3EVKA

Crystal structure of the metal-bound superoxide dismutase from pyrobaculum aerophilum
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
211
Chain Sequence
b'SVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Fe]
molecule tags Oxidoreductase
source organism Pyrobaculum aerophilum
publication title Crystal Structure of the Metal-bound Superoxide Dismutase from Pyrobaculum aerophilum and Comparison with the Metal-free Form
rcsb
total genus 78
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3evkA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3evkA02
1MA1A 3AK2A 1GN6A 4JZGA 1ZLZA 2GDSA 4JYYA 1IDSA 3CEIA 1AR4A 2CE4A 1D5NA 2P4KA 5AG2A 1PL4A 1GN3A 1AR5A 1GN4A 1ZSPA 1IX9A 1LUVA 1VARA 2ADPA 3AK1A 1AP5A 1BS3A 3BFRA 1JA8A 1MMMA 2AW9A 3C3SA 1I08A 4GUNA 4JZ2A 1BT8A 4X9QA 1N0JA 4YIOA 3KKYA 3EVKA 4C7UA 2QKAA 3TJTA 1EN4A 1Y67A 1VEWA 1QNMA 1EN6A 3RN4A 3IC9A 2QKCA 1IXBA 1WB7A 1XDCA 1SZXA 1XREA 1MSDA 4FFKA 1EM1A 1EN5A 1LUWA 3QVNA 1KKCA 1AVMA 1XUQA 1I0HA 1MNGA 3DC5A 1ZTEA 3DC6A 1N0NA 1XILA 1P7GA 1WB8A 1GN2A 1AP6A 2ADQB 3K9SA 3OT7A 3MDSA 1BSMA 1ZUQA 4BR6A 3LSUA 2CDYA 3C3TA 1JR9A 2RCVA 3AK3A 5A9GA 4YIPA 1B06A 4E4EA 4F6EA 1PM9A
chains in the Genus database with same CATH superfamily
3GWKC 2UUAO 1HW7A 1R6TA 2PY5A 1BGYH 3X2QB 2E5LO 2HFEC 3IFXA 5LMUO 5CB4A 1SQQH 2EIKB 3FAVA 4ZI7B 1BL8A 1QLEC 3HKBB 1OCCB 3E86A 4WCEV 2QDOA 4I4TA 5FLXN 4MTGA 3CCRV 2HHHB 2AW9A 3SYPA 4DUZB 4YJ2B 4JZ2A 3A0BZ 2YXHA 5EIBD 5KA6A 4LFCB 4I9WA 4UVCA 2V1DA 2D2CB 4JTCB 1U96A 3ZN0A 2QKAA 1QU7A 3H01A 3CSXA 2IM9A 3ML0A 3SGIA 3LUTB 1XDCA 3H1HH 1IBMB 1JQ0A 2UUAB 2XTAA 4O4IA 2WPDG 2ZT9B 3JAKB 4NB5A 1K34A 4F6RA 1IBKO 1FAFA 1DF5A 1K5SA 5JWPA 3K57A 1VQLV 1SC5B 4JI2O 1N8RW 3LNNA 3RYCB 4TUYB 5H6QA 3UCSC 5JJNB 4LF6B 3JARA 5KMGA 2JS3A 3IAYA 4CZZA 1VQMV 1CP9A 2Z0AA 1R3LC 4BAYA 1OCCC 3ZIAG 2WWWA 3N2KA 3SPIA 2IW5A 3ASOC 5GONA 2UU9O 4D7SA 4H0LB 2P7TC 4YIPA 5LHIA 4UUJC 3ZMZA 4YXWG 2WA4A 3B4SA 3VQVA 2W0FC 4GX2A 1Y76B 3U10A 1KECA 1TVKB 3WG7B 1NS1A 3JD0A 1VQ9V 1NI8A 2Y69C 4JV5B 3BA8A 3RYFA 3LDEA 4JI5O 3I5DA 4O2BB 3ZRSA 4JYBA 2JK5C 2WSSG 4Z1VA 2ADPA 4JI0O 1VMGA 4TV9B 2YEVB 1IBKB 1WLEA 1XOUA 2UUCO 3JALB 4IIJA 1ZAUA 5KHJA 3CCMV 1JCHA 1K4CC 1R3JC 4AILC 4J9ZB 4WF9V 1YHQV 1N0JA 2X6AA 2QTOA 4I55A 3OTFA 1GRJA 3H1KH 3H1JH 3JATA 2LQTA 3JCUZ 4DRXB 2F66C 3HKDA 2V4DA 1WJZA 2Y48A 5CA1B 4IL6Z 4LNUA 4GKJO 1S77D 4B08A 1EM1A 3K79A 1TAEA 3FB5C 1N32O 1HR0O 4JI3B 2RN9A 4AQYB 5JCOC 4UCRA 1VP7A 4MVMA 2CTRA 1N36B 2JDIG 2PTMA 1VQ7V 5LMNO 4LFBB 1VF5B 1SKVA 3MDSA 3ZHUA 1NTMH 1P49A 5LA6B 2ATKC 1EZJA 4FPPA 2NLJC 2WLJA 1VIBA 2DQ0A 4QJFB 3HKBA 2KSDA 4EFEA 2Q7GA 5HFMA 2EIJC 5LHHA 1TUBB 4JI6O 2EBOA 2LFRA 2W0XA 1WNSA 3STZC 2OCHA 4E4EA 3CXHF 4LF8O 4BW5A 4NXNB 3JSLA 1Y74B 3CJHB 1OCOB 1AROP 5E1AC 3RFRA 1IXMA 5JH7A 1M5IA 4FLWA 3N27A 3T1HB 4X20A 5DEDA 4HZ3A 3K59A 3MHHC 2HHHO 2YSUB 4RUFA 1SQPH 3BFRA 2QM7A 4GCZA 5LP6B 2YIBD 2DMXA 1JFFA 1XNRB 3OUFA 2JGDB 5KMGB 1Q7YW 4J9YB 4Z2WA 4JI7B 3AG2C 4H33A 1OCZB 3EVKA 1LNQA 3AG7A 3OGCC 1KP2A 3K0DA 3OMAB 4LH7A 3IC9A 4LF4O 2IJIA 5D5PA 1XREA 1Y66A 5KX5B 4ZBMA 4TSFG 1FKAO 4CH6A 2P4VA 1DF4A 1N34O 3WFVA 1MNGA 4JASA 4JI8B 3E22A 4DV2B 3CRRA 1WB8A 1SF9A 1FS0G 3P3NA 1F4NA 3K9SA 4GT1A 2FL4A 1KP3A 2XHBA 2EILC 2JGDA 2NN4A 2A3QA 3FFQA 4U3JB 4DV1B 4NXMB 1K92A 4U7NA 2PYLA 1M56B 3CMEV 1DK1A 1NTKH 1WP7A 2GSMB 4B3RB 1YXBA 1N4CA 2QWOB 5BXZA 2Z3YA 3CCQV 1SQBH 3ICXA 3UKMA 1JMKC 3F7VC 2XAQA 4RWUA 1PL4A 2HJFC 5ITZA 4X1IB 4MT8A 5JQGB 4YHHB 4B3MB 3JCZA 3AEIA 3S3XA 5C93A 2Y0IA 5EZYB 5KUKA 1BS3A 4XDLA 3VQYA 2EIMB 4DV3O 2F93B 1TUBA 2DWEC 3SJCC 4I55B 1K8AW 3N2GA 3AG2B 4YY3O 1HP8A 5H2FZ 3AG1B 1YI2V 2CAZC 4GKKO 1H38A 1IBLO 1K4DC 3FX7A 4FLXA 2AZ2A 3M99B 1SA0B 4TQDA 3ZHQA 4TV9A 2LJ2A 2N05A 4X8AA 1HNWO 4X1KB 2B5UA 1F51A 1U97A 4QGPA 4B3RO 5ITZB 3CCLV 5KHIA 1GM9A 2DJVA 1VQ6V 2R9IA 3HKDB 2E3CA 2AXTZ 5B1OA 1GTOA 1I0HA 1ENVA 1BCCH 5H6RA 4DR2O 5EYPA 4X62B 1VQ8V 4NVPA 4FZ1A 2HLDG 2VS0A 3SJAC 1K73W 1F7YA 4FZ0A 3ASNB 3T4ZA 4DV5O 4LCUC 2OIEA 2UXBO 1AILA 1KU9A 2ITCC 1HWYA 4DR4B 1AB3A 1RSOB 5HFLA 1L0NH 1MABG 4AHCA 1IURA 3FB7C 1H2SB 2YEVA 3ZHVA 1Q6HA 4F6EA 