3EVKA

Crystal structure of the metal-bound superoxide dismutase from pyrobaculum aerophilum
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
211
Chain Sequence
SVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Fe]
publication title Crystal Structure of the Metal-bound Superoxide Dismutase from Pyrobaculum aerophilum and Comparison with the Metal-free Form
rcsb
source organism Pyrobaculum aerophilum
molecule tags Oxidoreductase
total genus 78
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3evkA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3evkA02
4JZ2A 1JA8A 2RCVA 1GN6A 1GN4A 3LSUA 1MSDA 3CEIA 1Y67A 1BSMA 1N0JA 4FFKA 1EN6A 3C3TA 1XUQA 1AP5A 4X9QA 1IX9A 3AK1A 2CE4A 1WB8A 3QVNA 2QKCA 1P7GA 1XDCA 3EVKA 1AVMA 1LUWA 1ZLZA 1SZXA 3TJTA 1B06A 1VARA 3AK3A 1EM1A 3BFRA 3DC6A 4F6EA 1WB7A 1JR9A 3C3SA 1XILA 4C7UA 3DC5A 1AR5A 1EN4A 1AP6A 1I0HA 1XREA 1IDSA 1LUVA 2QKAA 1I08A 1D5NA 5A9GA 2ADPA 1KKCA 4BR6A 1ZUQA 1MMMA 5AG2A 1EN5A 4YIPA 4GUNA 1MA1A 2GDSA 1BS3A 3IC9A 3OT7A 1IXBA 1PM9A 2ADQB 4YIOA 1MNGA 3AK2A 3KKYA 1QNMA 4JYYA 2P4KA 1ZSPA 3K9SA 4E4EA 1N0NA 1PL4A 1ZTEA 1AR4A 1BT8A 1VEWA 3MDSA 4JZGA 1GN3A 1GN2A 3RN4A 2CDYA 2AW9A
chains in the Genus database with same CATH superfamily
5H6QA 1Q8IA 4DR7B 3LUTB 1NVPB 5JH7A 1FFXB 3OMNB 1YJ9V 3BAAA 4PJ0Z 1QLEB 3K79A 1M5IA 4FJCC 3WG7B 1DLBA 4JAUA 4GKJB 2WSSG 4NXNO 1GTOA 3RFRA 1Q6UA 4PDRA 3H01A 1HNXO 1HNZB 3G6EV 4H44B 4DR4B 2A9HA 3AG2C 3B77A 3D36A 4FZ0A 1JJ2U 4RQFA 3LNMB 4GZRB 3CMAV 4YY3O 2F1MA 5JVDA 3U11A 1XQ8A 3EXAA 2A79B 2QDOA 2YC0A 1WP8A 5J2UB 4LF8O 1PKXA 5GW7A 5LMUB 3IAYA 5JQGA 5KHIA 4DR5B 4KUMA 1EZJA 4WFGA 1ZWIC 4B3SB 3A2FA 3Q4HB 3JATB 1M93A 2F93B 4O4IB 1E1QG 3ABLB 5LA6A 4JI2O 1R1BA 1QCEA 1MZEA 3OAAG 4J9YB 2AXTZ 4LF4O 1L8DA 4QIWF 2WLKA 1ZSPA 1N0NA 1KC8W 5C8YA 5IYZB 3T1HB 1AR4A 4CC6A 1BT8A 2XT9A 2OCCB 2PF4E 3F7VC 3RYHA 3T1CA 3P3NA 2HP8A 5JJEB 2QGNA 1GRJA 1MSWD 5DECA 1GN6A 3LSUA 5FL7G 4JI7B 1Y67A 3ABKC 4P2ZA 3W7SA 4YHHO 2E5LO 2DWEC 4TSFG 4JI5O 2JJ1G 2QA4V 4JYBA 5JH7B 4LC1A 3HKCA 1ZL8A 4RQEA 2WPDG 4J42A 1N32O 2DN9A 4DR3O 1YEWA 3QVNA 4DUYB 2RDCA 5EBMC 4IL6Z 2UXDO 1X59A 3RYIA 1G8MA 1JFFA 3QO8A 2EINB 3LSQA 4FLTA 3TGUH 2KB1A 1JX9A 5LP6A 2FMLA 1VQNV 2XAQA 2QEXV 4UCOA 2B5UA 3OTFA 1FAFA 4JI1B 4GX1A 3ETEA 3FAVA 2JGDA 4UV8A 1XNRB 3TXQA 5JVDB 4W4KA 4JI8O 1YSCA 3ZBHA 1GM9A 5AG2A 1SQPH 4NB5A 4N21A 1OCCB 4ZI7A 1BL8A 3IC9A 5FPOA 5JQGB 2FYUH 3UO2A 1J5EB 1H5WA 1EZVH 3OE7G 1AI7A 1NQTA 5IWAB 5LHGA 2E3CA 1YITV 3P30A 4DV5B 5LA6B 2Q68A 4X62O 2WLNA 3ZCCA 1QVFU 2L6LA 2EILC 5J9PC 3KCYA 5BR8B 2F95B 2XOKG 3RYFA 2PI4A 3SDLA 2BOBC 4B3TB 4IYHA 3PJSK 2K1EA 1MZFA 5C8YB 1GN2A 3CJHA 4DK0A 2AGAA 1XI1A 4J11A 3RYHB 5EYPA 1Q82W 3S3WA 4JI4B 2YDEA 4TOIA 4LF7B 4JV5B 2QSAA 5ITZA 3AK1A 4WFEA 4JI6B 2NR5A 2DMXA 3D3QA 3HKCB 1ZL8B 5KUMA 4BWAA 1P7GA 2O57A 3EFFK 2P90A 2EIJC 1I5YA 3OR6C 4FZ1A 3CHXA 3OGIB 5JCOC 1EM1A 5FPRA 3RYIB 1JFFB 4RUFA 4YXWG 3SYOA 4F6EA 4DR1B 4LFAO 1Q90D 4WF9V 3WU2Z 5LP6B 4I9WA 4JAVA 2D3OW 1XILA 4FIPC 4W4LA 3CXCU 1ROPA 1SC5B 1SQQH 1I0HA 4JTDB 1WLEA 3X2QC 1I08A 2Q67A 3FAVB 1D5NA 2A0LA 2JGDB 3SYCA 2WA4A 5K1XA 2Q0OC 1O9HA 3N2KA 1BS3A 2CUGA 2V1DA 3SJQC 1BMFG 5B3SB 2E75B 3KG2A 4BIUA 4L8JA 1QNMA 4LF5B 3QG5A 1SZTA 2AZ0A 2CTWA 3P32A 3KDRA 4DK1A 4MTGA 2YI8A 3ZS8C 3JCZA 1RM1B 3RYFB 4X64O 3K0DA 3I56V 5LMNB 4LCUC 3DSQA 4PELA 2AW9A 3CJHB 4HNAB 4DV2B 2ZM6B 2F4VB 1H2MA 5C93A 3E2EA 3K57A 1VMGA 4J7ZA 1KQSU 4HZ3A 1FYJA 5EYPB 4FFKA 4CC5A 3SJBC 4BAYA 1NU1H 3FFQA 1AP5A 4LF9O 2CK3G 2HKOA 2ZXWB 3UKMA 4B7KA 2CE4A 3K5OA 1Z5VA 1WB8A 2Z3YA 2NNUA 5ITZB 3OEEG 1S5JA 4FLYA 3EVKA 1KECA 1ENVA 4B3RO 4KXRA 3M8AA 1ZLZA 1V54B 3A0BZ 4LFBO 3SJAC 4K0KO 1QLEC 4PHZA 2D2CB 3WG7C 4PA3A 2N74A 3HPLC 5L3FA 2UUCO 3ZMZA 4LFCO 5IYCO 1XMQB 2AHYA 1EN4A 1GM7A 5EIBD 4DYLA 3E35A 4NTXA 