1K9MW 1SQGA 4B7EA 5LHIA 5JH7B 1GH6A 4YHHO 2Y0PA 4QJFB 3JD4A 4LH6A 2F93B 1GTOA 2HJDA 2RMKB 4K3AA 4JZGA 3ZHSA 3HKBB 1PNKA 2W0FC 3FB5C 3M7MX 5CA1B 4I0XB 4U3FH 1M57C 2F4VO 2OCHA 2ZD9A 1VQ7V 2Q5ZA 2KG7A 4PI0A 2LP7A 2YIBD 3ETEA 4TV9B 1SRYA 1N32O 3JARA 1OHHG 3JCUZ 4MVSA 3CYOA 3MD0A 1GN4A 1KC8W 5J2UA 2XOKG 1JJOA 3CCEV 2JJ2G 3MHSC 3KCXA 2GHYA 3DGEA 4JI4O 5IJ9B 4UV8A 1BE3H 4L87A 4EB6B 4UVCA 1ZUQA 5TISZ 1O9HA 3CCLV 4RO2A 3BA9A 2CK3G 4MTOA 2CAZC 3AG3C 2WLNA 4HAMA 2B9ZA 2JS3A 3G71V 2ZNJA 4DRXA 1W2BU 1AR4A 2ILMA 4GX2A 3CRCA 3ETDA 4DUYO 3MHHC 4JGSA 1KYOF 1JQ0A 1R3KC 4O4LB 4OXSA 4X64O 5IY5C 4WCEV 3FD9A 2A7WA 1P7GA 1S3JA 1VQNV 2LQTA 5H6RA 1PL0A 4DR6O 1YXBA 2IU0A 4XBFA 4JI1O 1YF2A 1KBHA 3U0ZA 4NTYA 4JV5O 5BR8B 3CX5F 5LMNO 1ZWIC 2WAMA 2ZE5A 4PJ0Z 2AHZA 4DR5B 3IGAC 1NR7A 1KKDA 5LXTB 1IBLB 1MA1A 4FFKA 2RN9A 3ZN0A 5JVDB 4LNUA 2JGUA 4ASUG 3CC4V 5KAFZ 1SQXH 4WFAV 2EJ7A 2UU9O 1ZL8B 3G6BA 2ZXWB 3SR2C 1VIBA 2JS5A 4NXNB 1W0JG 3G4SV 1HW7A 1TUBA 3K79A 3HKCA 2XAGA 5EYPB 2HHHO 4I50A 4LF7O 4X65B 4X1YA 1SA0B 5KA5A 2DYRB 4CS4A 1XILA 4B3RO 2Q8VA 4TV9A 2AW9A 1NVPD 5KLVH 4MVRA 5JH7A 2HLDG 3RFRA 1MSDA 3RYHB 3SGIA 4JI0B 3SJBC 4NKGB 4K8XA 1HNWB 5LL6Y 3TJTA 4PA6A 4TUYA 2LGQA 2XAHA 4LF5O 3ZHQA 4JAUA 3MDSA 4WBNB 2YUAA 4JI6B 2L35A 4BW9A 4P30A 1PM9A 1VF5B 1B3QA 1H8EG 2WWWA 2YSUB 3KDRA 2K1EA 4GYCB 2EIMC 2KG7B 4TT3G 3SDLA 2AXTZ 4BR6A 1F7YA 1N33B 4LFBO 3SYQA 1QVFU 3N2KA 4NR1A 4PV1B 5CA1A 2GUZA 4TV8A 3ZMUA 2F95B 3LDEA 5EBLC 2OIGA 1HR0B 1G1XB 4FVMA 2GTAA 3K5NA 3UKMA 2CGNA 3CRAA 2MK3A 4PA3A 3APOA 3SJCC 3FX7A 3L72H 4L8JA 4JI3B 3CPWU 1P7BA 4YJ3B 4J42A 3ZHRA 2JK5C 1QLEB 4MTGA 5L3FA 4IL6Z 1NR1A 3DC5A 4J11A 5HFMA 1S77D 3D36C 4FM0A 1F51A 2XTAA 2D3OW 1FXKB 2UXDO 1HNZB 2OYQA 5L3DA 2BTQB 1XMQB 3ASOB 5ITZA 3TGUH 1KUQA 5KMGA 3CMEV 2X6CA 3ZRWA 1OCZC 4I9QA 2BSKB 2YS8A 4JI2O 5BMVB 1W59A 2JRIA 1SA0A 2VQEO 3K06A 4EEQA 1TVKA 5HFLA 4JYAB 3RYIA 4O2AB 5FNVA 1PPJH 4TOIA 4DK0A 2ARHA 3RWRD 3OEHG 1BHAA 4KFMA 2BE3A 3IFXA 3AG4B 1N34O 4UFZA 2YI8A 1JNBA 3GVMA 1S0VA 2ETNA 5KUMA 4BIOA 2DW4A 3O9OA 3HKCB 5CA3A 3U11A 1S5JA 3RBZA 2DQ3A 2DYRC 4KP4A 2DOSA 4NTWA 4DV3B 3UT5B 3SJAC 1EBOA 3ZBHA 2ADQB 5DM6V 4B3TO 4WFHA 1PNLA 1NS1A 5GW7A 1OCRB 3CSXA 5CB4B 4FJCC 2ZM6O 3W7WA 3G6EV 4DW1A 4ZIBA 1N0NA 2G38A 4O4IB 1BQ0A 3SPCA 4R7CA 1XNRO 1VQKV 4IT5A 5EIBD 1TAEA 4KHPB 1R6TA 4WFEA 3H1HH 3ZMTA 4PDVA 2UXBO 2IU3A 3ICXA 3K3WA 4Z2WA 2NN4A 2QR4A 3M8AA 3CHXA 5EIBC 2WLIA 3A0RA 1M5IA 3ZS8C 2UUAB 2UXNA 5LP6A 5C8YA 2XASA 2XUMA 3B4SA 4KXRA 4DXWA 4K0KO 1SQQH 5CBHA 1H38A 2RDCA 1V54C 2OCCC 3T1CA 2NLJC 3K0GA 3C3SA 2KQXA 1BSMA 1Z5WA 2UXCO 2QJ1A 1FS0G 2CTRA 3LNNA 1TVKB 4GKJO 2QDOA 4H44B 3CMAV 4O2BB 4JASA 1YEWA 1URFA 4D7SA 3BPZA 3WFVA 1WNSA 3FAVA 3CCMV 4P9OA 3X2QC 1BCCH 4J7JA 2QGNA 3T4ZA 3SYPA 4DK1A 4AILC 4MW3A 3OUFA 4HNAB 3K03A 2LFRA 3VQVA 4X1KB 4X88A 1WPBA 1FJGB 2F23A 4I7ZB 1ZX3A 1K5SA 4DR1O 4JPRA 4DV6B 4QPKA 4YJ2B 1VEWA 1AP6A 4FPPA 3WB2A 4PD4F 3H01A 2WLLA 1QHTA 1QVGU 4EFBA 1K73W 1OCOC 3JAWB 1NVPB 1P4RA 2JDIG 4BW5A 5CA0B 2EIKC 3B77A 1YJNV 2ZE8A 1WP7A 2Q7GA 3RYFB 2UUCB 3E8GA 1VQ4V 3WU2Z 2D2CB 3UCSC 3SPJA 2DMXA 3QO5A 2CE4A 1L0LH 4WFFA 3CC2V 1Y74B 2E3CA 4X9QA 4W4LA 1XUQA 3ZX6A 4D6TH 4X1IB 1M90W 1TA8A 4GKKO 2PF4E 1FKAO 2JVDA 1GMGA 1MSWD 1OCRC 3SPHA 1K97A 5IJ9A 1Q5OA 2L6LA 2ZDIC 2A3QA 4BWAA 3ABKB 2V1DA 4FZ0A 1MMMA 3UM7A 4GZRB 3IC7A 5KHJA 2R9AA 5LP6C 3JCZA 1GM7A 3LSUA 1UJWB 1Q6IA 2FL4A 1YDXA 4LF4O 3S3WA 3SYCA 3BVOA 2CGOA 3HKDB 1EN5A 2PI5A 1H2KA 1YJWV 3D3QA 4CS3A 3K08A 