2B1GA 4UFZA 4IYIA 5LBQA 2EJRA 2UXXA 1E1RG 1IBLB 3JSNA 3VQWA 3ZS8C 2JRIA 1M90W 3P3PA 2YIDA 1FJGB 1GN3A 1LR1A 1NU1H 4KFMA 4JV5O 1H2KA 3OAAG 5B1AB 4UV9A 3K06A 1YEWA 2Y4UA 5LGUA 3E89A 1AP5A 1P7BA 2GHYA 1MG1A 2ZDIC 5IYDO 2DW4A 1SQGA 5LOVB 4JI7O 5FL7G 4UV8A 3BABA 2PGGA 3DGEA 3SPGA 5IJ0A 4YJ2A 4ABMA 2ZE6A 1URFA 5IWAB 3KKYA 5CBGA 1NBMG 1AI6A 1VQOV 2ZNJA 3JYCA 1SS3A 4QIWF 4JPRA 4IT5A 4F6RB 1Q82W 4DXWA 4I7ZB 3WB2A 2WLLA 3ZJZA 2QWNB 1Q8IA 4X1KA 4X65B 5L3GA 1MSDA 2PZSA 1LUWA 2XNDG 1K3EA 3WG7C 4DUYB 5BZBA 3J7AU 3G6BA 2ZIOA 1G4YB 3ZHTA 1PKXA 3OE7G 3W7XA 1AP6A 3TXSA 4Q20A 2JJ2G 1ZUQA 2WA3A 4CS3A 1N36O 5FNVB 2IU3A 4PD4F 4I9QA 2WLHA 4KL1A 1Y4MA 3ABKB 4JAUA 5B5EZ 1XNQO 2NNUA 2UXDO 1AI5A 1H8HG 4NTWA 1OJHA 1H2NA 1XQ8A 4JF3A 1N33O 3T4DA 4P30A 3GB7C 2MK3A 4LF8B 3G80A 3ETGA 1GO3F 1YDXA 1Q43A 2YDEA 3VOUA 4GX0A 1S76D 2IH3C 5D5QA 5L3BA 4TT3G 2VQEO 1JOYA 1YITV 5BR8B 4PDLA 4IIJB 3T1CA 4BIUA 1QR9A 2PI5A 3A0RA 4GUNA 3SYAA 2AZ0A 2YIBA 4ICGA 1XMQO 1PL0A 4QPKA 2A7WA 4KUMA 3AG3B 5LYJB 1L0LH 1KQSU 2P5OA 1XNRO 1XHZA 5EBMC 3K5NA 1G1XB 3D36C 1QVFU 1SRYA 1JNBA 4CS4A 4L8JA 4YJ3A 1EN4A 3FYEB 5CBFA 2UXCB 1XNQB 1YIJV 4GZRB 3RN4A 1FXKC 4BIOA 2LP7A 4DV7O 4TWKA 4EB6A 1WB7A 4FFKA 3ABKC 1P84F 2IH1C 2GBOA 5EK0A 1AVMA 2OCCC 3SYCA 1Y76A 3RYIB 4J10A 2DYSB 2KG7B 4DR1B 4UVAA 2A79B 3JD1A 2JJ1G 4F4LA 5B66Z 2R9AA 1N33B 2HVJC 4UCUA 2L6LA 2Q69A 5H5NA 1NKDA 4CC6A 3LSUA 4XDKA 5LXTB 3RW0A 1O9HA 1DTOA 3QNEA 4LWSA 2QM8A 2DWDC 4O2AB 4FM0A 4HNAB 4X20B 5LP6C 3G71V 3JASA 5IYZB 4FLUA 2NR5A 2QWQB 2ZQMA 3RYHB 2QE7G 3TK1A 1MA1A 3ASOB 3SR2C 3OEEG 1ZLZA 5IY5C 1B04A 1YF2A 2BE3A 4LF7B 3B40A 4DR7O 3E8HA 4J42A 2YXLA 4MTFA 4DV7B 1TUEB 5J2UA 2VWKA 3W7WA 2F4VB 4GX1A 1AR5A 1J5EO 1BMFG 4FMTA 1RSOA 3CX5F 1IX9A 1NTZH 4MW3A 1XMOO 1JPXA 4MVUA 2QTSA 4G27B 3ZMUA 3OUSA 2ZR2A 2LO1A 4BWAA 2IJJA 5DM6V 1FXKA 3TCUA 4E2LA 5L3FA 1RFYA 3B8MA 2VQFO 2EULA 3ETEA 1FXKB 1HNWB 2KB1A 4RUEA 5CB4B 3L72H 2HR3A 2R72A 4X65O 3K58A 2ZKOA 3JAWA 4LNUB 1VEWA 4K35A 2QM4A 2AGAA 1WA8A 3SYQA 1SZTA 4TQFA 2N74A 4U3FH 4JI4B 1R6NA 2YXYA 4J41A 3CHXA 3Q4HB 4G2KA 4JI1O 3APOA 1P7GA 5A2QN 4RQFA 3TGUH 2E5LB 4UCSA 4WFEA 2UUCB 3OGIB 1PNMA 3L9DA 4KHPO 2YICA 2CGNA 5EZYA 3J81N 2QA4V 3CWBH 5BMVA 2LW7A 1NR1A 2HJDA 4CS2A 3G67A 1VF7A 3T1YB 3SDLA 3MAQA 3AG1C 4FFBA 4PHZA 1SESA 4IGGA 2RDCA 3D3QA 5IE9A 3DXRA 4N21A 4MTOA 2PI4A 1TVKA 3CEIA 2CE4A 1RPRA 3ZBHA 1D5AA 3LSSA 4X1YA 1I7FA 2Z5UA 2UXBB 1IBMO 3ABMC 4GX5A 5LL6Y 4CC5A 1FJGO 1MZFA 5KLVH 1J95A 3HKEB 3HKEA 1JA8A 4WFFA 3CRAA 1N32B 1VF6A 1MMMA 4RQEA 1IJGA 1ZWIC 4OPAA 1V54B 4JYAO 4DR3O 5J2TA 2OYQA 4RAIA 2QWRB 1A32A 3JAKA 5CN0A 5K1PA 3F5WC 4NR1A 1YZBA 5EYPB 3TJTA 2H94A 1NH2B 1I5XA 3BVOA 2QKCA 4UCVA 1IVSA 3U0ZA 4R6ZA 4B3TO 4J7JA 4DUYO 3SYOA 1H2LA 2DN9A 2H3OA 5JJJB 1JJ2U 3CCJV 1SQXH 3FKSG 4NYKA 2E74B 2CK3G 2QEXV 1BZKA 4H44B 1XILA 4UVBA 1D2DA 2YIAA 4X89A 4P9PA 2CTWA 1BSMA 1FXHA 3QO8A 4BR6A 4B7EA 2XAFA 3DSQA 4X66B 3RYCA 4PA3A 3B09A 4UXNA 1M9NA 2Q0AA 4UCTA 3CC4V 4NKGB 3K5MA 4X88A 3FYIB 2JGUA 4KXRA 1CPYA 1UFIA 2CTPA 3HB3B 4H37A 1B06A 3B77A 1ZL8A 2MW2B 3OTOB 2EINC 2F4VO 2EIKC 4DR3B 5CA3A 3LDDA 1M93A 5GW7A 1D5NA 5LHGA 3CCUV 1TGOA 1COWG 2V7QG 4X64O 4LFAO 1XI1A 3KG2A 3AG4B 3L70H 1ZSPA 3CRMA 3P32A 2X6BA 3AK1A 4FM2A 2GUZB 3H1LH 4I4TB 5LGNA 5FNVA 1QLEB 2DQ3A 3ZRWB 4ZI7A 1K9MW 3KCYA 1R3KC 2JEXA 1AJNA 2BCCH 2QKSA 4TV8B 1YTFB 4C7UA 3O9OA 1EN6A 4JI3O 4UB6Z 4PA9A 4DW1A 4NXMO 4NTXA 5FPRA 1FFTB 5J2UB 1NVPB 4HBNA 5CA0B 1MZEA 2ZIMA 3DC5A 3BA9A 2Q68A 5L3DA 4MVRA 1GN2A 1V55B 1KYOF 1NR7A 3EHBB 1HNXB 1YVWA 1M57B 1YSCA 2HG5C 3QTCA 4HNAA 2YS8A 3CC7V 3CRCA 2P6JA 3RT3C 5LXTA 3OFNG 2UUBO 3SPJA 2LGWA 3BY6A 3J80N 2FYUH 1P4RA 4ZHQA 5LP6A 3A8TA 3W7TA 2GTAA 3ZMVA 3L74H 3E2EA 2IJKA 3K9AA 4LF7O 1Z2GA 2QR4A 3BRCA 3RYIA 1GN6A 2P22C 3AG4C 3D36A 1W0JG 2GDSA 4EEQA 4ZOLA 1BE3H 2WLIA 4Q6GA 4O4HB 4R7CA 4D6TH 4FIPC 3W7UA 2R70A 3W7SA 2WLNA 4KP4A 2IJHA 2XASA 4DV6B 1QVGU 4EB6B 1GN4A 3LDCA 5EBLC 4MVQA 2C2AA 5H9CA 2Y69B 3ETDA 4LF9O 4MVSA 4O4LA 2ZXWC 3D3IA 1BHAA 1J5EB 5B1AC 1H8EG 1BQ0A 4JI8O 3ZCCA 3K5LA 3IJ4A 4BIZA 3C3SA 4K0KB 3ETQA 2A0LA 4FM1A 5KHGA 1BT8A 3UT5A 4K3AA 5JVDA 3OD4A 3OR7C 4L87A 3G4SV 