5LBQA 2P5OA 2RNBA 4U7NA 4DW1A 2WAMA 3VQYA 3EHBB 2WLMA 4I0XA 2UXNA 3OMAB 1MMMA 1E79G 1LR1A 4I4TA 4UB8Z 2BCCH 5DEDA 4F6RA 1CEZA 4DV6B 2X6CA 4KFMA 1GM8A 2ITCC 3N2KB 3DGEA 1XNQO 1JOYA 3CRAA 1Q86W 1Q6HA 2OIGA 4DV0B 3K9AA 1IURA 4X1KA 4CZZA 3LDEA 4D6TH 1A32A 3T2MA 4WFAV 3CC7V 3BEHA 1DF4A 3ABLC 2IU0A 3HKEA 2ZE7A 5EBWC 1NKDA 2CGOA 4FPPA 2IBZH 1SKVA 4FLVA 5CB4A 2YXYA 4U7OA 1KP3A 4QE7A 4X66B 1DGSA 2PUSA 4MVMA 3CC4V 3CP1A 3R65A 5B1AB 2Q0AA 2IJKA 1QR8A 3ML0A 5LGTA 1GKFA 1EN6A 3C3TA 2OCCC 2UUAB 1XMOB 4GT1A 4DO2A 3CCQV 2PYLA 2JDIG 2BE3A 4GYCB 2VS0A 2CTQA 2WLLA 3QF7A 3JD2A 1R6KA 3KCXA 1AR1B 2DOSA 1SQXH 2Q7HA 3QO7A 3E89A 2ZR3A 3QNEA 3JALA 2PTMA 3L71H 3W7TA 3TJTA 1H2KA 1G6UA 4DR7O 3PN1A 4HYOA 5D5PA 1YVWA 2OT5A 3P3PA 1HR0B 3CB2A 4LFCB 1QQCA 2CGNA 1WB7A 3CCUV 3C3SA 4PA4A 4O4LA 1XHXA 5H2FZ 1HNWB 4GKJO 1IDSA 3OM3B 3SPJA 2QKAA 2EINC 3GB7C 4JASA 4I50A 5B1NA 1VF6A 2UXXA 1GAXA 4MT8A 4H0LB 2ZNIA 1QR9A 1HNZO 1BE3H 1EN5A 3TETA 4I0XB 5CN0A 1B6QA 1YJNV 1VQ6V 1KP2A 4I4TB 3D36C 4DR4O 4TV8A 3FB7C 4F6RB 5B1BC 3JSNA 2LFRA 2A7WA 4XDKA 3AG4C 1X4TA 5D5QA 3A0HZ 4JYYA 2QKSA 1OCCC 2ATKC 5LMUO 4PA7A 4X1KB 1PP9H 4BIOA 1ZTEA 4DR5O 3ABUA 2YEVA 4B3SO 4DR2B 4BW5A 1M4UA 2LQTA 3FYEB 3HKEB 3RWRD 1NJIW 4J9ZB 4JI3B 5CB4B 1VQLV 3LDDA 1Y66A 2HEPA 4YJ3A 2QWNB 3CEIA 5IJ0A 3JD0A 2R70A 3SJCC 3VQWA 2JEUA 4DR6B 1UJWB 3T1HO 4UVBA 4AILC 1YCIA 2EZOA 4O4HA 4DV4B 1GO3F 2WLLB 1SA0A 3APQA 3JSLA 3BPZA 1P49A 3CD6V 3JALB 1COWG 5B5EZ 1W59A 4TT3G 4UVCA 4JI7O 4R50A 1CXZB 1THZA 3ZHUA 4NKGB 2JK5C 2JVDA 1KYOF 4O4LB 3SPGA 1L0NH 2GTSA 4DUYO 1Q3EA 2B1IA 4LH7A 4I50B 2HG5C 2Y48A 5LP6C 4DRXA 5EIBC 4GUNA 3VBBA 2ZCEA 4B08A 3W7UA 2RQ6A 5BY1A 1MNGA 4TV8B 2ZDIA 4JI1O 2EIMC 2PY5A 4FMTA 2P4KA 1XNRO 5KHKA 1U97A 4FLUA 1YDXA 1H38A 3FD9A 3GVMA 5B3SC 4DUZB 5IDJA 4CS2A 1VQPV 1J5EO 3RN4A 2YEVB 3MD0A 5IWAO 4P30A 1S5LZ 2OWOA 2VQFB 1QVGU 1RSOA 2X7RB 4UFZA 1KKDA 5KAIZ 4DV5O 1IBMB 1AJPA 4KL1A 3L70H 4FFBA 1F7YA 2V7QG 4GCZA 2W6JG 4YJ3B 4CH3A 3VQVA 5BR8O 1OCZB 4MS2A 3OW2U 3ETGA 5IJ0B 4PDLA 4B3TO 4Q6GA 1L0LH 4QPKA 1AVMA 4QPJA 2Q7EA 2UU9B 5KHGA 4O4HB 4X65B 2WA3A 2ZQMA 2F43G 5FNVA 4ZHQA 4JI4O 1SA0B 4QNHB 3STZC 2OYQA 2ZXWC 3E83A 1NVPD 1VQMV 1TGOA 1BQZA 3JASA 2VQEB 4LF7O 4NXMB 4JV5O 3CCVV 2UXCB 2ILMA 2B9ZA 4UCTA 4RWUA 3VQXA 3IFXA 4JI6O 5LGUA 1HDJA 1V54C 4ZOLA 4LF6B 2ZIMA 5A9GA 3CE2A 1VF7A 3THOA 1MA1A 1DK1A 3OT7A 4DRXB 4DR1O 4K8ZA 1VQ9V 3ZHRA 3CWBH 2RJZA 3CS5A 3CSXA 4WCEV 5DM6V 3L74H 2IU3A 4N23A 2Y4UA 1AI4A 2AZ2A 1PV0A 3AG1B 4I7ZB 3QO5A 5FLXN 1SS3A 5DN6G 2HLDG 1NR7A 4PDVA 3ZIAG 1VQOV 3RVYA 1BGYH 4DW0A 2CDYA 3JD4A 3S3XA 3JARA 3A0RA 4LF5O 1RSOB 4CS3A 5BXZA 3K5LA 4CH5A 4G27B 4X88A 4IYIA 3CCRV 2XAGA 4JAAA 2XNDG 1F51A 4EFEA 4JGSA 4JYCA 4P9PA 1K9MW 5LXTA 1S72V 1FJGB 5HFMA 1BCCH 3BCCH 2QKCA 1AJQA 3DTUB 5LMNO 1XDCA 1Q6IA 1M1KW 4J7KA 5CMUA 3OMIB 4DV2O 2JEXA 5KLVH 2ZM6O 2F4VO 5A2QN 3FB5C 3O9OA 4CH4A 3G80A 1S76D 4Z2WA 4GX0A 4J41A 5FNVB 4BIZA 1NI8A 1OV9A 2YUAA 1HP8A 4J7JA 3ICXA 1UFIA 2FL4A 3JASB 3RVZA 3RBZA 1JNBA 3LSSA 1NR1A 3OUSA 2HFEC 2LJ2A 2Q7GA 4FM0A 2B1GA 1ZUQA 3AG3B 4ZOLB 3MHHC 1WNSA 1URFA 1JCHA 1AI6A 1XL4A 3CRRA 5IYDO 3M7MX 2KQXA 4UXNA 2UXBB 1V9PA 3CX5F 5KX5A 3OFNG 1N36B 1EFRG 1XMQO 1PNKA 1I7FA 5IJ9A 1QLNA 4R7CA 1Q43A 2JRIA 3UCSC 1K73W 1M9NA 1TVKA 1BHAA 2W0XA 4DV3B 5H9CA 4MVOA 2GSMB 5EZYA 1QU7A 2XASA 4DV6O 3ZRXA 1MOFA 4ZI7B 4QJFB 1F23A 2ITDC 1IVSA 4TUYA 3ZMUA 5KAFZ 4DV0O 3OGCC 4D7SA 1JPXA 2RCVA 1OCOC 3ZMSA 1ZX3A 3JARB 2H3OA 1XUQA 5E79Z 1OHHG 3UM7A 1S77D 1US6A 5LHIA 2EX3A 3JD3A 2CTPA 4X66O 5LXTB 1FD9A 3FX7A 2K9PA 1VARA 3AK3A 3K58A 5KHJA 2CH7A 4RUEA 2JS3A 4UUJC 2UUAO 4UCSA 4NTWA 1XMOO 4WFHA 4MVZA 2VRZA 3N2GA 5CA0A 2N05A 1LUVA 3N27A 1Q81W 1CPYA 2ADPA 3H1KH 2EIKB 1M56B 4FLWA 4K8XA 4CS4A 1M57B 2P67A 3ABKB 4MTFA 3W7XA 1N34B 1I5XA 3ZMVA 1HR0O 1VIBA 2HJDA 5IT9N 1N8RW 2R72A 