1BS3A 4CC5A 1NTKH 4UCRA 3JASB 4GCZA 4B7KA 1XMOB 4B08A 2HP8A 1Y4MA 4PA9A 2JEUA 2JGDB 1VF6C 3U10A 1BZKA 5LGUA 1BHBA 3I55V 4IHJB 2P4KA 2ZE6A 2LW7A 4HNAA 1SQPH 4DV2B 1WN7A 1YVWA 4DR2B 5JQGA 3JATA 1B04A 3K0DA 1QR9A 1XNRB 4DUYB 1BL8A 2WA4A 3JSNA 1Q86W 4DV7O 4QPJA 1I08A 3L74H 4J9ZB 3L73H 1M9NA 1XL4A 1H2SB 4G27B 4C7UA 1DLBA 2OTJV 3GB7C 1JVMA 1JJ2U 5A9GA 3CCSV 2QWQB 3WG7C 1AROP 5EZYA 2DN9A 2P5OA 3ABMB 1Q90D 3AEIA 4XDJA 4AI8A 3FAVB 4NXMB 3K5MA 5KX5B 1YSCA 4EKWA 2V4DA 2Y4TA 2NNUA 3FB6C 1N36O 1QBZA 2IJJA 3OMIB 5LYJA 1HNXO 1OV9A 1QNMA 2Q4PA 3RGBA 3APQA 3CP1A 4E2LA 1JX9A 5E1AC 1L1FA 4UUJC 3HPLC 4I55A 5KMGB 4LH7A 3VOUA 4GX1A 3CXCU 2UU9B 2YIBA 4JTCB 4R50A 4J9YB 3ABLB 1LUWA 2W0XA 4U3JA 4JI8O 4TV8B 3QO8A 1KECA 4LFBB 4FLWA 1MOFA 3VQXA 1ZTEA 1SKVA 1B06A 1AB3A 2ZT9B 2X6AA 1IBMO 1M93A 1GN2A 2OIEA 4JI5O 2V7QG 3UQ8A 1KQSU 1HNXB 1J5EB 4AQYB 2K9PA 5B3SB 2QKAA 5CA0A 1Z2GA 2CH7A 1NTMH 4HYOA 3ABKC 1H8HG 1GKFA 3JYCA 5LHGA 1V55C 2ZR2A 3IAYA 2XT9A 1KU9A 3E22A 2BOCC 4CZZA 3HKEB 4ZHQB 3WG7B 3FYEB 1R73A 4MTXA 2N04A 1ZLZA 5LGTA 4K8ZA 3BY6A 3ZHUA 4X20A 2VQFB 1SZXA 1MG1A 4ZI7A 1H2GA 4J7ZA 3DC6A 2A06H 2JIZG 3RN4A 4QIWF 5IE9A 2Y4UA 4K0KB 2EIJB 1HR0O 2GUZB 5LHHA 3F7VC 1DF5A 5LA6A 3VBBA 4MVUA 5BXZA 1NJIW 1SERA 4DUZO 1Y66A 3BABA 3ZMSA 1K7DA 4G28B 3JD2A 3RT3C 3BA8A 2ZCEA 1YIJV 3HKDA 3B8NA 2RJZA 5LXTA 5KHHA 4CH6A 3CS5A 4NB5A 4B3RB 1SS3A 4QE7A 2QWOB 1VQLV 3FB7C 1OCCB 2X0LA 1WLEA 4CH4A 1JOYA 3I56V 5JCOA 4I9WA 4JI0O 3QO7A 1GO3F 2IJIA 4LF5B 2BTQA 1N34B 5JWPA 1DF4A 1JR9A 3FFQA 2UUBB 2PYJA 1WA8A 2DE0X 2QTOA 1E1QG 2O57A 1NKDA 2EINB 3KZIZ 4JYCA 5BZBA 1RM1B 5LMUO 2YXLA 2FB5A 4UCOA 5DECA 4DV6O 2HFEC 4YJ2A 3L9DA 5KUKA 2QTSA 3RYHA 3FB8C 4O4JA 1R6NA 3OE7G 1P84F 3QNEA 2YIAA 2CH7B 4X89A 3JAWA 3RYCB 1VQ8V 1E1RG 4FFBB 2EIJC 3OEEG 1MABG 2PYLA 3AK2A 2XNDG 1ZSPA 4UVAA 2WLIB 3E8FA 4OX9B 3AG1B 3HKEA 2E76B 5BR8O 4IYIA 4FMTA 4LWSA 1RP3B 3E2EA 1U96A 1T5EA 2Q9LA 2WSSG 1PP9H 2MW2B 3L75H 2OTLV 4F6EA 2ODMA 2Y48A 4J41A 1L0NH 2B5UA 5LMNB 4BIUA 4X62O 1COWG 1X4TA 2X6BA 4JI1B 4EB6A 1I5YA 2B1GA 4PDMA 1EZVH 3A8TA 2ZIMA 4MS2A 3QG5A 4X8AA 3D36A 3AK1A 4AHCA 4WBNA 4ICGA 3EFFK 4FZ1A 1K4DC 1Y6XA 3B2EE 3AG7A 2F1MA 1KMIZ 5L3EA 2WLKA 4XDLA 5IJ0B 1D5NA 2LO1A 4YIOA 3GWKC 3AG2B 1I0HA 2DJVA 2YC0A 4PI2A 1M57B 2ZDIA 4LC1A 3ZIAG 4ZI7B 4DV5B 1IDSA 2IW5A 3OD4A 3OMAB 5FPOA 1CEZA 1S5HC 3T4DA 2F4VB 2UUAO 3DTUB 4LFAB 2P22C 2Q69A 3B8MA 4A5UB 1XOUA 2P90A 1MNGA 4MVOA 1DK1A 5CBFA 3T2MA 3THOA 2LJ2A 5CMUA 4DV7B 5EC1C 3N27A 2AHYA 4KUMA 1YTFB 1IXBA 1YZBA 4LCUC 4MVZA 3WB1A 4JI7O 4LFCB 2FMLA 2HKOA 3H1JH 2Q73A 2QE7G 2VQFO 3CEIA 4JYYA 1SQBH 1RFYA 1AJQA 1NH2D 2Z0AA 4LF7B 1JPXA 3GWOA 4OGQB 4FIPC 4JI4B 2Q0OC 4CH5A 1Q7YW 3IC9A 1N0JA 2C2AA 1HP8A 2EULA 1K34A 2IH3C 1XREA 5IT9N 3ZN1A 4U3JB 3BEHA 4YY3B 4PA4A 3UO3A 2F43G 4FM1A 1I94B 4R8CA 4K35A 3P32A 4O4IA 4HZ3A 4GKKB 5B1BB 1YJ9V 2GDSA 1XEQA 3N2GB 4H37A 1WB8A 4X66O 5D5PA 2ITCC 2P6JA 5H6QA 4P2ZA 1G6UA 3JALB 4BAYA 4LF9B 3LUTB 3P3NA 3ASNC 2ADPA 1IBKO 1WB7A 2ZKOA 2M6YA 1J5EO 2ZQMA 3AG1C 1VQPV 3FKSG 2LGWA 1ORQC 3O65A 3ABUA 1F4NA 4CBCA 5J9PC 3N2KB 2AGAA 5B1NA 4UCTA 2JJ1G 1NZ6A 2VS0A 2M7WA 5JJEB 2DQ0A 3OTFA 3E35A 2HR3A 2EZPA 1LUVA 3F5WC 2EINC 1RM1C 1R6KA 2Q6AA 1AJPA 3JD3A 4MSWC 2H94A 3JD0A 2XAFA 3K5LA 2JEXA 1AR5A 1OCOB 4FK5C 4OPAA 1FFXA 4LF6O 2E74B 2FYUH 4LF8O 1E79G 4PHZA 4LP8A 4X20B 5FLXN 4J80A 3TXQA 3BCCH 2AZ2A 2Z3YA 1QU7A 3PN1A 4NXMO 2HHHB 3CCRV 1QLNA 1NT2B 1FYJA 2IM9A 1K5QA 3E8BA 1M1KW 3JASA 4I4TB 4ZHQA 1Q3EA 2QKSA 3KG2A 