1YTFD 3CD6V 2H8PC 1XHXA 3E8GA 4PDVA 3WB1A 5IYBO 5KAIZ 2VQEB 1FOUA 5KA5A 5IDJA 1NVPD 2UUBB 1IXBA 4PI0A 4XDJA 4DUZO 2LFSA 4JI4O 2UXCO 3ZEDA 1KKCA 1T5EA 5BMVB 1PPJH 3NXSA 4CH5A 2K1EA 3OEHG 2Q73A 3B8NA 3UT5B 1RPOA 1SETA 1YJWV 4LFCO 3KCXA 2YUAA 2EIMC 2EZPA 3CXCU 5LGTA 1JR9A 5IJ9A 5A9GA 4LF9B 2XAGA 3LNMB 1ZX3A 2RJZA 4QE9A 1ORQC 2EZOA 2VRZA 4LFAB 2QWPB 3OR6C 4DV0B 4O2BA 3HPLC 2JVDA 2B1IA 4W4KA 2R9RB 2BOCC 2WAMA 1B3QA 1KB9F 5IWAO 4O4HA 1KUQA 2Q6AA 1AI7A 4U7OA 3CPWU 1SQVH 2ZDIA 4YY3B 3ASNC 3STLC 1QQCA 3BPZA 4LWSB 4OX9O 4MW8A 3R66A 4DV4O 4JI5B 2CH7A 4I0XA 3OMIB 2YI8A 1VQ5V 5DN6G 3CS5A 1K5QA 3VBBA 2OTJV 2X7RB 1QLNA 4X9QA 4PDRA 4MSWC 1O9GA 4DR2B 3JD4A 2RMKB 5EC1C 1W59A 3QG5A 3AG3C 4B3TB 5B1NA 3BCCH 1JJOA 1L1FA 2DYRB 4FLTA 1OCZC 1SZXA 4DR4O 4J80A 2A06H 2EJ7A 3QVNA 5LMUB 3JASB 3QO7A 5F2VO 5KAFZ 2Q67A 2WLKA 3C90A 2VQFB 4WFHA 2Q0OC 4O2AA 4FLZA 3UO3A 2ZE7A 2CTQA 3ZMTA 1N0NA 2UXDB 2IBZH 3THOA 3LSQA 4IYHA 4QPJA 4CBCA 4WFGA 3E83A 4WFAV 2JIZG 4BW9A 1PNKA 4LBEC 1JFFB 4PA7A 2KG7A 3H1IH 1F4MA 4LFBO 2RCVA 1PV0A 1W0KG 2WLMA 5FPOA 4OGQB 1S0VA 1FFXB 5KHKA 5EIBC 3CCSV 2ARHA 3SJBC 1PM9A 4AQYO 2BSKA 1GAXA 3OM3B 4PA4A 1M4UA 2QSAA 2ODMA 3AK2A 4O4JB 3FAVB 4JZGA 3K3WA 4JI2B 3DXRB 1VQPV 1YJNV 2ILMA 3JD2A 1Q6IA 4UCOA 2P4KA 5JH7B 3E8BA 1AR1B 4KHPB 1JVMA 5DECA 3JD3A 4DW0A 3G6EV 1DGSA 1MSWD 2DOSA 3B2EE 3BHPA 1Z5VA 1HDJA 4DR1O 1ZL8B 1SA0A 5EBWC 5CBHA 3N2GB 3ZRXA 4FLVA 3MHSC 1B6QA 1GK9A 1NZ6A 5JVDB 3P30A 5C8YB 3S3WA 3JAMN 2ZD9A 4LC1A 1G8MA 2BTOA 3M8AA 1XL4A 1QCEA 1OCOC 4J7ZA 4P2ZA 4YIOA 4O4LB 2HKOA 1NH2D 3HR0A 3UO2A 5IT9N 4ASUG 1Y67A 2Q7HA 3ABLC 1I94O 3A0HZ 2ITDC 1E79G 2P06A 5JQGA 2ZINA 1WA8B 3QF7A 4X1IA 5L3CA 3U11A 2D3OW 1BQZA 1EN5A 5CA1A 1FFXA 1YJ9V 2LW1A 4DRXA 4JYAB 4I50A 1G6UA 3HKCA 2ZR3A 4JI0B 2OT5A 2BSKB 2QGNA 4U3JA 1PNLA 4WFBV 3CB2A 4ZHQB 1X4TA 2CGOA 4PJ0Z 3EFFK 2M6YA 4FJCC 2Q5ZA 4PV1B 5BY1A 3M7MX 3K5OA 1L8DA 3RBZA 4LF4B 2E75B 4DV0O 3JALA 3AK3A 2W6IG 4LF5B 1GM7A 1NJIW 4X66O 2BTQA 4EFBA 3K03A 3E22B 1RM1B 1NT2B 4DV1O 2E76B 5BR8O 3OW2U 3WU2Z 1AR4A 1YCIA 5CA0A 3RYFB 4JTAB 2HP8A 5KX5A 2Q8VA 1WPBA 1UPGA 3E35A 1S5HC 2VWJA 2EILB 3APQA 1Q86W 4TOIA 2O57A 4FFBB 2XUMA 3R65A 4MS2A 4X64B 4PI2A 2FMLA 4HYOA 1EBOA 2A9HA 5LOVA 1FD9A 5GONB 4GYCB 2AHZA 3ABMB 1SQFA 1TA8A 1XL6A 3F7YC 3HKCB 1Q90D 2IU0A 4I50B 1RP3B 4JI1B 4LF5O 4I0XB 3X2QC 4LF6O 4DV3B 1QNMA 1VF6C 3D8CA 4OXSA 1R3IC 1HNZB 2OWOA 1Y74A 4DK1A 1OCRB 4D7TA 4JTDB 3ZN1A 2LGQA 1RM1C 5KUMA 4YJ3B 4B3MO 4FLYA 3CYOA 3T1HO 1UJWB 3CJHA 2F95B 1XUQA 5LYJA 2DYRC 3DC6A 3JAWB 1WP8A 1XBLA 4UB8Z 5C8YA 3VQXA 4XBFA 2Y0PA 1S3JA 2EIJB 4LR3A 5IJ9B 3K0GA 1K33A 2CUGA 3KZIZ 4DO2A 2Q7EA 1VQ4V 1PD3A 5LA6A 4PELA 5JJEB 2GUZA 2HVKC 2M7WA 3RVYA 1XMOB 4JYCA 1Q81W 4HAMA 1GH6A 4JYYA 4EKWA 1FPOA 4DR5O 1H2MA 1V9PA 1HNXO 2ZM6B 5TISZ 4RO2A 1R73A 3MD0A 2UXNA 2OTLV 3FD9A 5JCOA 4DV5B 4DV4B 1OCRC 1VARA 2XAHA 2YC0A 4JAVA 1GM8A 4Z1MG 3T2MA 3ZHRA 3GWOA 1Q3EA 1KD1W 1OV9A 1I08A 4FK5C 5B3SC 5B1BC 3CP1A 4I5SA 1JX9A 2P67A 2OIGA 2ZE5A 1WPXA 5EC2C 2GTSA 1I5YA 1S5LZ 1QHTA 2ZE8A 4WBNA 4YHHO 2XT9A 1EFRG 2F23A 4W4LA 3SJQC 4QNHB 3OTOO 1OHHG 3RGBA 2RQ6A 1MOFA 3ZHSA 5J9PC 4A5UB 1S5JA 2ZM6O 2F1MA 1ROPA 3WB0A 1VQNV 2EX3A 4LH6A 4DK0A 4P9OA 2Q9LA 3T1YO 1ZTEA 4NXNO 4WBNB 4J7KA 5IJ0B 3CE2A 1AJPA 2XAJA 3O65A 3JARB 2HEPA 1QR8A 4JAAA 5L3EA 5J2TB 4B3SB 2CH7B 2F43G 1AJQA 2UU9B 2ETNA 1IZ3A 3OMNB 1KKDA 3Q4HA 4LP8A 4H13B 3A2FA 3DTUB 1KC8W 4K8ZA 3UQ8A 5AG2A 1X59A 2YI9A 2BTQB 3IGAC 1Y6XA 3H9VA 3SPCA 1M1KW 4FVMA 4JGSA 3CMAV 2PF4E 2KQXA 4X62O 4DR6B 3I55V 4TV8A 1H5WA 5B3SB 1EZVH 3K04A 1AI4A 5GTHZ 1W2BU 1US6A 2QJ1A 3L71H 1K97A 2EINB 1HR0B 4DYLA 2L35A 4R8CA 1VQKV 2KKWA 4GKJB 3PJSK 4PA6A 1NQTA 5LMNB 3FB6C 3CRQA 2ZNIA 4ZKIA 2G38A 5K1XA 1R6KA 1S72V 2X6CA 1KBHA 2WLLB 1I94B 3ABTA 4R50A 1XMQB 2AHYA 3TETA 4JI6B 4K8XA 4DR6O 4QE7A 2K9PA 2N04A 3KDRA 1R1BA 5IYZA 3RWRD 3BEHA 1KMIZ 1SERA 2ZCEA 3QO5A 2JS5A 1H2GA 1E1QG 1Z5WA 2FB5A 1WN7A 3PN1A 4G28B 1CEZA 4DR5B 3IC7A 5CMUA 2X0LA 4N23A 2WLIB 4CH4A 2OCCB 1IDSA 4GKKB 3JATB 4O4JA 2DYSC 5GTIZ 1GKFA 2Q4PA 3ABLB 4MVOA 4GLXA 3ZMSA 1V55C 4MTXA 1M57C 5E79Z 1LUVA 3CCVV 2FTKA 2W6JG 3RYHA 2FKXA 3TXQA 1V54C 4IHJA 2GV9A 4OPHA 4J11A 1BHBA 4ZIBA 4CH3A 2PYJA 3UM7A 2RNBA 5IYCO 3F5TA 3K08A 3L75H 1K7DA 1M56C 3E8FA 1Q5OA 3RVZA 1THZA 3ZRVA 4NTYA 4IHJB 4O4IB 1HNZO 1F23A 5B1BB 4DR7B 4DV2O 3NR7A 1QBZA 4ZOLB 4X1YB 1FXVA 2P90A 3CCEV 5IY5B 5KHHA 3I56V 2PUSA 1CXZB 1Q6UA 2XOKG 3BAAA 2BOBC 3N2KB 4B3SO 2JEUA 3ZRWA 3CC2V 4B7KA 3SPHA 1N34B 1GMGA 1PP9H 2ADQB 3EXAA 3OT7A 1OZ0A 2DE0X 1DLBA 2B9ZA 4TUYA 1XEQA 1FYJA 1WAZA 2CDYA 3C3TA 3FB8C 3GVMA 4PDMA 2ZXWB 3ZX6A 4DV6O 4MVZA 4K0KO 4OX9B 2Y4TA 3ABUA 3L73H 4AI8A