3OTOB 1P4RA 2QJ1A 3CRQA 5KX5B 1HNWO 5JWPA 1TUBA 2XAHA 1VF6C 1Y4MA 1EBOA 4ASUG 3TCUA 5IJ9B 4H13B 1VQKV 1VQ8V 3GWKC 5B66Z 2YIDA 3ASNB 4BW9A 4DV1O 1TVKB 4X89A 2DYSB 1H2NA 2ZE5A 2BTQA 1XL6A 1GN3A 4Z1VA 5EZYB 4JI0B 4PD4F 2VWJA 4NVPA 1H8EG 4LH6A 2M6YA 1VQ7V 4ZBMA 5LYJA 4TUYB 2YIAA 1FPOA 3I55V 1K4CC 1G1XB 5F2VO 2X6BA 1JQ0A 3APOA 4UVAA 3L75H 2Q4PA 2Y69B 2ETNA 2ZINA 3CCLV 1WP7A 4DR2O 2RMKB 1WPBA 2ZIOA 4JI3O 2L35A 4G2KA 4FM1A 1Z2GA 3K59A 1OCZC 2XUMA 2YS8A 3H1LH 1ORQC 2CH7B 1R3KC 2KSDA 1NH2B 3WFVA 4JYAB 4DR6O 4D7TA 3F5TA 4Z1MG 3HR0A 1LNQA 4X20A 3N2GB 5CA0B 4DV4O 1KKCA 4I55A 2Y4TA 3T4DA 3MAQA 3JAWA 1YTFB 2FB5A 1FOUA 2VWKA 1Y74A 3JYCA 2QM8A 1VP7A 4OGQB 3T1YB 2ZR2A 1K92A 5L3GA 2YSUB 2LGWA 3BRCA 4E4EA 1TUBB 4DV1B 1K3EA 4MSWC 1G4YB 1R3IC 2ZE8A 2Z5UA 3K04A 3U10A 4J80A 3LNNA 4A5UB 3ABMB 4MVQA 2WLHA 3B40A 2P22C 2BTQB 1D2DA 2ZDIC 4U3JA 5HFLA 2CAZC 4MTXA 3VOUA 3H1IH 1IJGA 1MSDA 2IH1C 3H9VA 1N0JA 5LYJB 2IJJA 2QWOB 1FS0G 4X9QA 2QWPB 1TAEA 4DUZO 4AQYB 3OUFA 4EB6A 5LOVA 1R3LC 1YF2A 1IBKB 2VQFO 3I5DA 3J80N 5L3CA 3OD4A 1IBMO 2QWQB 1Q7YW 1OCRB 4HBNA 1SQGA 4I5SA 3SPHA 4GKKB 1NTKH 1K7DA 1YI2V 4NTYA 1MG1A 2Q8VA 1NH2D 3G6BA 3ZRWA 1N4CA 3FYIB 2PZSA 4KHPB 5IYZA 4DV7B 1SF9A 2H8PC 2R9RB 3B09A 2HHHB 2UU9O 1IBLB 4X20B 3R66A 4X65O 4KP4A 3HKDA 1IZ3A 4FK5C 4UV9A 3FB8C 4I55B 4B3MB 2YXHA 3JAWB 4B7EA 2ADQB 2VQEO 4NXMO 2Q6AA 2UXCO 3C90A 1RPOA 2ZT9B 3KKYA 1Y74B 4TQFA 1KUQA 3AG3C 2OIEA 5J2TA 1XHZA 1FXKA 4LF6O 5K1PA 2UUBB 1N33B 3OR7C 5CBFA 3ZN1A 2WLIA 3L72H 3ASOB 5TISZ 1PD3A 4UB6Z 2RN9A 2MK3A 3JCUZ 3U0ZA 3ZHTA 1XOUA 3K08A 3K03A 2YIBA 4YJ2A 4IIJA 4E2LA 4I9QA 5CBHA 2C2AA 1JA8A 1K5SA 2LFSA 3JD1A 4U3JB 3SYAA 5EC2C 3IJ4A 2NN4A 3L9DA 4JTCB 4K35A 2WLJA 1KMIZ 2ZE6A 2V4DA 3UO3A 4X8AA 2YXLA 1SQVH 1AROP 3DXRA 4MVSA 2Q69A 3B8NA 1YIJV 4EB6B 5LOVB 1SZXA 2DQ0A 2OTLV 1UPGA 5H5NA 3E86A 3SGIA 1RM1C 5L3EA 3FKSG 3CCEV 4HAMA 4MTOA 3B8MA 1B3QA 5LGNA 3DC5A 2HVKC 4WFFA 3K0GA 4WFBV 3ZRSA 3A8TA 1NT2B 1FJGO 3ZN0A 4L87A 2AHZA 4J10A 1S3JA 1FKAO 4TV9A 4MVRA 3F7YC 3FB6C 3ZRWB 4CBCA 3CRMA 4R6ZA 5CA1A 4EKWA 4OX9B 3TK1A 1HWYA 1YJWV 4YIOA 3HKDB 1BHBA 1PL0A 2E74B 1JMKC 1DTOA 2LO1A 5CA3A 2QM4A 4ZKIA 2EIKC 4PA9A 1M56C 2DW4A 3RYCA 5IY5B 1M57C 3IGAC 2DJVA 4IT5A 3F5WC 5J2TB 1L1FA 1FXKB 2Z0AA 3WB2A 1RFYA 1VEWA 4UCVA 4JZGA 2NLJC 2DWDC 3MDSA 2WLIB 4NXNB 2IH3C 2ODMA 1F4NA 2UXBO 1HNXB 3E22A 2F66C 1N36O 3IC7A 3RT3C 3ASNC 3T4ZA 4YJ2B 4IIJB 4LNUA 2DYSC 2JGUA 1IXMA 5KA6A 4DV3O 4PV1B 1J95A 4YY3B 5KMGA 1SESA 4UCUA 3W7WA 4FVMA 4LF8B 5B1BB 4LBEC 5LHHA 4RO2A 1Y6XA 3AG4B 1KB9F 2LW7A 5EBLC 1Y76A 3CCJV 2M7WA 1R6TA 1O9GA 3DXRB 3BFRA 4P9OA 1V55B 2Y69C 5CBGA 2A3QA 3ZHQA 1OZ0A 4FFBB 2FTKA 4JI2B 4ABMA 3ETDA 4G28B 1K34A 1AR5A 1P84F 1KU9A 1AP6A 3K3WA 3OEHG 5B1AC 3TXSA 2QR4A 4LF4B 2F23A 2R9AA 4OXSA 5H6RA 1R6NA 2JJ2G 3CRCA 4FM2A 2P7TC 4TV9B 2GDSA 2EZPA 1D5AA 2OCHA 2W6IG 4ZHQB 5GTHZ 3CPWU 5EC1C 4PDMA 3J81N 4HNAA 5CA1B 2EJRA 2BSKA 2PGGA 2BOCC 2EULA 1WA8A 3BA9A 3BY6A 4MW3A 2DYRB 4YHHB 2E5LB 2HVJC 4H37A 4GX2A 4JF3A 4JI5B 1VQ5V 3E8HA 1K33A 1KD1W 5GONA 3RYCB 4MVUA 4JPRA 5IYBO 1N32B 1WPXA 4R8CA 1W2BU 2PYJA 4DR3B 1R73A 3ABTA 2HR3A 2EJ7A 1H8HG 1N34O 4EFBA 3ETQA 2UXDB 1MABG 2W0FC 3OTOO 1M90W 3E22B 4GX5A 5B1OA 3SPCA 1AI5A 1BSMA 3NXSA 2YIBD 4UCRA 4FLXA 3UQ8A 2FKXA 1GH6A 1PNMA 1B04A 3ABMC 3AG2B 1W0KG 1IX9A 4LNUB 5EK0A 3BA8A 3AG7A 1XBLA 4ICGA 2QTOA 4O2BA 3ZMTA 5KMGB 1R3JC 1TUEB 4JI0O 4JI8B 1P7BA 1LUWA 2EIMB 4IHJA 2H94A 1I94O 1B06A 1BQ0A 4QGPA 3BABA 1Y76B 3DC6A 3NR7A 1SQBH 3ZHSA 1SQFA 2Q73A 1F4MA 4C7UA 3BHPA 2WWWA 2ZD9A 4DXWA 3JAMN 1NS1A 1WN7A 4LWSA 1FXHA 4X62B 3ZEDA 2X6AA 3WB1A 1NTZH 5E1AC 4XDLA 3STLC 3ZJZA 3D8CA 2LW1A 4BR6A 3B2EE 1WAZA 3H1JH 1OCRC 3HKBA 3MHSC 1BZKA 1S5HC 1K97A 4YIPA 2CTRA 2X0LA 4O4JA 1YXBA 4RAIA 1XEQA 4O2AA 3G71V 1K4DC 2QE7G 4AI8A 5BMVA 3G67A 4JYAO 2KG7A 5JJNB 