3BRCA 1JFFA 2IJHA 4R6ZA 4DV4B 2XAJA 1AR1B 3K9SA 4RWUA 1XBLA 5B1AB 4DR2O 1WJZA 2CTWA 4LF8B 4NTXA 3JD1A 5LA6B 1VQOV 2EIMB 2DYSC 5D5QA 1WAZA 3CJHB 5IY5B 1TUEB 2QM7A 3OFNG 4DYLA 2ITDC 2P67A 5B5EZ 1VF7A 3QF7A 1GN3A 2UXXA 5GONB 1M4UA 1OCCC 4H13B 4JV5B 1QCEA 5IYZA 3RYIB 3NR7A 3OT7A 2YXYA 2PI4A 3E83A 3ETGA 2QWNB 3CCUV 2EJRA 4FLTA 3CJHA 4UXNA 3Q4HB 1BQZA 5B1AC 1XL6A 3M99B 1V55B 1KP2A 3W7SA 3JALA 5IYBO 4UCUA 1HNZO 5EBWC 2P7TC 3J7AU 5GONA 1K33A 4MVMA 5DN6G 3HR0A 2Y0IA 1EM1A 4JI5B 1OJHA 5B1BC 1M56C 1NU1H 3ML0A 1LNQA 1MZEA 1JMKC 2A0LA 3ASOC 1O9GA 4ZOLB 1R3IC 5J2TB 4TSFG 1W0KG 4FM2A 5CBGA 1QQCA 2FTKA 1WPXA 3T1HB 1J95A 1JCHA 4JTAB 2GV9A 4X1IA 3W7TA 1K8AW 2H8PC 1CP9A 1IURA 4GLXA 1RPOA 2PZSA 4JI2B 2VRZA 3TK1A
chains in the Genus database with same CATH topology
3LSUA 3KDRA 3K9SA 1XDCA 2RCVA 4BR6A 3KKYA 1LUWA 1P7GA 3C3TA 1D5NA 1EN5A 3BFRA 4JZ2A 3EVKA 2ADPA 1WB7A 4YIOA 1ZTEA 1I0HA 1B06A 1BS3A 4E4EA 1JR9A 1GN2A 1IDSA 5AG2A 2ADQB 4JZGA 1GN3A 1MA1A 4FFKA 2QKAA 1VEWA 2P4KA 4GUNA 1AP6A 1VARA 1AP5A 1MNGA 1N0NA 3OT7A 1LUVA 3DC5A 1IXBA 2CDYA 1I08A 1AR5A 1ZLZA 4C7UA 1GN4A 3CEIA 4JYYA 3QVNA 1Y67A 1SZXA 2QKCA 3AK2A 1JA8A 1ZSPA 5A9GA 3DC6A 1AVMA 2CE4A 3IC9A 1BT8A 1N0JA 1XILA 3RN4A 2AW9A 1GN6A 1EM1A 1XREA 4X9QA 1PL4A 1MSDA 1ZUQA 1XUQA 1EN6A 4F6EA 1QNMA 3TJTA 1KKCA 2GDSA 1IX9A 1WB8A 3C3SA 4YIPA 3MDSA 1AR4A 1BSMA 3AK3A 1MMMA 1PM9A 1EN4A 3AK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LSU A;  3K9S A;  1XDC A;  2RCV A;  4BR6 A;  3KKY A;  1LUW A;  1P7G A;  3C3T A;  1D5N A;  1EN5 A;  3BFR A;  4JZ2 A;  3EVK A;  2ADP A;  1WB7 A;  4YIO A;  1ZTE A;  1I0H A;  1B06 A;  1BS3 A;  4E4E A;  1JR9 A;  1GN2 A;  1IDS A;  5AG2 A;  2ADQ B;  4JZG A;  1GN3 A;  1MA1 A;  4FFK A;  2QKA A;  1VEW A;  2P4K A;  4GUN A;  1AP6 A;  1VAR A;  1AP5 A;  1MNG A;  1N0N A;  3OT7 A;  1LUV A;  3DC5 A;  1IXB A;  2CDY A;  1I08 A;  1AR5 A;  1ZLZ A;  4C7U A;  1GN4 A;  3CEI A;  4JYY A;  3QVN A;  1Y67 A;  1SZX A;  2QKC A;  3AK2 A;  1JA8 A;  1ZSP A;  5A9G A;  3DC6 A;  1AVM A;  2CE4 A;  3IC9 A;  1BT8 A;  1N0J A;  1XIL A;  3RN4 A;  2AW9 A;  1GN6 A;  1EM1 A;  1XRE A;  4X9Q A;  1PL4 A;  1MSD A;  1ZUQ A;  1XUQ A;  1EN6 A;  4F6E A;  1QNM A;  3TJT A;  1KKC A;  2GDS A;  1IX9 A;  1WB8 A;  3C3S A;  4YIP A;  3MDS A;  1AR4 A;  1BSM A;  3AK3 A;  1MMM A;  1PM9 A;  1EN4 A;  3AK1 A; 
#chains in the Genus database with same CATH topology
 4X62 B;  5H2F Z;  4LF9 O;  4IHJ A;  5IYD O;  3HB3 B;  2RCV A;  2B1I A;  5E79 Z;  5LOV A;  3E22 B;  2YIC A;  4DR3 B;  1XQ8 A;  2EX3 A;  4JZ2 A;  4ZKI A;  1HNW O;  1K3E A;  2QEX V;  3K59 A;  4DO2 A;  1HWY A;  5IYC O;  4DV2 O;  4X1K A;  1H2M A;  3DXR A;  4JYB A;  3D8C A;  5H9C A;  1D5A A;  1UFI A;  4GX0 A;  1NQT A;  5JJJ B;  4DUZ B;  2QSA A;  4O4L A;  1P49 A;  1YCI A;  1ENV A;  3K9A A;  2EIK B;  1QR8 A;  1AP5 A;  5GTH Z;  4LFA O;  4I4T A;  3CB2 A;  2OWO A;  1CXZ B;  3OMN B;  2LW1 A;  4DRX B;  3STZ C;  3JSL A;  1EZJ A;  2CDY A;  3ZRW B;  5K1X A;  3TCU A;  3VQY A;  2QWP B;  2LFS A;  5JJN B;  2ZNI A;  3OUS A;  3SPG A;  3T1H O;  3ABL C;  2E5L B;  4LF6 B;  3K04 A;  1IBM B;  4I55 B;  2UUC O;  4O2B A;  2W6I G;  1R1B A;  2YI9 A;  2PGG A;  1BT8 A;  4OPH A;  4DR7 B;  1U97 A;  2QM8 A;  2Q68 A;  4GT1 A;  1GN6 A;  3AG4 C;  3ZRX A;  4I0X A;  4PDR A;  1V54 B;  2OCC B;  4Q6G A;  1FOU A;  1ZL8 A;  2YDE A;  1EN6 A;  2N05 A;  3SPI A;  2ZIN A;  3B09 A;  4TWK A;  4JI7 B;  1FXK C;  1RSO B;  3RVY A;  1XNQ B;  3ETQ A;  1FXV A;  4TQD