chains in the Genus database with same CATH topology
1MA1A 3AK2A 1GN6A 4JZGA 1ZLZA 2GDSA 4JYYA 1IDSA 3CEIA 1AR4A 2CE4A 1D5NA 2P4KA 5AG2A 1PL4A 1GN3A 1AR5A 1GN4A 1ZSPA 1IX9A 1LUVA 1VARA 2ADPA 3AK1A 1AP5A 1BS3A 3BFRA 1JA8A 1MMMA 2AW9A 3C3SA 1I08A 4GUNA 4JZ2A 1BT8A 4X9QA 1N0JA 4YIOA 3KKYA 3EVKA 4C7UA 2QKAA 3TJTA 1EN4A 1Y67A 1VEWA 1QNMA 1EN6A 3RN4A 3IC9A 2QKCA 1IXBA 1WB7A 1XDCA 1SZXA 1XREA 1MSDA 4FFKA 1EM1A 1EN5A 1LUWA 3QVNA 1KKCA 1AVMA 1XUQA 1I0HA 1MNGA 3DC5A 1ZTEA 3DC6A 1N0NA 1XILA 1P7GA 3KDRA 1WB8A 1GN2A 1AP6A 2ADQB 3K9SA 3OT7A 3MDSA 1BSMA 1ZUQA 4BR6A 3LSUA 2CDYA 3C3TA 1JR9A 2RCVA 3AK3A 5A9GA 4YIPA 1B06A 4E4EA 4F6EA 1PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MA1 A;  3AK2 A;  1GN6 A;  4JZG A;  1ZLZ A;  2GDS A;  4JYY A;  1IDS A;  3CEI A;  1AR4 A;  2CE4 A;  1D5N A;  2P4K A;  5AG2 A;  1PL4 A;  1GN3 A;  1AR5 A;  1GN4 A;  1ZSP A;  1IX9 A;  1LUV A;  1VAR A;  2ADP A;  3AK1 A;  1AP5 A;  1BS3 A;  3BFR A;  1JA8 A;  1MMM A;  2AW9 A;  3C3S A;  1I08 A;  4GUN A;  4JZ2 A;  1BT8 A;  4X9Q A;  1N0J A;  4YIO A;  3KKY A;  3EVK A;  4C7U A;  2QKA A;  3TJT A;  1EN4 A;  1Y67 A;  1VEW A;  1QNM A;  1EN6 A;  3RN4 A;  3IC9 A;  2QKC A;  1IXB A;  1WB7 A;  1XDC A;  1SZX A;  1XRE A;  1MSD A;  4FFK A;  1EM1 A;  1EN5 A;  1LUW A;  3QVN A;  1KKC A;  1AVM A;  1XUQ A;  1I0H A;  1MNG A;  3DC5 A;  1ZTE A;  3DC6 A;  1N0N A;  1XIL A;  1P7G A;  1WB8 A;  1GN2 A;  1AP6 A;  2ADQ B;  3K9S A;  3OT7 A;  3MDS A;  1BSM A;  1ZUQ A;  4BR6 A;  3LSU A;  2CDY A;  3C3T A;  1JR9 A;  2RCV A;  3AK3 A;  5A9G A;  4YIP A;  1B06 A;  4E4E A;  4F6E A;  1PM9 A; 
#chains in the Genus database with same CATH topology
 3GWK C;  2UUA O;  1HW7 A;  1R6T A;  2PY5 A;  1BGY H;  3X2Q B;  2E5L O;  2HFE C;  3IFX A;  5LMU O;  5CB4 A;  1SQQ H;  2EIK B;  3FAV A;  4ZI7 B;  1BL8 A;  1QLE C;  3HKB B;  1OCC B;  3E86 A;  4WCE V;  2QDO A;  4I4T A;  5FLX N;  4MTG A;  3CCR V;  2HHH B;  2AW9 A;  3SYP A;  4DUZ B;  4YJ2 B;  4JZ2 A;  3A0B Z;  2YXH A;  5EIB D;  5KA6 A;  4LFC B;  4I9W A;  4UVC A;  2V1D A;  2D2C B;  4JTC B;  1U96 A;  3ZN0 A;  2QKA A;  1QU7 A;  3H01 A;  3CSX A;  2IM9 A;  3ML0 A;  3SGI A;  3LUT B;  1XDC A;  3H1H H;  1IBM B;  1JQ0 A;  2UUA B;  2XTA A;  4O4I A;  2WPD G;  2ZT9 B;  3JAK B;  4NB5 A;  1K34 A;  4F6R A;  1IBK O;  1FAF A;  1DF5 A;  1K5S A;  5JWP A;  3K57 A;  1VQL V;  1SC5 B;  4JI2 O;  1N8R W;  3LNN A;  3RYC B;  4TUY B;  5H6Q A;  3UCS C;  5JJN B;  4LF6 B;  3JAR A;  5KMG A;  2JS3 A;  3IAY A;  4CZZ A;  1VQM V;  1CP9 A;  2Z0A A;  1R3L C;  4BAY A;  1OCC C;  3ZIA G;  2WWW A;  3N2K A;  3SPI A;  2IW5 A;  3ASO C;  5GON A;  2UU9 O;  4D7S A;  4H0L B;  2P7T C;  4YIP A;  5LHI A;  4UUJ C;  3ZMZ A;  4YXW G;  2WA4 A;  3B4S A;  3VQV A;  2W0F C;  4GX2 A;  1Y76 B;  3U10 A;  1KEC A;  1TVK B;  3WG7 B;  1NS1 A;  3JD0 A;  1VQ9 V;  1NI8 A;  2Y69 C;  4JV5 B;  3BA8 A;  3RYF A;  3LDE A;  4JI5 O;  3I5D A;  4O2B B;  3ZRS A;  4JYB A;  2JK5 C;  2WSS G;  4Z1V A;  2ADP A;  4JI0 O;  1VMG A;  4TV9 B;  2YEV B;  1IBK B;  1WLE A;  1XOU A;  2UUC O;  3JAL B;  4IIJ A;  1ZAU A;  5KHJ A;  3CCM V;  1JCH A;  1K4C C;  1R3J C;  4AIL C;  4J9Z B;  4WF9 V;  1YHQ V;  1N0J A;  2X6A A;  2QTO A;  4I55 A;  3OTF A;  1GRJ A;  3H1K H;  3H1J H;  3JAT A;  2LQT A;  3JCU Z;  4DRX B;  2F66 C;  3HKD A;  2V4D A;  1WJZ A;  2Y48 A;  5CA1 B;  4IL6 Z;  4LNU A;  4GKJ O;  1S77 D;  4B08 A;  1EM1 A;  3K79 A;  1TAE A;  3FB5 C;  1N32 O;  1HR0 O;  4JI3 B;  2RN9 A;  4AQY B;  5JCO C;  4UCR A;  1VP7 A;  4MVM A;  2CTR A;  1N36 B;  2JDI G;  2PTM A;  1VQ7 V;  5LMN O;  4LFB B;  1VF5 B;  1SKV A;  3MDS A;  3ZHU A;  1NTM H;  