2BSKB 5JJJB 1WA8B 2IJHA 2XAJA 1PL4A 2P06A 2DQ3A 2GTAA 4NYKA 5GONB 1PNLA 3KZIZ 2QWRB 1S0VA 3K06A 3T1YO 2KKWA 2XHBA 5JCOA 3ASOC 4LFAB 3JAKA 1RP3B 1WJZA 4GLXA 1K5QA 4MW8A 4LP8A 3B4SA 4WBNA 4PI0A 3BVOA 1H2SB 4Q20A 1JJOA 1AJNA 1I94B 2YICA 4O2BB 1SERA 1Z5WA 3WB0A 4LR3A 4IHJB 3RGBA 3GWOA 1FFTB 5KHHA 3G4SV 2DE0X 2Q9LA 4TQDA 2MW2B 1U96A 3SR2C 3CCMV 2R9IA 3UT5A 1SETA 1W0JG 2LP7A 4XBFA 3O65A 4AQYO 1VQ4V 1NBMG 4LWSB 4CH6A 2GUZA 1IBKO 2JIZG 1YZBA 4X64B 2EILB 1PM9A 3HKBB 2BTOA 3SPIA 4O4JB 2G38A 2XAFA 4GKKO 3AK2A 1KBHA 4QE9A 4O2AB 2A06H 3E8GA 1AB3A 2QM7A 5BMVB 4X1YA 3K9SA 4KHPO 2KG7B 4DV7O 4LF9B 1OJHA 4H33A 4PA6A 2HHHO 2Q5ZA 1IBLO 1E1RG 3L73H 3RW0A 3QTCA 4X1IA 2LGQA 4B3MO 1QHTA 4B3RB 5IY5C 1YHQV 3ZX6A 3ZHVA 4LFBB 4JZ2A 4K0KB 1FFXA 2IJIA 4JTAB 2PI5A 1GN4A 1FXKC 1SRYA 2EIJB 1ZAUA 4TWKA 2UUBO 1N33O 2UUCB 2GHYA 3H1HH 3JAKB 3CCSV 3E8BA 5LL6Y 4WBNB 2IM9A 1TA8A 2JS5A 3K5NA 3X2QB 4F4LA 2IW5A 5KUKA 3AG1C 4NR1A 1QBZA 5BZBA 2QTSA 2ARHA 2ZKOA 1GMGA 1XNQB 1DF5A 1T5EA 3CYOA 1GK9A 1JR9A 4FLZA 1FXVA 2Y0IA 5KA5A 5J2UA 3CC2V 4PI2A 1XREA 4IGGA 2Y0PA 5L3BA 3UT5B 1V55C 3AEIA 3ZRVA 4K3AA 1K8AW 2OTJV 1JVMA 3Q4HA 3JATA 1OCOB 4O4IA 2YI9A 2XTAA 2GUZB 1NZ6A 1IXBA 2EBOA 1Q5OA 4OPAA 4OPHA 4U3FH 3HB3B 2E76B 3D3IA 3SYQA 5IE9A 2N04A 4EEQA 3LDCA 2HJFC 1NTMH 3CMEV 1PPJH 3J7AU 1HW7A 3E8FA 2P6JA 5L3DA 1VF5B 3M99B 4X1YB 2GV9A 2P4VA 4XDJA 1RPRA 1H2GA 4ZIBA 1YTFD 2DYRC 1CP9A 1AILA 4OX9O 3K5MA 2GBOA 3SYPA 2ZNJA 1H2LA 4AHCA 3CXHF 5GTIZ 4X1IB
chains in the Genus database with same CATH topology
4JZ2A 1JA8A 2RCVA 1GN6A 1GN4A 3LSUA 1MSDA 3CEIA 1Y67A 1BSMA 1N0JA 4FFKA 1EN6A 3C3TA 1XUQA 1AP5A 4X9QA 1IX9A 3AK1A 2CE4A 1WB8A 3QVNA 2QKCA 1P7GA 1XDCA 3EVKA 1AVMA 1LUWA 1ZLZA 1SZXA 3TJTA 1B06A 1VARA 3AK3A 1EM1A 3BFRA 3DC6A 4F6EA 1WB7A 1JR9A 3C3SA 1XILA 4C7UA 3DC5A 1AR5A 1EN4A 1AP6A 1I0HA 1XREA 1IDSA 1LUVA 2QKAA 1I08A 1D5NA 5A9GA 2ADPA 1KKCA 4BR6A 1ZUQA 1MMMA 5AG2A 1EN5A 4YIPA 4GUNA 1MA1A 2GDSA 1BS3A 3IC9A 3OT7A 1IXBA 1PM9A 2ADQB 4YIOA 1MNGA 3AK2A 3KKYA 1QNMA 4JYYA 2P4KA 1ZSPA 3KDRA 3K9SA 4E4EA 1N0NA 1PL4A 1ZTEA 1AR4A 1BT8A 1VEWA 3MDSA 4JZGA 1GN3A 1GN2A 3RN4A 2CDYA 2AW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZ2 A;  1JA8 A;  2RCV A;  1GN6 A;  1GN4 A;  3LSU A;  1MSD A;  3CEI A;  1Y67 A;  1BSM A;  1N0J A;  4FFK A;  1EN6 A;  3C3T A;  1XUQ A;  1AP5 A;  4X9Q A;  1IX9 A;  3AK1 A;  2CE4 A;  1WB8 A;  3QVN A;  2QKC A;  1P7G A;  1XDC A;  3EVK A;  1AVM A;  1LUW A;  1ZLZ A;  1SZX A;  3TJT A;  1B06 A;  1VAR A;  3AK3 A;  1EM1 A;  3BFR A;  3DC6 A;  4F6E A;  1WB7 A;  1JR9 A;  3C3S A;  1XIL A;  4C7U A;  3DC5 A;  1AR5 A;  1EN4 A;  1AP6 A;  1I0H A;  1XRE A;  1IDS A;  1LUV A;  2QKA A;  1I08 A;  1D5N A;  5A9G A;  2ADP A;  1KKC A;  4BR6 A;  1ZUQ A;  1MMM A;  5AG2 A;  1EN5 A;  4YIP A;  4GUN A;  1MA1 A;  2GDS A;  1BS3 A;  3IC9 A;  3OT7 A;  1IXB A;  1PM9 A;  2ADQ B;  4YIO A;  1MNG A;  3AK2 A;  3KKY A;  1QNM A;  4JYY A;  2P4K A;  1ZSP A;  3K9S A;  4E4E A;  1N0N A;  1PL4 A;  1ZTE A;  1AR4 A;  1BT8 A;  1VEW A;  3MDS A;  4JZG A;  1GN3 A;  1GN2 A;  3RN4 A;  2CDY A;  2AW9 A; 
#chains in the Genus database with same CATH topology
 5H6Q A;  1Q8I A;  4DR7 B;  3LUT B;  1NVP B;  5JH7 A;  1FFX B;  3OMN B;  1YJ9 V;  3BAA A;  4PJ0 Z;  1QLE B;  3K79 A;  1M5I A;  4FJC C;  3WG7 B;  1DLB A;  4JAU A;  4GKJ B;  2WSS G;  4NXN O;  1GTO A;  3RFR A;  1Q6U A;  4PDR A;  3H01 A;  1HNX O;  1HNZ B;  3G6E V;  4H44 B;  4DR4 B;  2A9H A;  3AG2 C;  3B77 A;  3D36 A;  4FZ0 A;  1JJ2 U;  4RQF A;  3LNM B;  4GZR B;  3CMA V;  4YY3 O;  2F1M A;  5JVD A;  3U11 A;  1XQ8 A;  3EXA A;  2A79 B;  2QDO A;  2YC0 A;  1WP8 A;  5J2U B;  4LF8 O;  1PKX A;  5GW7 A;  5LMU B;  3IAY A;  5JQG A;  5KHI A;  4DR5 B;  4KUM A;  1EZJ A;  4WFG A;  1ZWI C;  4B3S B;  3A2F A;  3Q4H B;  3JAT B;  1M93 A;  