A;  3OGI B;  3OAA G;  3SYO A;  4JYA O;  4UB6 Z;  1IBL O;  4LWS B;  3WB0 A;  2CTP A;  2ZE7 A;  5C93 A;  1N32 B;  3K58 A;  3PJS K;  1OCZ B;  1EFR G;  1FPO A;  2Y69 B;  4DV4 O;  4LF4 B;  3VQW A;  5J2U B;  4X66 B;  4IIJ B;  3B40 A;  3SJQ C;  2Z5U A;  3KKY A;  3P3P A;  5DED A;  4NXN O;  3OW2 U;  2HJF C;  1SF9 A;  4H0L B;  3BFR A;  1SC5 B;  2XAQ A;  1Q81 W;  4ZBM A;  1YHQ V;  2QA4 V;  1RSO A;  2HEP A;  5IWA O;  3RW0 A;  5C8Y B;  3TXS A;  5EBM C;  1K92 A;  2EZO A;  3EXA A;  3ZMV A;  3TET A;  4F4L A;  3CCV V;  3K57 A;  5IJ0 A;  3LDC A;  1NI8 A;  2AZ0 A;  4RQE A;  3T1Y O;  3H9V A;  3Q4H A;  3AG3 B;  3EHB B;  2DWD C;  1SQF A;  3CE2 A;  3JAR B;  4DR1 B;  3HKB A;  1Q6H A;  5GTI Z;  3ZED A;  1D2D A;  4Q20 A;  4JAV A;  5KA6 A;  3ABM C;  2F66 C;  1N36 B;  4O4H B;  4MW8 A;  2CUG A;  4CS2 A;  2ZM6 B;  1XNQ O;  4B3S B;  4B3M B;  4JAA A;  4X64 B;  4FLX A;  2X7R B;  3FYI B;  3D3I A;  3F7Y C;  2QKC A;  2IBZ H;  1AVM A;  3NXS A;  2ATK C;  4BIZ A;  4DR5 O;  1SZT A;  3OTO B;  5EC2 C;  5L3G A;  4TQF A;  1NBM G;  1WA8 B;  1F4M A;  1X59 A;  3G67 A;  3T1Y B;  1YIT V;  1PL4 A;  1B6Q A;  4O4H A;  4UVB A;  2UUB O;  4YY3 O;  2WLL B;  3IJ4 A;  3JAM N;  2Y69 C;  1IX9 A;  1VQ6 V;  1Y76 B;  5LOV B;  4B3M O;  1TUB B;  2WPD G;  2E75 B;  3JAK A;  2ZXW C;  5KAI Z;  4WF9 V;  4RUF A;  1DGS A;  1LR1 A;  2UXC B;  5JQG B;  3LDD A;  4LFC O;  4DV0 B;  4FLY A;  4H33 A;  2YEV B;  3DXR B;  2OT5 A;  4JF3 A;  4JI3 O;  3A0H Z;  3L70 H;  1N8R W;  2R9R B;  2GTS A;  2QM4 A;  1PV0 A;  3CRR A;  4UV9 A;  5KHG A;  2DWE C;  1G4Y B;  3BAA A;  4F6R B;  5IDJ A;  4O4J B;  1Q82 W;  4PEL A;  4W4K A;  5FNV B;  2KB1 A;  4I5S A;  3F5T A;  4YXW G;  4E4E A;  1K4C C;  1R3L C;  5BY1 A;  4OX9 O;  2UXD B;  2W6J G;  4DR7 O;  2KSD A;  5K1P A;  1KP3 A;  4LR3 A;  1US6 A;  3ZMZ A;  1XMQ O;  1OZ0 A;  4GKJ B;  4B3S O;  1QLE C;  4N23 A;  2P06 A;  5L3B A;  1UPG A;  1SET A;  1VAR A;  1F23 A;  4O2A A;  3P30 A;  4U7N A;  1XHZ A;  3I5D A;  1DTO A;  3J80 N;  4FLV A;  4QE9 A;  3UO2 A;  1MZF A;  3LSQ A;  4KL1 A;  2A9H A;  2N74 A;  1YI2 V;  3QVN A;  3KCY A;  2EIL B;  1JA8 A;  3RYC A;  2HG5 C;  3H1K H;  2BCC H;  4FFB A;  4B3T B;  1G8M A;  5LP6 B;  2JGD A;  4QGP A;  4IYH A;  3UT5 A;  1ROP A;  2R72 A;  4MT8 A;  2UXB B;  1JFF B;  1KKC A;  4ZOL A;  1V9P A;  4U7O A;  1I5X A;  3ZRV A;  1GRJ A;  3ABT A;  2RQ6 A;  1TGO A;  2H3O A;  1AJN A;  1VQ9 V;  1H5W A;  4HBN A;  4DR4 B;  2BTO A;  4G2K A;  5H5N A;  1FXH A;  1S76 D;  1VQM V;  3QTC A;  3CCJ V;  3JAK B;  3EVK A;  2GSM B;  1IVS A;  3ASN B;  1KB9 F;  5B1O A;  4DR3 O;  4UCV A;  3W7X A;  3G80 A;  3JAT B;  2DYS B;  4CC6 A;  3CD6 V;  4LNU B;  2HVK C;  4F6R A;  4D7T A;  1AI6 A;  1XMO O;  4UB8 Z;  5JCO C;  2NR5 A;  4N21 A;  1VP7 A;  1VF6 A;  5EK0 A;  4WFB V;  5KHI A;  4P9P A;  5F2V O;  1SES A;  4J7K A;  4I50 B;  1NH2 B;  3RYF A;  3H1I H;  3SYA A;  2E5L O;  3K5O A;  4XDK A;  2BSK A;  3N2G A;  5KX5 A;  2VQE B;  1A32 A;  3E86 A;  1VQ5 V;  2ZIO A;  5IYZ B;  3C90 A;  3CWB H;  3E8H A;  2YEV A;  5LGN A;  4X65 O;  2Q7E A;  4J10 A;  1FXK A;  2QWR B;  1N4C A;  5JVD A;  1ZAU A;  3CRQ A;  3LSS A;  5J2T A;  1IBK B;  2EBO A;  1I7F A;  2R9I A;  3ZRS A;  1Y76 A;  1BMF G;  2YXH A;  1S72 V;  3E89 A;  2YID A;  5KHK A;  3A0B Z;  2IJK A;  2XHB A;  1AI5 A;  5FPR A;  3ZCC A;  3OM3 B;  3ZJZ A;  4DV1 O;  4YIP A;  4IGG A;  3AK3 A;  4GX5 A;  4NVP A;  4RUE A;  1NTZ H;  1H2L A;  2PTM A;  4Z1M G;  4CH3 A;  4DV3 O;  1HDJ A;  2ZR3 