1P49 A;  5LA6 B;  2ATK C;  1EZJ A;  4FPP A;  2NLJ C;  2WLJ A;  1VIB A;  2DQ0 A;  4QJF B;  3HKB A;  2KSD A;  4EFE A;  2Q7G A;  5HFM A;  2EIJ C;  5LHH A;  1TUB B;  4JI6 O;  2EBO A;  2LFR A;  2W0X A;  1WNS A;  3STZ C;  2OCH A;  4E4E A;  3CXH F;  4LF8 O;  4BW5 A;  4NXN B;  3JSL A;  1Y74 B;  3CJH B;  1OCO B;  1ARO P;  5E1A C;  3RFR A;  1IXM A;  5JH7 A;  1M5I A;  4FLW A;  3N27 A;  3T1H B;  4X20 A;  5DED A;  4HZ3 A;  3K59 A;  3MHH C;  2HHH O;  2YSU B;  4RUF A;  1SQP H;  3BFR A;  2QM7 A;  4GCZ A;  5LP6 B;  2YIB D;  2DMX A;  1JFF A;  1XNR B;  3OUF A;  2JGD B;  5KMG B;  1Q7Y W;  4J9Y B;  4Z2W A;  4JI7 B;  3AG2 C;  4H33 A;  1OCZ B;  3EVK A;  1LNQ A;  3AG7 A;  3OGC C;  1KP2 A;  3K0D A;  3OMA B;  4LH7 A;  3IC9 A;  4LF4 O;  2IJI A;  5D5P A;  1XRE A;  1Y66 A;  5KX5 B;  4ZBM A;  4TSF G;  1FKA O;  4CH6 A;  2P4V A;  1DF4 A;  1N34 O;  3WFV A;  1MNG A;  4JAS A;  4JI8 B;  3E22 A;  4DV2 B;  3CRR A;  1WB8 A;  1SF9 A;  1FS0 G;  3P3N A;  1F4N A;  3K9S A;  4GT1 A;  2FL4 A;  1KP3 A;  2XHB A;  2EIL C;  2JGD A;  2NN4 A;  2A3Q A;  3FFQ A;  4U3J B;  4DV1 B;  4NXM B;  1K92 A;  4U7N A;  2PYL A;  1M56 B;  3CME V;  1DK1 A;  1NTK H;  1WP7 A;  2GSM B;  4B3R B;  1YXB A;  1N4C A;  2QWO B;  5BXZ A;  2Z3Y A;  3CCQ V;  1SQB H;  3ICX A;  3UKM A;  1JMK C;  3F7V C;  2XAQ A;  4RWU A;  1PL4 A;  2HJF C;  5ITZ A;  4X1I B;  4MT8 A;  5JQG B;  4YHH B;  4B3M B;  3JCZ A;  3AEI A;  3S3X A;  5C93 A;  2Y0I A;  5EZY B;  5KUK A;  1BS3 A;  4XDL A;  3VQY A;  2EIM B;  4DV3 O;  2F93 B;  1TUB A;  2DWE C;  3SJC C;  4I55 B;  1K8A W;  3N2G A;  3AG2 B;  4YY3 O;  1HP8 A;  5H2F Z;  3AG1 B;  1YI2 V;  2CAZ C;  4GKK O;  1H38 A;  1IBL O;  1K4D C;  3FX7 A;  4FLX A;  2AZ2 A;  3M99 B;  1SA0 B;  4TQD A;  3ZHQ A;  4TV9 A;  2LJ2 A;  2N05 A;  4X8A A;  1HNW O;  4X1K B;  2B5U A;  1F51 A;  1U97 A;  4QGP A;  4B3R O;  5ITZ B;  3CCL V;  5KHI A;  1GM9 A;  2DJV A;  1VQ6 V;  2R9I A;  3HKD B;  2E3C A;  2AXT Z;  5B1O A;  1GTO A;  1I0H A;  1ENV A;  1BCC H;  5H6R A;  4DR2 O;  5EYP A;  4X62 B;  1VQ8 V;  4NVP A;  4FZ1 A;  2HLD G;  2VS0 A;  3SJA C;  1K73 W;  1F7Y A;  4FZ0 A;  3ASN B;  3T4Z A;  4DV5 O;  4LCU C;  2OIE A;  2UXB O;  1AIL A;  1KU9 A;  2ITC C;  1HWY A;  4DR4 B;  1AB3 A;  1RSO B;  5HFL A;  1L0N H;  1MAB G;  4AHC A;  1IUR A;  3FB7 C;  1H2S B;  2YEV A;  3ZHV A;  1Q6H A;  4F6E A;  2B1G A;  4UFZ A;  4IYI A;  5LBQ A;  2EJR A;  2UXX A;  1E1R G;  1IBL B;  3JSN A;  3VQW A;  3ZS8 C;  2JRI A;  1M90 W;  3P3P A;  2YID A;  1FJG B;  1GN3 A;  1LR1 A;  1NU1 H;  4KFM A;  4JV5 O;  1H2K A;  3OAA G;  5B1A B;  4UV9 A;  3K06 A;  1YEW A;  2Y4U A;  5LGU A;  3E89 A;  1AP5 A;  1P7B A;  2GHY A;  1MG1 A;  2ZDI C;  5IYD O;  2DW4 A;  1SQG A;  5LOV B;  4JI7 O;  5FL7 G;  4UV8 A;  3BAB A;  2PGG A;  3DGE A;  3SPG A;  5IJ0 A;  4YJ2 A;  4ABM A;  2ZE6 A;  1URF A;  5IWA B;  3KKY A;  5CBG A;  1NBM G;  1AI6 A;  1VQO V;  2ZNJ A;  3JYC A;  1SS3 A;  4QIW F;  4JPR A;  4IT5 A;  4F6R B;  1Q82 W;  4DXW A;  4I7Z B;  3WB2 A;  2WLL A;  3ZJZ A;  2QWN B;  1Q8I A;  4X1K A;  4X65 B;  5L3G A;  1MSD A;  2PZS A;  1LUW A;  2XND G;  1K3E A;  3WG7 C;  4DUY B;  5BZB A;  3J7A U;  3G6B A;  2ZIO A;  1G4Y B;  3ZHT A;  1PKX A;  3OE7 G;  3W7X A;  1AP6 A;  3TXS A;  4Q20 A;  2JJ2 G;  1ZUQ A;  2WA3 A;  4CS3 A;  1N36 O;  5FNV B;  2IU3 A;  4PD4 F;  4I9Q A;  2WLH A;  4KL1 A;  1Y4M A;  3ABK B;  4JAU A;  5B5E Z;  1XNQ O;  2NNU A;  2UXD O;  1AI5 A;  1H8H G;  4NTW A;  1OJH A;  1H2N A;  1XQ8 A;  4JF3 A;  1N33 O;  3T4D A;  4P30 A;  3GB7 C;  2MK3 A;  4LF8 B;  3G80 A;  3ETG A;  1GO3 F;  1YDX A;  1Q43 A;  2YDE A;  3VOU A;  4GX0 A;  1S76 D;  2IH3 C;  5D5Q A;  5L3B A;  4TT3 G;  2VQE O;  1JOY A;  1YIT V;  5BR8 B;  4PDL A;  4IIJ B;  3T1C A;  4BIU A;  1QR9 A;  2PI5 A;  3A0R A;  4GUN A;  3SYA A;  2AZ0 A;  2YIB A;  4ICG A;  1XMQ O;  1PL0 A;  4QPK A;  2A7W A;  4KUM A;  3AG3 B;  5LYJ B;  1L0L H;  1KQS U;  2P5O A;  1XNR O;  1XHZ A;  5EBM C;  3K5N A;  1G1X B;  3D36 C;  1QVF U;  1SRY A;  1JNB A;  4CS4 A;  4L8J A;  4YJ3 A;  1EN4 A;  3FYE B;  5CBF A;  2UXC B;  1XNQ B;  1YIJ V;  4GZR B;  3RN4 A;  1FXK C;  4BIO A;  2LP7 A;  4DV7 O;  