2F93 B;  4O4I B;  1E1Q G;  3ABL B;  5LA6 A;  4JI2 O;  1R1B A;  1QCE A;  1MZE A;  3OAA G;  4J9Y B;  2AXT Z;  4LF4 O;  1L8D A;  4QIW F;  2WLK A;  1ZSP A;  1N0N A;  1KC8 W;  5C8Y A;  5IYZ B;  3T1H B;  1AR4 A;  4CC6 A;  1BT8 A;  2XT9 A;  2OCC B;  2PF4 E;  3F7V C;  3RYH A;  3T1C A;  3P3N A;  2HP8 A;  5JJE B;  2QGN A;  1GRJ A;  1MSW D;  5DEC A;  1GN6 A;  3LSU A;  5FL7 G;  4JI7 B;  1Y67 A;  3ABK C;  4P2Z A;  3W7S A;  4YHH O;  2E5L O;  2DWE C;  4TSF G;  4JI5 O;  2JJ1 G;  2QA4 V;  4JYB A;  5JH7 B;  4LC1 A;  3HKC A;  1ZL8 A;  4RQE A;  2WPD G;  4J42 A;  1N32 O;  2DN9 A;  4DR3 O;  1YEW A;  3QVN A;  4DUY B;  2RDC A;  5EBM C;  4IL6 Z;  2UXD O;  1X59 A;  3RYI A;  1G8M A;  1JFF A;  3QO8 A;  2EIN B;  3LSQ A;  4FLT A;  3TGU H;  2KB1 A;  1JX9 A;  5LP6 A;  2FML A;  1VQN V;  2XAQ A;  2QEX V;  4UCO A;  2B5U A;  3OTF A;  1FAF A;  4JI1 B;  4GX1 A;  3ETE A;  3FAV A;  2JGD A;  4UV8 A;  1XNR B;  3TXQ A;  5JVD B;  4W4K A;  4JI8 O;  1YSC A;  3ZBH A;  1GM9 A;  5AG2 A;  1SQP H;  4NB5 A;  4N21 A;  1OCC B;  4ZI7 A;  1BL8 A;  3IC9 A;  5FPO A;  5JQG B;  2FYU H;  3UO2 A;  1J5E B;  1H5W A;  1EZV H;  3OE7 G;  1AI7 A;  1NQT A;  5IWA B;  5LHG A;  2E3C A;  1YIT V;  3P30 A;  4DV5 B;  5LA6 B;  2Q68 A;  4X62 O;  2WLN A;  3ZCC A;  1QVF U;  2L6L A;  2EIL C;  5J9P C;  3KCY A;  5BR8 B;  2F95 B;  2XOK G;  3RYF A;  2PI4 A;  3SDL A;  2BOB C;  4B3T B;  4IYH A;  3PJS K;  2K1E A;  1MZF A;  5C8Y B;  1GN2 A;  3CJH A;  4DK0 A;  2AGA A;  1XI1 A;  4J11 A;  3RYH B;  5EYP A;  1Q82 W;  3S3W A;  4JI4 B;  2YDE A;  4TOI A;  4LF7 B;  4JV5 B;  2QSA A;  5ITZ A;  3AK1 A;  4WFE A;  4JI6 B;  2NR5 A;  2DMX A;  3D3Q A;  3HKC B;  1ZL8 B;  5KUM A;  4BWA A;  1P7G A;  2O57 A;  3EFF K;  2P90 A;  2EIJ C;  1I5Y A;  3OR6 C;  4FZ1 A;  3CHX A;  3OGI B;  5JCO C;  1EM1 A;  5FPR A;  3RYI B;  1JFF B;  4RUF A;  4YXW G;  3SYO A;  4F6E A;  4DR1 B;  4LFA O;  1Q90 D;  4WF9 V;  3WU2 Z;  5LP6 B;  4I9W A;  4JAV A;  2D3O W;  1XIL A;  4FIP C;  4W4L A;  3CXC U;  1ROP A;  1SC5 B;  1SQQ H;  1I0H A;  4JTD B;  1WLE A;  3X2Q C;  1I08 A;  2Q67 A;  3FAV B;  1D5N A;  2A0L A;  2JGD B;  3SYC A;  2WA4 A;  5K1X A;  2Q0O C;  1O9H A;  3N2K A;  1BS3 A;  2CUG A;  2V1D A;  3SJQ C;  1BMF G;  5B3S B;  2E75 B;  3KG2 A;  4BIU A;  4L8J A;  1QNM A;  4LF5 B;  3QG5 A;  1SZT A;  2AZ0 A;  2CTW A;  3P32 A;  3KDR A;  4DK1 A;  4MTG A;  2YI8 A;  3ZS8 C;  3JCZ A;  1RM1 B;  3RYF B;  4X64 O;  3K0D A;  3I56 V;  5LMN B;  4LCU C;  3DSQ A;  4PEL A;  2AW9 A;  3CJH B;  4HNA B;  4DV2 B;  2ZM6 B;  2F4V B;  1H2M A;  5C93 A;  3E2E A;  3K57 A;  1VMG A;  4J7Z A;  1KQS U;  4HZ3 A;  1FYJ A;  5EYP B;  4FFK A;  4CC5 A;  3SJB C;  4BAY A;  1NU1 H;  3FFQ A;  1AP5 A;  4LF9 O;  2CK3 G;  2HKO A;  2ZXW B;  3UKM A;  4B7K A;  2CE4 A;  3K5O A;  1Z5V A;  1WB8 A;  2Z3Y A;  2NNU A;  5ITZ B;  3OEE G;  1S5J A;  4FLY A;  3EVK A;  1KEC A;  1ENV A;  4B3R O;  4KXR A;  3M8A A;  1ZLZ A;  1V54 B;  3A0B Z;  4LFB O;  3SJA C;  4K0K O;  1QLE C;  4PHZ A;  2D2C B;  3WG7 C;  4PA3 A;  2N74 A;  3HPL C;  5L3F A;  2UUC O;  3ZMZ A;  4LFC O;  5IYC O;  1XMQ B;  2AHY A;  1EN4 A;  1GM7 A;  5EIB D;  4DYL A;  3E35 A;  4NTX A;  5LBQ A;  2P5O A;  2RNB A;  4U7N A;  4DW1 A;  2WAM A;  3VQY A;  3EHB B;  2WLM A;  4I0X A;  2UXN A;  3OMA B;  1MMM A;  1E79 G;  1LR1 A;  4I4T A;  4UB8 Z;  2BCC H;  5DED A;  4F6R A;  1CEZ A;  4DV6 B;  2X6C A;  4KFM A;  1GM8 A;  2ITC C;  3N2K B;  3DGE A;  1XNQ O;  1JOY A;  3CRA A;  1Q86 W;  1Q6H A;  2OIG A;  4DV0 B;  3K9A A;  1IUR A;  4X1K A;  4CZZ A;  3LDE A;  4D6T H;  1A32 A;  3T2M A;  4WFA V;  3CC7 V;  3BEH A;  1DF4 A;  3ABL C;  2IU0 A;  3HKE A;  2ZE7 A;  5EBW C;  1NKD A;  2CGO A;  4FPP A;  2IBZ H;  1SKV A;  4FLV A;  5CB4 A;  2YXY A;  4U7O A;  1KP3 A;  4QE7 A;  4X66 B;  1DGS A;  2PUS A;  4MVM A;  3CC4 V;  3CP1 A;  