A;  4DW0 A;  1N33 O;  1XDC A;  4FLU A;  4PDL A;  4KHP O;  1FFT B;  2Q7H A;  2HVJ C;  5CN0 A;  2Q67 A;  2WLM A;  2WLH A;  1Q43 A;  2FKX A;  3RVZ A;  3C3T A;  1PNM A;  5IWA B;  4RQF A;  1R3J C;  1GK9 A;  1XHX A;  4TUY B;  1THZ A;  3DSQ A;  4DR6 B;  2BOB C;  3W7U A;  1CPY A;  4PA7 A;  2Q0A A;  2WLJ A;  4JTD B;  5AG2 A;  1BGY H;  4AQY O;  2WA3 A;  4EFE A;  1FFX B;  1Y74 A;  3STL C;  4NYK A;  1FD9 A;  1XI1 A;  2P4V A;  4GUN A;  5LMU B;  4IIJ A;  4MVQ A;  3CCQ V;  1I94 O;  4QNH B;  3OR6 C;  4RAI A;  5L3C A;  3MAQ A;  5B3S C;  5CB4 A;  1AI7 A;  4JI8 B;  5LBQ A;  2IH1 C;  1GM9 A;  1PKX A;  3BHP A;  3CC7 V;  3OGC C;  4DV1 B;  5ITZ B;  1AI4 A;  5EZY B;  3L71 H;  1RPR A;  5FL7 G;  1Y67 A;  1AIL A;  1WP8 A;  1KD1 W;  1VMG A;  4WFG A;  1L8D A;  4Z1V A;  3R66 A;  2RNB A;  2VWJ A;  2PY5 A;  4UCS A;  2CTQ A;  2EIL C;  3OTO O;  1SQV H;  3OR7 C;  3S3X A;  4YJ3 A;  4YHH B;  4LBE C;  3LNM B;  1H2N A;  2GBO A;  3ZHT A;  2R70 A;  1IZ3 A;  4FLZ A;  1PD3 A;  2A79 B;  3CXH F;  3J81 N;  1FAF A;  1M56 B;  3CRM A;  2PUS A;  1YTF D;  1GAX A;  4JI6 O;  5B66 Z;  1Q8I A;  3H1L H;  4DV0 O;  1IXM A;  1IJG A;  1Q6U A;  1EN4 A;  4DR4 O;  1Z5V A;  5EYP A;  4MTF A;  4ABM A;  3A2F A;  3R65 A;  2VWK A;  4DV5 O;  1S5L Z;  3X2Q B;  4X1Y B;  3AG2 C;  1FJG O;  5BMV A;  3ZHV A;  5A2Q N;  2KKW A;  1GM8 A;  5LYJ B;  1K9M W;  1SQG A;  4B7E A;  5LHI A;  5JH7 B;  1GH6 A;  4YHH O;  2Y0P A;  4QJF B;  3JD4 A;  4LH6 A;  2F93 B;  1GTO A;  2HJD A;  2RMK B;  4K3A A;  4JZG A;  3ZHS A;  3HKB B;  1PNK A;  2W0F C;  3FB5 C;  3M7M X;  5CA1 B;  4I0X B;  4U3F H;  1M57 C;  2F4V O;  2OCH A;  2ZD9 A;  1VQ7 V;  2Q5Z A;  2KG7 A;  4PI0 A;  2LP7 A;  2YIB D;  3ETE A;  4TV9 B;  1SRY A;  1N32 O;  3JAR A;  1OHH G;  3JCU Z;  4MVS A;  3CYO A;  3MD0 A;  1GN4 A;  1KC8 W;  5J2U A;  2XOK G;  1JJO A;  3CCE V;  2JJ2 G;  3MHS C;  3KCX A;  2GHY A;  3DGE A;  4JI4 O;  5IJ9 B;  4UV8 A;  1BE3 H;  4L87 A;  4EB6 B;  4UVC A;  1ZUQ A;  5TIS Z;  1O9H A;  3CCL V;  4RO2 A;  3BA9 A;  2CK3 G;  4MTO A;  2CAZ C;  3AG3 C;  2WLN A;  4HAM A;  2B9Z A;  2JS3 A;  3G71 V;  2ZNJ A;  4DRX A;  1W2B U;  1AR4 A;  2ILM A;  4GX2 A;  3CRC A;  3ETD A;  4DUY O;  3MHH C;  4JGS A;  1KYO F;  1JQ0 A;  1R3K C;  4O4L B;  4OXS A;  4X64 O;  5IY5 C;  4WCE V;  3FD9 A;  2A7W A;  1P7G A;  1S3J A;  1VQN V;  2LQT A;  5H6R A;  1PL0 A;  4DR6 O;  1YXB A;  2IU0 A;  4XBF A;  4JI1 O;  1YF2 A;  1KBH A;  3U0Z A;  4NTY A;  4JV5 O;  5BR8 B;  3CX5 F;  5LMN O;  1ZWI C;  2WAM A;  2ZE5 A;  4PJ0 Z;  2AHZ A;  4DR5 B;  3IGA C;  1NR7 A;  1KKD A;  5LXT B;  1IBL B;  1MA1 A;  4FFK A;  2RN9 A;  3ZN0 A;  5JVD B;  4LNU A;  2JGU A;  4ASU G;  3CC4 V;  5KAF Z;  1SQX H;  4WFA V;  2EJ7 A;  2UU9 O;  1ZL8 B;  3G6B A;  2ZXW B;  3SR2 C;  1VIB A;  2JS5 A;  4NXN B;  1W0J G;  3G4S V;  1HW7 A;  1TUB A;  3K79 A;  3HKC A;  2XAG A;  5EYP B;  2HHH O;  4I50 A;  4LF7 O;  4X65 B;  4X1Y A;  1SA0 B;  5KA5 A;  2DYR B;  4CS4 A;  1XIL A;  4B3R O;  2Q8V A;  4TV9 A;  2AW9 A;  1NVP D;  5KLV H;  4MVR A;  5JH7 A;  2HLD G;  3RFR A;  1MSD A;  3RYH B;  3SGI A;  4JI0 B;  3SJB C;  4NKG B;  4K8X A;  1HNW B;  5LL6 Y;  3TJT A;  4PA6 A;  4TUY A;  2LGQ A;  2XAH A;  4LF5 O;  3ZHQ A;  4JAU A;  3MDS A;  4WBN B;  2YUA A;  4JI6 B;  2L35 A;  4BW9 A;  4P30 A;  1PM9 A;  1VF5 B;  1B3Q A;  1H8E G;  2WWW A;  2YSU B;  3KDR A;  2K1E A;  4GYC B;  2EIM C;  2KG7 B;  4TT3 G;  3SDL A;  2AXT Z;  4BR6 A;  1F7Y A;  1N33 B;  4LFB O;  3SYQ A;  1QVF U;  3N2K A;  