4TWK A;  4EB6 A;  1WB7 A;  4FFK A;  3ABK C;  1P84 F;  2IH1 C;  2GBO A;  5EK0 A;  1AVM A;  2OCC C;  3SYC A;  1Y76 A;  3RYI B;  4J10 A;  2DYS B;  2KG7 B;  4DR1 B;  4UVA A;  2A79 B;  3JD1 A;  2JJ1 G;  4F4L A;  5B66 Z;  2R9A A;  1N33 B;  2HVJ C;  4UCU A;  2L6L A;  2Q69 A;  5H5N A;  1NKD A;  4CC6 A;  3LSU A;  4XDK A;  5LXT B;  3RW0 A;  1O9H A;  1DTO A;  3QNE A;  4LWS A;  2QM8 A;  2DWD C;  4O2A B;  4FM0 A;  4HNA B;  4X20 B;  5LP6 C;  3G71 V;  3JAS A;  5IYZ B;  4FLU A;  2NR5 A;  2QWQ B;  2ZQM A;  3RYH B;  2QE7 G;  3TK1 A;  1MA1 A;  3ASO B;  3SR2 C;  3OEE G;  1ZLZ A;  5IY5 C;  1B04 A;  1YF2 A;  2BE3 A;  4LF7 B;  3B40 A;  4DR7 O;  3E8H A;  4J42 A;  2YXL A;  4MTF A;  4DV7 B;  1TUE B;  5J2U A;  2VWK A;  3W7W A;  2F4V B;  4GX1 A;  1AR5 A;  1J5E O;  1BMF G;  4FMT A;  1RSO A;  3CX5 F;  1IX9 A;  1NTZ H;  4MW3 A;  1XMO O;  1JPX A;  4MVU A;  2QTS A;  4G27 B;  3ZMU A;  3OUS A;  2ZR2 A;  2LO1 A;  4BWA A;  2IJJ A;  5DM6 V;  1FXK A;  3TCU A;  4E2L A;  5L3F A;  1RFY A;  3B8M A;  2VQF O;  2EUL A;  3ETE A;  1FXK B;  1HNW B;  2KB1 A;  4RUE A;  5CB4 B;  3L72 H;  2HR3 A;  2R72 A;  4X65 O;  3K58 A;  2ZKO A;  3JAW A;  4LNU B;  1VEW A;  4K35 A;  2QM4 A;  2AGA A;  1WA8 A;  3SYQ A;  1SZT A;  4TQF A;  2N74 A;  4U3F H;  4JI4 B;  1R6N A;  2YXY A;  4J41 A;  3CHX A;  3Q4H B;  4G2K A;  4JI1 O;  3APO A;  1P7G A;  5A2Q N;  4RQF A;  3TGU H;  2E5L B;  4UCS A;  4WFE A;  2UUC B;  3OGI B;  1PNM A;  3L9D A;  4KHP O;  2YIC A;  2CGN A;  5EZY A;  3J81 N;  2QA4 V;  3CWB H;  5BMV A;  2LW7 A;  1NR1 A;  2HJD A;  4CS2 A;  3G67 A;  1VF7 A;  3T1Y B;  3SDL A;  3MAQ A;  3AG1 C;  4FFB A;  4PHZ A;  1SES A;  4IGG A;  2RDC A;  3D3Q A;  5IE9 A;  3DXR A;  4N21 A;  4MTO A;  2PI4 A;  1TVK A;  3CEI A;  2CE4 A;  1RPR A;  3ZBH A;  1D5A A;  3LSS A;  4X1Y A;  1I7F A;  2Z5U A;  2UXB B;  1IBM O;  3ABM C;  4GX5 A;  5LL6 Y;  4CC5 A;  1FJG O;  1MZF A;  5KLV H;  1J95 A;  3HKE B;  3HKE A;  1JA8 A;  4WFF A;  3CRA A;  1N32 B;  1VF6 A;  1MMM A;  4RQE A;  1IJG A;  1ZWI C;  4OPA A;  1V54 B;  4JYA O;  4DR3 O;  5J2T A;  2OYQ A;  4RAI A;  2QWR B;  1A32 A;  3JAK A;  5CN0 A;  5K1P A;  3F5W C;  4NR1 A;  1YZB A;  5EYP B;  3TJT A;  2H94 A;  1NH2 B;  1I5X A;  3BVO A;  2QKC A;  4UCV A;  1IVS A;  3U0Z A;  4R6Z A;  4B3T O;  4J7J A;  4DUY O;  3SYO A;  1H2L A;  2DN9 A;  2H3O A;  5JJJ B;  1JJ2 U;  3CCJ V;  1SQX H;  3FKS G;  4NYK A;  2E74 B;  2CK3 G;  2QEX V;  1BZK A;  4H44 B;  1XIL A;  4UVB A;  1D2D A;  2YIA A;  4X89 A;  4P9P A;  2CTW A;  1BSM A;  1FXH A;  3QO8 A;  4BR6 A;  4B7E A;  2XAF A;  3DSQ A;  4X66 B;  3RYC A;  4PA3 A;  3B09 A;  4UXN A;  1M9N A;  2Q0A A;  4UCT A;  3CC4 V;  4NKG B;  3K5M A;  4X88 A;  3FYI B;  2JGU A;  4KXR A;  1CPY A;  1UFI A;  2CTP A;  3HB3 B;  4H37 A;  1B06 A;  3B77 A;  1ZL8 A;  2MW2 B;  3OTO B;  2EIN C;  2F4V O;  2EIK C;  4DR3 B;  5CA3 A;  3LDD A;  1M93 A;  5GW7 A;  1D5N A;  5LHG A;  3CCU V;  1TGO A;  1COW G;  2V7Q G;  4X64 O;  4LFA O;  1XI1 A;  3KG2 A;  3AG4 B;  3L70 H;  1ZSP A;  3CRM A;  3P32 A;  2X6B A;  3AK1 A;  4FM2 A;  2GUZ B;  3H1L H;  4I4T B;  5LGN A;  5FNV A;  1QLE B;  2DQ3 A;  3ZRW B;  4ZI7 A;  1K9M W;  3KCY A;  1R3K C;  2JEX A;  1AJN A;  2BCC H;  2QKS A;  4TV8 B;  1YTF B;  4C7U A;  3O9O A;  1EN6 A;  4JI3 O;  4UB6 Z;  4PA9 A;  4DW1 A;  4NXM O;  4NTX A;  5FPR A;  1FFT B;  5J2U B;  1NVP B;  4HBN A;  5CA0 B;  1MZE A;  2ZIM A;  3DC5 A;  3BA9 A;  2Q68 A;  5L3D A;  4MVR A;  1GN2 A;  1V55 B;  1KYO F;  1NR7 A;  3EHB B;  1HNX B;  1YVW A;  1M57 B;  1YSC A;  2HG5 C;  3QTC A;  4HNA A;  2YS8 A;  3CC7 V;  3CRC A;  2P6J A;  3RT3 C;  5LXT A;  3OFN G;  2UUB O;  3SPJ A;  2LGW A;  3BY6 A;  3J80 N;  2FYU H;  1P4R A;  4ZHQ A;  5LP6 A;  3A8T A;  3W7T A;  2GTA A;  3ZMV A;  3L74 H;  3E2E A;  2IJK A;  3K9A A;  4LF7 O;  1Z2G A;  2QR4 A;  3BRC A;  3RYI A;  1GN6 A;  2P22 C;  3AG4 C;  3D36 A;  1W0J G;  2GDS A;  4EEQ A;  4ZOL A;  1BE3 H;  2WLI A;  4Q6G A;  4O4H B;  4R7C A;  4D6T H;  4FIP C;  3W7U A;  2R70 A;  3W7S A;  2WLN A;  4KP4 A;  2IJH A;  2XAS A;  4DV6 B;  1QVG U;  4EB6 B;  1GN4 A;  3LDC A;  5EBL C;  4MVQ A;  2C2A A;  5H9C A;  2Y69 B;  