3R65 A;  5B1A B;  2Q0A A;  2IJK A;  1QR8 A;  3ML0 A;  5LGT A;  1GKF A;  1EN6 A;  3C3T A;  2OCC C;  2UUA B;  1XMO B;  4GT1 A;  4DO2 A;  3CCQ V;  2PYL A;  2JDI G;  2BE3 A;  4GYC B;  2VS0 A;  2CTQ A;  2WLL A;  3QF7 A;  3JD2 A;  1R6K A;  3KCX A;  1AR1 B;  2DOS A;  1SQX H;  2Q7H A;  3QO7 A;  3E89 A;  2ZR3 A;  3QNE A;  3JAL A;  2PTM A;  3L71 H;  3W7T A;  3TJT A;  1H2K A;  1G6U A;  4DR7 O;  3PN1 A;  4HYO A;  5D5P A;  1YVW A;  2OT5 A;  3P3P A;  1HR0 B;  3CB2 A;  4LFC B;  1QQC A;  2CGN A;  1WB7 A;  3CCU V;  3C3S A;  4PA4 A;  4O4L A;  1XHX A;  5H2F Z;  1HNW B;  4GKJ O;  1IDS A;  3OM3 B;  3SPJ A;  2QKA A;  2EIN C;  3GB7 C;  4JAS A;  4I50 A;  5B1N A;  1VF6 A;  2UXX A;  1GAX A;  4MT8 A;  4H0L B;  2ZNI A;  1QR9 A;  1HNZ O;  1BE3 H;  1EN5 A;  3TET A;  4I0X B;  5CN0 A;  1B6Q A;  1YJN V;  1VQ6 V;  1KP2 A;  4I4T B;  3D36 C;  4DR4 O;  4TV8 A;  3FB7 C;  4F6R B;  5B1B C;  3JSN A;  2LFR A;  2A7W A;  4XDK A;  3AG4 C;  1X4T A;  5D5Q A;  3A0H Z;  4JYY A;  2QKS A;  1OCC C;  2ATK C;  5LMU O;  4PA7 A;  4X1K B;  1PP9 H;  4BIO A;  1ZTE A;  4DR5 O;  3ABU A;  2YEV A;  4B3S O;  4DR2 B;  4BW5 A;  1M4U A;  2LQT A;  3FYE B;  3HKE B;  3RWR D;  1NJI W;  4J9Z B;  4JI3 B;  5CB4 B;  1VQL V;  3LDD A;  1Y66 A;  2HEP A;  4YJ3 A;  2QWN B;  3CEI A;  5IJ0 A;  3JD0 A;  2R70 A;  3SJC C;  3VQW A;  2JEU A;  4DR6 B;  1UJW B;  3T1H O;  4UVB A;  4AIL C;  1YCI A;  2EZO A;  4O4H A;  4DV4 B;  1GO3 F;  2WLL B;  1SA0 A;  3APQ A;  3JSL A;  3BPZ A;  1P49 A;  3CD6 V;  3JAL B;  1COW G;  5B5E Z;  1W59 A;  4TT3 G;  4UVC A;  4JI7 O;  4R50 A;  1CXZ B;  1THZ A;  3ZHU A;  4NKG B;  2JK5 C;  2JVD A;  1KYO F;  4O4L B;  3SPG A;  1L0N H;  2GTS A;  4DUY O;  1Q3E A;  2B1I A;  4LH7 A;  4I50 B;  2HG5 C;  2Y48 A;  5LP6 C;  4DRX A;  5EIB C;  4GUN A;  3VBB A;  2ZCE A;  4B08 A;  3W7U A;  2RQ6 A;  5BY1 A;  1MNG A;  4TV8 B;  2ZDI A;  4JI1 O;  2EIM C;  2PY5 A;  4FMT A;  2P4K A;  1XNR O;  5KHK A;  1U97 A;  4FLU A;  1YDX A;  1H38 A;  3FD9 A;  3GVM A;  5B3S C;  4DUZ B;  5IDJ A;  4CS2 A;  1VQP V;  1J5E O;  3RN4 A;  2YEV B;  3MD0 A;  5IWA O;  4P30 A;  1S5L Z;  2OWO A;  2VQF B;  1QVG U;  1RSO A;  2X7R B;  4UFZ A;  1KKD A;  5KAI Z;  4DV5 O;  1IBM B;  1AJP A;  4KL1 A;  3L70 H;  4FFB A;  1F7Y A;  2V7Q G;  4GCZ A;  2W6J G;  4YJ3 B;  4CH3 A;  3VQV A;  5BR8 O;  1OCZ B;  4MS2 A;  3OW2 U;  3ETG A;  5IJ0 B;  4PDL A;  4B3T O;  4Q6G A;  1L0L H;  4QPK A;  1AVM A;  4QPJ A;  2Q7E A;  2UU9 B;  5KHG A;  4O4H B;  4X65 B;  2WA3 A;  2ZQM A;  2F43 G;  5FNV A;  4ZHQ A;  4JI4 O;  1SA0 B;  4QNH B;  3STZ C;  2OYQ A;  2ZXW C;  3E83 A;  1NVP D;  1VQM V;  1TGO A;  1BQZ A;  3JAS A;  2VQE B;  4LF7 O;  4NXM B;  4JV5 O;  3CCV V;  2UXC B;  2ILM A;  2B9Z A;  4UCT A;  4RWU A;  3VQX A;  3IFX A;  4JI6 O;  5LGU A;  1HDJ A;  1V54 C;  4ZOL A;  4LF6 B;  2ZIM A;  5A9G A;  3CE2 A;  1VF7 A;  3THO A;  1MA1 A;  1DK1 A;  3OT7 A;  4DRX B;  4DR1 O;  4K8Z A;  1VQ9 V;  3ZHR A;  3CWB H;  2RJZ A;  3CS5 A;  3CSX A;  4WCE V;  5DM6 V;  3L74 H;  2IU3 A;  4N23 A;  2Y4U A;  1AI4 A;  2AZ2 A;  1PV0 A;  3AG1 B;  4I7Z B;  3QO5 A;  5FLX N;  1SS3 A;  5DN6 G;  2HLD G;  1NR7 A;  4PDV A;  3ZIA G;  1VQO V;  3RVY A;  1BGY H;  4DW0 A;  2CDY A;  3JD4 A;  3S3X A;  3JAR A;  3A0R A;  4LF5 O;  1RSO B;  4CS3 A;  5BXZ A;  3K5L A;  4CH5 A;  4G27 B;  4X88 A;  4IYI A;  3CCR V;  2XAG A;  4JAA A;  2XND G;  1F51 A;  4EFE A;  4JGS A;  4JYC A;  4P9P A;  1K9M W;  5LXT A;  1S72 V;  1FJG B;  5HFM A;  1BCC H;  3BCC H;  2QKC A;  1AJQ A;  3DTU B;  5LMN O;  1XDC A;  1Q6I A;  1M1K W;  4J7K A;  5CMU A;  3OMI B;  4DV2 O;  2JEX A;  5KLV H;  2ZM6 O;  2F4V O;  5A2Q N;  3FB5 C;  3O9O A;  4CH4 A;  3G80 A;  1S76 D;  4Z2W A;  4GX0 A;  4J41 A;  5FNV B;  4BIZ A;  1NI8 A;  1OV9 A;  2YUA A;  1HP8 A;  4J7J A;  3ICX A;  1UFI A;  2FL4 A;  3JAS