4NR1 A;  4PV1 B;  5CA1 A;  2GUZ A;  4TV8 A;  3ZMU A;  2F95 B;  3LDE A;  5EBL C;  2OIG A;  1HR0 B;  1G1X B;  4FVM A;  2GTA A;  3K5N A;  3UKM A;  2CGN A;  3CRA A;  2MK3 A;  4PA3 A;  3APO A;  3SJC C;  3FX7 A;  3L72 H;  4L8J A;  4JI3 B;  3CPW U;  1P7B A;  4YJ3 B;  4J42 A;  3ZHR A;  2JK5 C;  1QLE B;  4MTG A;  5L3F A;  4IL6 Z;  1NR1 A;  3DC5 A;  4J11 A;  5HFM A;  1S77 D;  3D36 C;  4FM0 A;  1F51 A;  2XTA A;  2D3O W;  1FXK B;  2UXD O;  1HNZ B;  2OYQ A;  5L3D A;  2BTQ B;  1XMQ B;  3ASO B;  5ITZ A;  3TGU H;  1KUQ A;  5KMG A;  3CME V;  2X6C A;  3ZRW A;  1OCZ C;  4I9Q A;  2BSK B;  2YS8 A;  4JI2 O;  5BMV B;  1W59 A;  2JRI A;  1SA0 A;  2VQE O;  3K06 A;  4EEQ A;  1TVK A;  5HFL A;  4JYA B;  3RYI A;  4O2A B;  5FNV A;  1PPJ H;  4TOI A;  4DK0 A;  2ARH A;  3RWR D;  3OEH G;  1BHA A;  4KFM A;  2BE3 A;  3IFX A;  3AG4 B;  1N34 O;  4UFZ A;  2YI8 A;  1JNB A;  3GVM A;  1S0V A;  2ETN A;  5KUM A;  4BIO A;  2DW4 A;  3O9O A;  3HKC B;  5CA3 A;  3U11 A;  1S5J A;  3RBZ A;  2DQ3 A;  2DYR C;  4KP4 A;  2DOS A;  4NTW A;  4DV3 B;  3UT5 B;  3SJA C;  1EBO A;  3ZBH A;  2ADQ B;  5DM6 V;  4B3T O;  4WFH A;  1PNL A;  1NS1 A;  5GW7 A;  1OCR B;  3CSX A;  5CB4 B;  4FJC C;  2ZM6 O;  3W7W A;  3G6E V;  4DW1 A;  4ZIB A;  1N0N A;  2G38 A;  4O4I B;  1BQ0 A;  3SPC A;  4R7C A;  1XNR O;  1VQK V;  4IT5 A;  5EIB D;  1TAE A;  4KHP B;  1R6T A;  4WFE A;  3H1H H;  3ZMT A;  4PDV A;  2UXB O;  2IU3 A;  3ICX A;  3K3W A;  4Z2W A;  2NN4 A;  2QR4 A;  3M8A A;  3CHX A;  5EIB C;  2WLI A;  3A0R A;  1M5I A;  3ZS8 C;  2UUA B;  2UXN A;  5LP6 A;  5C8Y A;  2XAS A;  2XUM A;  3B4S A;  4KXR A;  4DXW A;  4K0K O;  1SQQ H;  5CBH A;  1H38 A;  2RDC A;  1V54 C;  2OCC C;  3T1C A;  2NLJ C;  3K0G A;  3C3S A;  2KQX A;  1BSM A;  1Z5W A;  2UXC O;  2QJ1 A;  1FS0 G;  2CTR A;  3LNN A;  1TVK B;  4GKJ O;  2QDO A;  4H44 B;  3CMA V;  4O2B B;  4JAS A;  1YEW A;  1URF A;  4D7S A;  3BPZ A;  3WFV A;  1WNS A;  3FAV A;  3CCM V;  4P9O A;  3X2Q C;  1BCC H;  4J7J A;  2QGN A;  3T4Z A;  3SYP A;  4DK1 A;  4AIL C;  4MW3 A;  3OUF A;  4HNA B;  3K03 A;  2LFR A;  3VQV A;  4X1K B;  4X88 A;  1WPB A;  1FJG B;  2F23 A;  4I7Z B;  1ZX3 A;  1K5S A;  4DR1 O;  4JPR A;  4DV6 B;  4QPK A;  4YJ2 B;  1VEW A;  1AP6 A;  4FPP A;  3WB2 A;  4PD4 F;  3H01 A;  2WLL A;  1QHT A;  1QVG U;  4EFB A;  1K73 W;  1OCO C;  3JAW B;  1NVP B;  1P4R A;  2JDI G;  4BW5 A;  5CA0 B;  2EIK C;  3B77 A;  1YJN V;  2ZE8 A;  1WP7 A;  2Q7G A;  3RYF B;  2UUC B;  3E8G A;  1VQ4 V;  3WU2 Z;  2D2C B;  3UCS C;  3SPJ A;  2DMX A;  3QO5 A;  2CE4 A;  1L0L H;  4WFF A;  3CC2 V;  1Y74 B;  2E3C A;  4X9Q A;  4W4L A;  1XUQ A;  3ZX6 A;  4D6T H;  4X1I B;  1M90 W;  1TA8 A;  4GKK O;  2PF4 E;  1FKA O;  2JVD A;  1GMG A;  1MSW D;  1OCR C;  3SPH A;  1K97 A;  5IJ9 A;  1Q5O A;  2L6L A;  2ZDI C;  2A3Q A;  4BWA A;  3ABK B;  2V1D A;  4FZ0 A;  1MMM A;  3UM7 A;  4GZR B;  3IC7 A;  5KHJ A;  2R9A A;  5LP6 C;  3JCZ A;  1GM7 A;  3LSU A;  1UJW B;  1Q6I A;  2FL4 A;  1YDX A;  4LF4 O;  3S3W A;  3SYC A;  3BVO A;  2CGO A;  3HKD B;  1EN5 A;  2PI5 A;  1H2K A;  1YJW V;  3D3Q A;  4CS3 A;  3K08 A;  1BS3 A;  4CC5 A;  1NTK H;  4UCR A;  3JAS B;  4GCZ A;  4B7K A;  1XMO B;  4B08 A;  2HP8 A;  1Y4M A;  4PA9 A;  2JEU A;  2JGD B;  1VF6 C;  3U10 A;  1BZK A;  5LGU A;  1BHB A;  3I55 V;  4IHJ B;  2P4K A;  2ZE6 A;  2LW7 A;  4HNA A;  1SQP H;  4DV2 B;  1WN7 A;  1YVW A;  4DR2 B;  5JQG A;  3JAT A;  1B04 A;  3K0D A;  1QR9 A;  1XNR B;  4DUY B;  1BL8 A;  2WA4 A;  3JSN A;  1Q86 