3ETD A;  4LF9 O;  4MVS A;  4O4L A;  2ZXW C;  3D3I A;  1BHA A;  1J5E B;  5B1A C;  1H8E G;  1BQ0 A;  4JI8 O;  3ZCC A;  3K5L A;  3IJ4 A;  4BIZ A;  3C3S A;  4K0K B;  3ETQ A;  2A0L A;  4FM1 A;  5KHG A;  1BT8 A;  3UT5 A;  4K3A A;  5JVD A;  3OD4 A;  3OR7 C;  4L87 A;  3G4S V;  1YTF D;  3CD6 V;  2H8P C;  1XHX A;  3E8G A;  4PDV A;  3WB1 A;  5IYB O;  5KAI Z;  2VQE B;  1FOU A;  5KA5 A;  5IDJ A;  1NVP D;  2UUB B;  1IXB A;  4PI0 A;  4XDJ A;  4DUZ O;  2LFS A;  4JI4 O;  2UXC O;  3ZED A;  1KKC A;  1T5E A;  5BMV B;  1PPJ H;  3NXS A;  4CH5 A;  2K1E A;  3OEH G;  2Q73 A;  3B8N A;  3UT5 B;  1RPO A;  1SET A;  1YJW V;  4LFC O;  3KCX A;  2YUA A;  2EIM C;  2EZP A;  3CXC U;  5LGT A;  1JR9 A;  5IJ9 A;  5A9G A;  4LF9 B;  2XAG A;  3LNM B;  1ZX3 A;  2RJZ A;  4QE9 A;  1ORQ C;  2EZO A;  2VRZ A;  4LFA B;  2QWP B;  3OR6 C;  4DV0 B;  4O2B A;  3HPL C;  2JVD A;  2B1I A;  4W4K A;  2R9R B;  2BOC C;  2WAM A;  1B3Q A;  1KB9 F;  5IWA O;  4O4H A;  1KUQ A;  2Q6A A;  1AI7 A;  4U7O A;  3CPW U;  1SQV H;  2ZDI A;  4YY3 B;  3ASN C;  3STL C;  1QQC A;  3BPZ A;  4LWS B;  4OX9 O;  4MW8 A;  3R66 A;  4DV4 O;  4JI5 B;  2CH7 A;  4I0X A;  3OMI B;  2YI8 A;  1VQ5 V;  5DN6 G;  3CS5 A;  1K5Q A;  3VBB A;  2OTJ V;  2X7R B;  1QLN A;  4X9Q A;  4PDR A;  4MSW C;  1O9G A;  4DR2 B;  3JD4 A;  2RMK B;  5EC1 C;  1W59 A;  3QG5 A;  3AG3 C;  4B3T B;  5B1N A;  3BCC H;  1JJO A;  1L1F A;  2DYR B;  4FLT A;  1OCZ C;  1SZX A;  4DR4 O;  4J80 A;  2A06 H;  2EJ7 A;  3QVN A;  5LMU B;  3JAS B;  3QO7 A;  5F2V O;  5KAF Z;  2Q67 A;  2WLK A;  3C90 A;  2VQF B;  4WFH A;  2Q0O C;  4O2A A;  4FLZ A;  3UO3 A;  2ZE7 A;  2CTQ A;  3ZMT A;  1N0N A;  2UXD B;  2IBZ H;  3THO A;  3LSQ A;  4IYH A;  4QPJ A;  4CBC A;  4WFG A;  3E83 A;  4WFA V;  2JIZ G;  4BW9 A;  1PNK A;  4LBE C;  1JFF B;  4PA7 A;  2KG7 A;  3H1I H;  1F4M A;  4LFB O;  2RCV A;  1PV0 A;  1W0K G;  2WLM A;  5FPO A;  4OGQ B;  1S0V A;  1FFX B;  5KHK A;  5EIB C;  3CCS V;  2ARH A;  3SJB C;  1PM9 A;  4AQY O;  2BSK A;  1GAX A;  3OM3 B;  4PA4 A;  1M4U A;  2QSA A;  2ODM A;  3AK2 A;  4O4J B;  3FAV B;  4JZG A;  3K3W A;  4JI2 B;  3DXR B;  1VQP V;  1YJN V;  2ILM A;  3JD2 A;  1Q6I A;  4UCO A;  2P4K A;  5JH7 B;  3E8B A;  1AR1 B;  4KHP B;  1JVM A;  5DEC A;  3JD3 A;  4DW0 A;  3G6E V;  1DGS A;  1MSW D;  2DOS A;  3B2E E;  3BHP A;  1Z5V A;  1HDJ A;  4DR1 O;  1ZL8 B;  1SA0 A;  5EBW C;  5CBH A;  3N2G B;  3ZRX A;  4FLV A;  3MHS C;  1B6Q A;  1GK9 A;  1NZ6 A;  5JVD B;  3P30 A;  5C8Y B;  3S3W A;  3JAM N;  2ZD9 A;  4LC1 A;  1G8M A;  2BTO A;  3M8A A;  1XL4 A;  1QCE A;  1OCO C;  4J7Z A;  4P2Z A;  4YIO A;  4O4L B;  2HKO A;  1NH2 D;  3HR0 A;  3UO2 A;  5IT9 N;  4ASU G;  1Y67 A;  2Q7H A;  3ABL C;  1I94 O;  3A0H Z;  2ITD C;  1E79 G;  2P06 A;  5JQG A;  2ZIN A;  1WA8 B;  3QF7 A;  4X1I A;  5L3C A;  3U11 A;  2D3O W;  1BQZ A;  1EN5 A;  5CA1 A;  1FFX A;  1YJ9 V;  2LW1 A;  4DRX A;  4JYA B;  4I50 A;  1G6U A;  3HKC A;  2ZR3 A;  4JI0 B;  2OT5 A;  2BSK B;  2QGN A;  4U3J A;  1PNL A;  4WFB V;  3CB2 A;  4ZHQ B;  1X4T A;  2CGO A;  4PJ0 Z;  3EFF K;  2M6Y A;  4FJC C;  2Q5Z A;  4PV1 B;  5BY1 A;  3M7M X;  3K5O A;  1L8D A;  3RBZ A;  4LF4 B;  2E75 B;  4DV0 O;  3JAL A;  3AK3 A;  2W6I G;  4LF5 B;  1GM7 A;  1NJI W;  4X66 O;  2BTQ A;  4EFB A;  3K03 A;  3E22 B;  1RM1 B;  1NT2 B;  4DV1 O;  2E76 B;  5BR8 O;  3OW2 U;  3WU2 Z;  1AR4 A;  1YCI A;  5CA0 A;  3RYF B;  4JTA B;  2HP8 A;  5KX5 A;  2Q8V A;  1WPB A;  1UPG A;  3E35 A;  1S5H C;  2VWJ A;  2EIL B;  3APQ A;  1Q86 W;  4TOI A;  2O57 A;  4FFB B;  2XUM A;  3R65 A;  4MS2 A;  4X64 B;  4PI2 A;  2FML A;  4HYO A;  1EBO A;  2A9H A;  5LOV A;  1FD9 A;  5GON B;  4GYC B;  2AHZ A;  3ABM B;  1SQF A;  1TA8 A;  1XL6 A;  3F7Y C;  3HKC B;  1Q90 D;  2IU0 A;  4I50 B;  1RP3 B;  4JI1 B;  4LF5 O;  4I0X B;  3X2Q C;  4LF6 O;  4DV3 B;  1QNM A;  1VF6 C;  3D8C A;  4OXS A;  1R3I C;  1HNZ B;  2OWO A;  1Y74 A;  4DK1 A;  1OCR B;  4D7T A;  4JTD B;  3ZN1 A;  2LGQ A;  1RM1 C;  5KUM A;  4YJ3 B;  4B3M O;  4FLY A;  3CYO A;  3T1H O;  1UJW B;  3CJH A;  2F95 B;  1XUQ A;  5LYJ A;  2DYR C;  3DC6 A;  3JAW B;  1WP8 A;  1XBL A;  4UB8 Z;  5C8Y A;  3VQX A;  4XBF