B;  3RVZ A;  3RBZ A;  1JNB A;  3LSS A;  1NR1 A;  3OUS A;  2HFE C;  2LJ2 A;  2Q7G A;  4FM0 A;  2B1G A;  1ZUQ A;  3AG3 B;  4ZOL B;  3MHH C;  1WNS A;  1URF A;  1JCH A;  1AI6 A;  1XL4 A;  3CRR A;  5IYD O;  3M7M X;  2KQX A;  4UXN A;  2UXB B;  1V9P A;  3CX5 F;  5KX5 A;  3OFN G;  1N36 B;  1EFR G;  1XMQ O;  1PNK A;  1I7F A;  5IJ9 A;  1QLN A;  4R7C A;  1Q43 A;  2JRI A;  3UCS C;  1K73 W;  1M9N A;  1TVK A;  1BHA A;  2W0X A;  4DV3 B;  5H9C A;  4MVO A;  2GSM B;  5EZY A;  1QU7 A;  2XAS A;  4DV6 O;  3ZRX A;  1MOF A;  4ZI7 B;  4QJF B;  1F23 A;  2ITD C;  1IVS A;  4TUY A;  3ZMU A;  5KAF Z;  4DV0 O;  3OGC C;  4D7S A;  1JPX A;  2RCV A;  1OCO C;  3ZMS A;  1ZX3 A;  3JAR B;  2H3O A;  1XUQ A;  5E79 Z;  1OHH G;  3UM7 A;  1S77 D;  1US6 A;  5LHI A;  2EX3 A;  3JD3 A;  2CTP A;  4X66 O;  5LXT B;  1FD9 A;  3FX7 A;  2K9P A;  1VAR A;  3AK3 A;  3K58 A;  5KHJ A;  2CH7 A;  4RUE A;  2JS3 A;  4UUJ C;  2UUA O;  4UCS A;  4NTW A;  1XMO O;  4WFH A;  4MVZ A;  2VRZ A;  3N2G A;  5CA0 A;  2N05 A;  1LUV A;  3N27 A;  1Q81 W;  1CPY A;  2ADP A;  3H1K H;  2EIK B;  1M56 B;  4FLW A;  4K8X A;  4CS4 A;  1M57 B;  2P67 A;  3ABK B;  4MTF A;  3W7X A;  1N34 B;  1I5X A;  3ZMV A;  1HR0 O;  1VIB A;  2HJD A;  5IT9 N;  1N8R W;  2R72 A;  3OTO B;  1P4R A;  2QJ1 A;  3CRQ A;  5KX5 B;  1HNW O;  5JWP A;  1TUB A;  2XAH A;  1VF6 C;  1Y4M A;  1EBO A;  4ASU G;  3TCU A;  5IJ9 B;  4H13 B;  1VQK V;  1VQ8 V;  3GWK C;  5B66 Z;  2YID A;  3ASN B;  4BW9 A;  4DV1 O;  1TVK B;  4X89 A;  2DYS B;  1H2N A;  2ZE5 A;  2BTQ A;  1XL6 A;  1GN3 A;  4Z1V A;  5EZY B;  4JI0 B;  4PD4 F;  2VWJ A;  4NVP A;  1H8E G;  4LH6 A;  2M6Y A;  1VQ7 V;  4ZBM A;  5LYJ A;  4TUY B;  2YIA A;  1FPO A;  3I55 V;  1K4C C;  1G1X B;  5F2V O;  2X6B A;  1JQ0 A;  3APO A;  4UVA A;  3L75 H;  2Q4P A;  2Y69 B;  2ETN A;  2ZIN A;  3CCL V;  1WP7 A;  4DR2 O;  2RMK B;  1WPB A;  2ZIO A;  4JI3 O;  2L35 A;  4G2K A;  4FM1 A;  1Z2G A;  3K59 A;  1OCZ C;  2XUM A;  2YS8 A;  3H1L H;  1ORQ C;  2CH7 B;  1R3K C;  2KSD A;  1NH2 B;  3WFV A;  4JYA B;  4DR6 O;  4D7T A;  3F5T A;  4Z1M G;  3HR0 A;  1LNQ A;  4X20 A;  3N2G B;  5CA0 B;  4DV4 O;  1KKC A;  4I55 A;  2Y4T A;  3T4D A;  3MAQ A;  3JAW A;  1YTF B;  2FB5 A;  1FOU A;  2VWK A;  1Y74 A;  3JYC A;  2QM8 A;  1VP7 A;  4OGQ B;  3T1Y B;  2ZR2 A;  1K92 A;  5L3G A;  2YSU B;  2LGW A;  3BRC A;  4E4E A;  1TUB B;  4DV1 B;  1K3E A;  4MSW C;  1G4Y B;  1R3I C;  2ZE8 A;  2Z5U A;  3K04 A;  3U10 A;  4J80 A;  3LNN A;  4A5U B;  3ABM B;  4MVQ A;  2WLH A;  3B40 A;  2P22 C;  2BTQ B;  1D2D A;  2ZDI C;  4U3J A;  5HFL A;  2CAZ C;  4MTX A;  3VOU A;  3H1I H;  1IJG A;  1MSD A;  2IH1 C;  3H9V A;  1N0J A;  5LYJ B;  2IJJ A;  2QWO B;  1FS0 G;  4X9Q A;  2QWP B;  1TAE A;  4DUZ O;  4AQY B;  3OUF A;  4EB6 A;  5LOV A;  1R3L C;  1YF2 A;  1IBK B;  2VQF O;  3I5D A;  3J80 N;  5L3C A;  3OD4 A;  1IBM O;  2QWQ B;  1Q7Y W;  1OCR B;  4HBN A;  1SQG A;  4I5S A;  3SPH A;  4GKK B;  1NTK H;  1K7D A;  1YI2 V;  4NTY A;  1MG1 A;  2Q8V A;  1NH2 D;  3G6B A;  3ZRW A;  1N4C A;  3FYI B;  2PZS A;  4KHP B;  5IYZ A;  4DV7 B;  1SF9 A;  2H8P C;  2R9R B;  3B09 A;  2HHH B;  2UU9 O;  1IBL B;  4X20 B;  3R66 A;  4X65 O;  4KP4 A;  3HKD A;  1IZ3 A;  4FK5 C;  4UV9 A;  3FB8 C;  4I55 B;  4B3M B;  2YXH A;  3JAW B;  4B7E A;  2ADQ B;  2VQE O;  4NXM O;  2Q6A A;  2UXC O;  3C90 A;  1RPO A;  2ZT9 B;  3KKY A;  1Y74 B;  4TQF A;  1KUQ A;  3AG3 C;  2OIE A;  5J2T A;  1XHZ A;  1FXK A;  4LF6 O;  5K1P A;  2UUB B;  1N33 B;  3OR7 C;  5CBF A;  3ZN1 A;  2WLI A;  3L72 H;  3ASO B;  5TIS Z;  1PD3 A;  4UB6 Z;  2RN9 A;  2MK3 A;  3JCU Z;  3U0Z A;  3ZHT A;  1XOU A;  3K08 A;  3K03 A;  2YIB A;  4YJ2 A;  4IIJ A;  4E2L A;  4I9Q A;  5CBH A;  2C2A A;  1JA8 A;  1K5S A;  2LFS A;  3JD1 A;  4U3J B;  3SYA A;  5EC2 C;  3IJ4 A;  2NN4 A;  3L9D A;  4JTC B;  4K35 