W;  4DV7 O;  4QPJ A;  1I08 A;  3L74 H;  4J9Z B;  3L73 H;  1M9N A;  1XL4 A;  1H2S B;  4G27 B;  4C7U A;  1DLB A;  2OTJ V;  3GB7 C;  1JVM A;  1JJ2 U;  5A9G A;  3CCS V;  2QWQ B;  3WG7 C;  1ARO P;  5EZY A;  2DN9 A;  2P5O A;  3ABM B;  1Q90 D;  3AEI A;  4XDJ A;  4AI8 A;  3FAV B;  4NXM B;  3K5M A;  5KX5 B;  1YSC A;  4EKW A;  2V4D A;  2Y4T A;  2NNU A;  3FB6 C;  1N36 O;  1QBZ A;  2IJJ A;  3OMI B;  5LYJ A;  1HNX O;  1OV9 A;  1QNM A;  2Q4P A;  3RGB A;  3APQ A;  3CP1 A;  4E2L A;  1JX9 A;  5E1A C;  1L1F A;  4UUJ C;  3HPL C;  4I55 A;  5KMG B;  4LH7 A;  3VOU A;  4GX1 A;  3CXC U;  2UU9 B;  2YIB A;  4JTC B;  4R50 A;  4J9Y B;  3ABL B;  1LUW A;  2W0X A;  4U3J A;  4JI8 O;  4TV8 B;  3QO8 A;  1KEC A;  4LFB B;  4FLW A;  1MOF A;  3VQX A;  1ZTE A;  1SKV A;  1B06 A;  1AB3 A;  2ZT9 B;  2X6A A;  1IBM O;  1M93 A;  1GN2 A;  2OIE A;  4JI5 O;  2V7Q G;  3UQ8 A;  1KQS U;  1HNX B;  1J5E B;  4AQY B;  2K9P A;  5B3S B;  2QKA A;  5CA0 A;  1Z2G A;  2CH7 A;  1NTM H;  4HYO A;  3ABK C;  1H8H G;  1GKF A;  3JYC A;  5LHG A;  1V55 C;  2ZR2 A;  3IAY A;  2XT9 A;  1KU9 A;  3E22 A;  2BOC C;  4CZZ A;  3HKE B;  4ZHQ B;  3WG7 B;  3FYE B;  1R73 A;  4MTX A;  2N04 A;  1ZLZ A;  5LGT A;  4K8Z A;  3BY6 A;  3ZHU A;  4X20 A;  2VQF B;  1SZX A;  1MG1 A;  4ZI7 A;  1H2G A;  4J7Z A;  3DC6 A;  2A06 H;  2JIZ G;  3RN4 A;  4QIW F;  5IE9 A;  2Y4U A;  4K0K B;  2EIJ B;  1HR0 O;  2GUZ B;  5LHH A;  3F7V C;  1DF5 A;  5LA6 A;  3VBB A;  4MVU A;  5BXZ A;  1NJI W;  1SER A;  4DUZ O;  1Y66 A;  3BAB A;  3ZMS A;  1K7D A;  4G28 B;  3JD2 A;  3RT3 C;  3BA8 A;  2ZCE A;  1YIJ V;  3HKD A;  3B8N A;  2RJZ A;  5LXT A;  5KHH A;  4CH6 A;  3CS5 A;  4NB5 A;  4B3R B;  1SS3 A;  4QE7 A;  2QWO B;  1VQL V;  3FB7 C;  1OCC B;  2X0L A;  1WLE A;  4CH4 A;  1JOY A;  3I56 V;  5JCO A;  4I9W A;  4JI0 O;  3QO7 A;  1GO3 F;  2IJI A;  4LF5 B;  2BTQ A;  1N34 B;  5JWP A;  1DF4 A;  1JR9 A;  3FFQ A;  2UUB B;  2PYJ A;  1WA8 A;  2DE0 X;  2QTO A;  1E1Q G;  2O57 A;  1NKD A;  2EIN B;  3KZI Z;  4JYC A;  5BZB A;  1RM1 B;  5LMU O;  2YXL A;  2FB5 A;  4UCO A;  5DEC A;  4DV6 O;  2HFE C;  4YJ2 A;  3L9D A;  5KUK A;  2QTS A;  3RYH A;  3FB8 C;  4O4J A;  1R6N A;  3OE7 G;  1P84 F;  3QNE A;  2YIA A;  2CH7 B;  4X89 A;  3JAW A;  3RYC B;  1VQ8 V;  1E1R G;  4FFB B;  2EIJ C;  3OEE G;  1MAB G;  2PYL A;  3AK2 A;  2XND G;  1ZSP A;  4UVA A;  2WLI B;  3E8F A;  4OX9 B;  3AG1 B;  3HKE A;  2E76 B;  5BR8 O;  4IYI A;  4FMT A;  4LWS A;  1RP3 B;  3E2E A;  1U96 A;  1T5E A;  2Q9L A;  2WSS G;  1PP9 H;  2MW2 B;  3L75 H;  2OTL V;  4F6E A;  2ODM A;  2Y48 A;  4J41 A;  1L0N H;  2B5U A;  5LMN B;  4BIU A;  4X62 O;  1COW G;  1X4T A;  2X6B A;  4JI1 B;  4EB6 A;  1I5Y A;  2B1G A;  4PDM A;  1EZV H;  3A8T A;  2ZIM A;  4MS2 A;  3QG5 A;  4X8A A;  3D36 A;  3AK1 A;  4AHC A;  4WBN A;  4ICG A;  3EFF K;  4FZ1 A;  1K4D C;  1Y6X A;  3B2E E;  3AG7 A;  2F1M A;  1KMI Z;  5L3E A;  2WLK A;  4XDL A;  5IJ0 B;  1D5N A;  2LO1 A;  4YIO A;  3GWK C;  3AG2 B;  1I0H A;  2DJV A;  2YC0 A;  4PI2 A;  1M57 B;  2ZDI A;  4LC1 A;  3ZIA G;  4ZI7 B;  4DV5 B;  1IDS A;  2IW5 A;  3OD4 A;  3OMA B;  5FPO A;  1CEZ A;  1S5H C;  3T4D A;  2F4V B;  2UUA O;  3DTU B;  4LFA B;  2P22 C;  2Q69 A;  3B8M A;  4A5U B;  1XOU A;  2P90 A;  1MNG A;  4MVO A;  1DK1 A;  5CBF A;  3T2M A;  3THO A;  2LJ2 A;  5CMU A;  4DV7 B;  5EC1 C;  3N27 A;  2AHY A;  4KUM A;  1YTF B;  1IXB A;  1YZB A;  4LCU C;  4MVZ A;  3WB1 A;  4JI7 O;  4LFC B;  2FML A;  2HKO A;  3H1J H;  2Q73 A;  2QE7 G;  