A;  2Y0P A;  1S3J A;  2EIJ B;  4LR3 A;  5IJ9 B;  3K0G A;  1K33 A;  2CUG A;  3KZI Z;  4DO2 A;  2Q7E A;  1VQ4 V;  1PD3 A;  5LA6 A;  4PEL A;  5JJE B;  2GUZ A;  2HVK C;  2M7W A;  3RVY A;  1XMO B;  4JYC A;  1Q81 W;  4HAM A;  1GH6 A;  4JYY A;  4EKW A;  1FPO A;  4DR5 O;  1H2M A;  1V9P A;  1HNX O;  2ZM6 B;  5TIS Z;  4RO2 A;  1R73 A;  3MD0 A;  2UXN A;  2OTL V;  3FD9 A;  5JCO A;  4DV5 B;  4DV4 B;  1OCR C;  1VAR A;  2XAH A;  2YC0 A;  4JAV A;  1GM8 A;  4Z1M G;  3T2M A;  3ZHR A;  3GWO A;  1Q3E A;  1KD1 W;  1OV9 A;  1I08 A;  4FK5 C;  5B3S C;  5B1B C;  3CP1 A;  4I5S A;  1JX9 A;  2P67 A;  2OIG A;  2ZE5 A;  1WPX A;  5EC2 C;  2GTS A;  1I5Y A;  1S5L Z;  1QHT A;  2ZE8 A;  4WBN A;  4YHH O;  2XT9 A;  1EFR G;  2F23 A;  4W4L A;  3SJQ C;  4QNH B;  3OTO O;  1OHH G;  3RGB A;  2RQ6 A;  1MOF A;  3ZHS A;  5J9P C;  4A5U B;  1S5J A;  2ZM6 O;  2F1M A;  1ROP A;  3WB0 A;  1VQN V;  2EX3 A;  4LH6 A;  4DK0 A;  4P9O A;  2Q9L A;  3T1Y O;  1ZTE A;  4NXN O;  4WBN B;  4J7K A;  5IJ0 B;  3CE2 A;  1AJP A;  2XAJ A;  3O65 A;  3JAR B;  2HEP A;  1QR8 A;  4JAA A;  5L3E A;  5J2T B;  4B3S B;  2CH7 B;  2F43 G;  1AJQ A;  2UU9 B;  2ETN A;  1IZ3 A;  3OMN B;  1KKD A;  3Q4H A;  4LP8 A;  4H13 B;  3A2F A;  3DTU B;  1KC8 W;  4K8Z A;  3UQ8 A;  5AG2 A;  1X59 A;  2YI9 A;  2BTQ B;  3IGA C;  1Y6X A;  3H9V A;  3SPC A;  1M1K W;  4FVM A;  4JGS A;  3CMA V;  2PF4 E;  2KQX A;  4X62 O;  4DR6 B;  3I55 V;  4TV8 A;  1H5W A;  5B3S B;  1EZV H;  3K04 A;  1AI4 A;  5GTH Z;  1W2B U;  1US6 A;  2QJ1 A;  3L71 H;  1K97 A;  2EIN B;  1HR0 B;  4DYL A;  2L35 A;  4R8C A;  1VQK V;  2KKW A;  4GKJ B;  3PJS K;  4PA6 A;  1NQT A;  5LMN B;  3FB6 C;  3CRQ A;  2ZNI A;  4ZKI A;  2G38 A;  5K1X A;  1R6K A;  1S72 V;  2X6C A;  1KBH A;  2WLL B;  1I94 B;  3ABT A;  4R50 A;  1XMQ B;  2AHY A;  3TET A;  4JI6 B;  4K8X A;  4DR6 O;  4QE7 A;  2K9P A;  2N04 A;  3KDR A;  1R1B A;  5IYZ A;  3RWR D;  3BEH A;  1KMI Z;  1SER A;  2ZCE A;  3QO5 A;  2JS5 A;  1H2G A;  1E1Q G;  1Z5W A;  2FB5 A;  1WN7 A;  3PN1 A;  4G28 B;  1CEZ A;  4DR5 B;  3IC7 A;  5CMU A;  2X0L A;  4N23 A;  2WLI B;  4CH4 A;  2OCC B;  1IDS A;  4GKK B;  3JAT B;  4O4J A;  2DYS C;  5GTI Z;  1GKF A;  2Q4P A;  3ABL B;  4MVO A;  4GLX A;  3ZMS A;  1V55 C;  4MTX A;  1M57 C;  5E79 Z;  1LUV A;  3CCV V;  2FTK A;  2W6J G;  3RYH A;  2FKX A;  3TXQ A;  1V54 C;  4IHJ A;  2GV9 A;  4OPH A;  4J11 A;  1BHB A;  4ZIB A;  4CH3 A;  2PYJ A;  3UM7 A;  2RNB A;  5IYC O;  3F5T A;  3K08 A;  3L75 H;  1K7D A;  1M56 C;  3E8F A;  1Q5O A;  3RVZ A;  1THZ A;  3ZRV A;  4NTY A;  4IHJ B;  4O4I B;  1HNZ O;  1F23 A;  5B1B B;  4DR7 B;  4DV2 O;  3NR7 A;  1QBZ A;  4ZOL B;  4X1Y B;  1FXV A;  2P90 A;  3CCE V;  5IY5 B;  5KHH A;  3I56 V;  2PUS A;  1CXZ B;  1Q6U A;  2XOK G;  3BAA A;  2BOB C;  3N2K B;  4B3S O;  2JEU A;  3ZRW A;  3CC2 V;  4B7K A;  3SPH A;  1N34 B;  1GMG A;  1PP9 H;  2ADQ B;  3EXA A;  3OT7 A;  1OZ0 A;  2DE0 X;  1DLB A;  2B9Z A;  4TUY A;  1XEQ A;  1FYJ A;  1WAZ A;  2CDY A;  3C3T A;  3FB8 C;  3GVM A;  4PDM A;  2ZXW B;  3ZX6 A;  4DV6 O;  4MVZ A;  4K0K O;  4OX9 B;  2Y4T A;  3ABU A;  3L73 H;  4AI8 A; 
#chains in the Genus database with same CATH homology
 1MA1 A;  3AK2 A;  1GN6 A;  4JZG A;  1ZLZ A;  2GDS A;  4JYY A;  1IDS A;  3CEI A;  1AR4 A;  2CE4 A;  1D5N A;  2P4K A;  5AG2 A;  1PL4 A;  1GN3 A;  1AR5 A;  1GN4 A;  1ZSP A;  1IX9 A;  1LUV A;  1VAR A;  2ADP A;  3AK1 A;  1AP5 A;  1BS3 A;  3BFR A;  1JA8 A;  1MMM A;  2AW9 A;  3C3S A;  1I08 A;  4GUN A;  4JZ2 A;  1BT8 A;  4X9Q A;  1N0J A;  4YIO A;  3KKY A;  3EVK A;  4C7U A;  2QKA A;  3TJT A;  1EN4 A;  1Y67 A;  1VEW A;  1QNM A;  1EN6 A;  3RN4 A;  3IC9 A;  2QKC A;  1IXB A;  1WB7 A;  1XDC A;  1SZX A;  1XRE A;  1MSD A;  4FFK A;  1EM1 A;  1EN5 A;  1LUW A;  3QVN A;  1KKC A;  1AVM A;  1XUQ A;  1I0H A;  1MNG A;  3DC5 A;  1ZTE A;  3DC6 A;  1N0N A;  1XIL A;  1P7G A;  3KDR A;  1WB8 A;  1GN2 A;  1AP6 A;  2ADQ B;  3K9S A;  3OT7 A;  3MDS A;  1BSM A;  1ZUQ A;  4BR6 A;  3LSU A;  2CDY A;  3C3T A;  1JR9 A;  2RCV A;  3AK3 A;  5A9G A;  4YIP A;  1B06 A;  4E4E A;  4F6E A;  1PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...