2VQF O;  3CEI A;  4JYY A;  1SQB H;  1RFY A;  1AJQ A;  1NH2 D;  2Z0A A;  4LF7 B;  1JPX A;  3GWO A;  4OGQ B;  4FIP C;  4JI4 B;  2Q0O C;  4CH5 A;  1Q7Y W;  3IC9 A;  1N0J A;  2C2A A;  1HP8 A;  2EUL A;  1K34 A;  2IH3 C;  1XRE A;  5IT9 N;  3ZN1 A;  4U3J B;  3BEH A;  4YY3 B;  4PA4 A;  3UO3 A;  2F43 G;  4FM1 A;  1I94 B;  4R8C A;  4K35 A;  3P32 A;  4O4I A;  4HZ3 A;  4GKK B;  5B1B B;  1YJ9 V;  2GDS A;  1XEQ A;  3N2G B;  4H37 A;  1WB8 A;  4X66 O;  5D5P A;  2ITC C;  2P6J A;  5H6Q A;  4P2Z A;  1G6U A;  3JAL B;  4BAY A;  4LF9 B;  3LUT B;  3P3N A;  3ASN C;  2ADP A;  1IBK O;  1WB7 A;  2ZKO A;  2M6Y A;  1J5E O;  2ZQM A;  3AG1 C;  1VQP V;  3FKS G;  2LGW A;  1ORQ C;  3O65 A;  3ABU A;  1F4N A;  4CBC A;  5J9P C;  3N2K B;  2AGA A;  5B1N A;  4UCT A;  2JJ1 G;  1NZ6 A;  2VS0 A;  2M7W A;  5JJE B;  2DQ0 A;  3OTF A;  3E35 A;  2HR3 A;  2EZP A;  1LUV A;  3F5W C;  2EIN C;  1RM1 C;  1R6K A;  2Q6A A;  1AJP A;  3JD3 A;  4MSW C;  2H94 A;  3JD0 A;  2XAF A;  3K5L A;  2JEX A;  1AR5 A;  1OCO B;  4FK5 C;  4OPA A;  1FFX A;  4LF6 O;  2E74 B;  2FYU H;  4LF8 O;  1E79 G;  4PHZ A;  4LP8 A;  4X20 B;  5FLX N;  4J80 A;  3TXQ A;  3BCC H;  2AZ2 A;  2Z3Y A;  1QU7 A;  3PN1 A;  4NXM O;  2HHH B;  3CCR V;  1QLN A;  1NT2 B;  1FYJ A;  2IM9 A;  1K5Q A;  3E8B A;  1M1K W;  3JAS A;  4I4T B;  4ZHQ A;  1Q3E A;  2QKS A;  3KG2 A;  3BRC A;  1JFF A;  2IJH A;  4R6Z A;  4DV4 B;  2XAJ A;  1AR1 B;  3K9S A;  4RWU A;  1XBL A;  5B1A B;  4DR2 O;  1WJZ A;  2CTW A;  4LF8 B;  4NTX A;  3JD1 A;  5LA6 B;  1VQO V;  2EIM B;  2DYS C;  5D5Q A;  1WAZ A;  3CJH B;  5IY5 B;  1TUE B;  2QM7 A;  3OFN G;  4DYL A;  2ITD C;  2P67 A;  5B5E Z;  1VF7 A;  3QF7 A;  1GN3 A;  2UXX A;  5GON B;  1M4U A;  1OCC C;  4H13 B;  4JV5 B;  1QCE A;  5IYZ A;  3RYI B;  3NR7 A;  3OT7 A;  2YXY A;  2PI4 A;  3E83 A;  3ETG A;  2QWN B;  3CCU V;  2EJR A;  4FLT A;  3CJH A;  4UXN A;  3Q4H B;  1BQZ A;  5B1A C;  1XL6 A;  3M99 B;  1V55 B;  1KP2 A;  3W7S A;  3JAL A;  5IYB O;  4UCU A;  1HNZ O;  5EBW C;  2P7T C;  3J7A U;  5GON A;  1K33 A;  4MVM A;  5DN6 G;  3HR0 A;  2Y0I A;  1EM1 A;  4JI5 B;  1OJH A;  5B1B C;  1M56 C;  1NU1 H;  3ML0 A;  1LNQ A;  1MZE A;  1JMK C;  2A0L A;  3ASO C;  1O9G A;  4ZOL B;  1R3I C;  5J2T B;  4TSF G;  1W0K G;  4FM2 A;  5CBG A;  1QQC A;  2FTK A;  1WPX A;  3T1H B;  1J95 A;  1JCH A;  4JTA B;  2GV9 A;  4X1I A;  3W7T A;  1K8A W;  2H8P C;  1CP9 A;  1IUR A;  4GLX A;  1RPO A;  2PZS A;  4JI2 B;  2VRZ A;  3TK1 A; 
#chains in the Genus database with same CATH homology
 3LSU A;  3KDR A;  3K9S A;  1XDC A;  2RCV A;  4BR6 A;  3KKY A;  1LUW A;  1P7G A;  3C3T A;  1D5N A;  1EN5 A;  3BFR A;  4JZ2 A;  3EVK A;  2ADP A;  1WB7 A;  4YIO A;  1ZTE A;  1I0H A;  1B06 A;  1BS3 A;  4E4E A;  1JR9 A;  1GN2 A;  1IDS A;  5AG2 A;  2ADQ B;  4JZG A;  1GN3 A;  1MA1 A;  4FFK A;  2QKA A;  1VEW A;  2P4K A;  4GUN A;  1AP6 A;  1VAR A;  1AP5 A;  1MNG A;  1N0N A;  3OT7 A;  1LUV A;  3DC5 A;  1IXB A;  2CDY A;  1I08 A;  1AR5 A;  1ZLZ A;  4C7U A;  1GN4 A;  3CEI A;  4JYY A;  3QVN A;  1Y67 A;  1SZX A;  2QKC A;  3AK2 A;  1JA8 A;  1ZSP A;  5A9G A;  3DC6 A;  1AVM A;  2CE4 A;  3IC9 A;  1BT8 A;  1N0J A;  1XIL A;  3RN4 A;  2AW9 A;  1GN6 A;  1EM1 A;  1XRE A;  4X9Q A;  1PL4 A;  1MSD A;  1ZUQ A;  1XUQ A;  1EN6 A;  4F6E A;  1QNM A;  3TJT A;  1KKC A;  2GDS A;  1IX9 A;  1WB8 A;  3C3S A;  4YIP A;  3MDS A;  1AR4 A;  1BSM A;  3AK3 A;  1MMM A;  1PM9 A;  1EN4 A;  3AK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...