A;  2WLJ A;  1KMI Z;  2ZE6 A;  2V4D A;  3UO3 A;  4X8A A;  2YXL A;  1SQV H;  1ARO P;  3DXR A;  4MVS A;  2Q69 A;  3B8N A;  1YIJ V;  4EB6 B;  5LOV B;  1SZX A;  2DQ0 A;  2OTL V;  1UPG A;  5H5N A;  3E86 A;  3SGI A;  1RM1 C;  5L3E A;  3FKS G;  3CCE V;  4HAM A;  4MTO A;  3B8M A;  1B3Q A;  5LGN A;  3DC5 A;  2HVK C;  4WFF A;  3K0G A;  4WFB V;  3ZRS A;  3A8T A;  1NT2 B;  1FJG O;  3ZN0 A;  4L87 A;  2AHZ A;  4J10 A;  1S3J A;  1FKA O;  4TV9 A;  4MVR A;  3F7Y C;  3FB6 C;  3ZRW B;  4CBC A;  3CRM A;  4R6Z A;  5CA1 A;  4EKW A;  4OX9 B;  3TK1 A;  1HWY A;  1YJW V;  4YIO A;  3HKD B;  1BHB A;  1PL0 A;  2E74 B;  1JMK C;  1DTO A;  2LO1 A;  5CA3 A;  2QM4 A;  4ZKI A;  2EIK C;  4PA9 A;  1M56 C;  2DW4 A;  3RYC A;  5IY5 B;  1M57 C;  3IGA C;  2DJV A;  4IT5 A;  3F5W C;  5J2T B;  1L1F A;  1FXK B;  2Z0A A;  3WB2 A;  1RFY A;  1VEW A;  4UCV A;  4JZG A;  2NLJ C;  2DWD C;  3MDS A;  2WLI B;  4NXN B;  2IH3 C;  2ODM A;  1F4N A;  2UXB O;  1HNX B;  3E22 A;  2F66 C;  1N36 O;  3IC7 A;  3RT3 C;  3ASN C;  3T4Z A;  4YJ2 B;  4IIJ B;  4LNU A;  2DYS C;  2JGU A;  1IXM A;  5KA6 A;  4DV3 O;  4PV1 B;  1J95 A;  4YY3 B;  5KMG A;  1SES A;  4UCU A;  3W7W A;  4FVM A;  4LF8 B;  5B1B B;  4LBE C;  5LHH A;  4RO2 A;  1Y6X A;  3AG4 B;  1KB9 F;  2LW7 A;  5EBL C;  1Y76 A;  3CCJ V;  2M7W A;  1R6T A;  1O9G A;  3DXR B;  3BFR A;  4P9O A;  1V55 B;  2Y69 C;  5CBG A;  2A3Q A;  3ZHQ A;  1OZ0 A;  4FFB B;  2FTK A;  4JI2 B;  4ABM A;  3ETD A;  4G28 B;  1K34 A;  1AR5 A;  1P84 F;  1KU9 A;  1AP6 A;  3K3W A;  3OEH G;  5B1A C;  3TXS A;  2QR4 A;  4LF4 B;  2F23 A;  2R9A A;  4OXS A;  5H6R A;  1R6N A;  2JJ2 G;  3CRC A;  4FM2 A;  2P7T C;  4TV9 B;  2GDS A;  2EZP A;  1D5A A;  2OCH A;  2W6I G;  4ZHQ B;  5GTH Z;  3CPW U;  5EC1 C;  4PDM A;  3J81 N;  4HNA A;  5CA1 B;  2EJR A;  2BSK A;  2PGG A;  2BOC C;  2EUL A;  1WA8 A;  3BA9 A;  3BY6 A;  4MW3 A;  2DYR B;  4YHH B;  2E5L B;  2HVJ C;  4H37 A;  4GX2 A;  4JF3 A;  4JI5 B;  1VQ5 V;  3E8H A;  1K33 A;  1KD1 W;  5GON A;  3RYC B;  4MVU A;  4JPR A;  5IYB O;  1N32 B;  1WPX A;  4R8C A;  1W2B U;  2PYJ A;  4DR3 B;  1R73 A;  3ABT A;  2HR3 A;  2EJ7 A;  1H8H G;  1N34 O;  4EFB A;  3ETQ A;  2UXD B;  1MAB G;  2W0F C;  3OTO O;  1M90 W;  3E22 B;  4GX5 A;  5B1O A;  3SPC A;  1AI5 A;  1BSM A;  3NXS A;  2YIB D;  4UCR A;  4FLX A;  3UQ8 A;  2FKX A;  1GH6 A;  1PNM A;  1B04 A;  3ABM C;  3AG2 B;  1W0K G;  1IX9 A;  4LNU B;  5EK0 A;  3BA8 A;  3AG7 A;  1XBL A;  4ICG A;  2QTO A;  4O2B A;  3ZMT A;  5KMG B;  1R3J C;  1TUE B;  4JI0 O;  4JI8 B;  1P7B A;  1LUW A;  2EIM B;  4IHJ A;  2H94 A;  1I94 O;  1B06 A;  1BQ0 A;  4QGP A;  3BAB A;  1Y76 B;  3DC6 A;  3NR7 A;  1SQB H;  3ZHS A;  1SQF A;  2Q73 A;  1F4M A;  4C7U A;  3BHP A;  2WWW A;  2ZD9 A;  4DXW A;  3JAM N;  1NS1 A;  1WN7 A;  4LWS A;  1FXH A;  4X62 B;  3ZED A;  2X6A A;  3WB1 A;  1NTZ H;  5E1A C;  4XDL A;  3STL C;  3ZJZ A;  3D8C A;  2LW1 A;  4BR6 A;  3B2E E;  1WAZ A;  3H1J H;  1OCR C;  3HKB A;  3MHS C;  1BZK A;  1S5H C;  1K97 A;  4YIP A;  2CTR A;  2X0L A;  4O4J A;  1YXB A;  4RAI A;  1XEQ A;  4O2A A;  3G71 V;  1K4D C;  2QE7 G;  4AI8 A;  5BMV A;  3G67 A;  4JYA O;  2KG7 A;  5JJN B;  2BSK B;  5JJJ B;  1WA8 B;  2IJH A;  2XAJ A;  1PL4 A;  2P06 A;  2DQ3 A;  2GTA A;  4NYK A;  5GON B;  1PNL A;  3KZI Z;  2QWR B;  1S0V A;  3K06 A;  3T1Y O;  2KKW A;  2XHB A;  5JCO A;  3ASO C;  4LFA B;  3JAK A;  1RP3 B;  1WJZ A;  4GLX A;  1K5Q A;  4MW8 A;  4LP8 A;  3B4S A;  4WBN A;  4PI0 A;  3BVO A;  1H2S B;  4Q20 A;  1JJO A;  1AJN A;  1I94 B;  2YIC A;  4O2B B;  1SER A;  1Z5W A;  3WB0 A;  4LR3 A;  4IHJ B;  3RGB A;  3GWO A;  1FFT B;  5KHH A;  3G4S V;  2DE0 X;  2Q9L A;  4TQD A;  2MW2 B;  1U96 A;  3SR2 C;  3CCM V;  2R9I A;  3UT5 A;  1SET A;  1W0J G;  2LP7 A;  4XBF A;  3O65 A;  4AQY O;  1VQ4 V;  1NBM G;  4LWS B;  4CH6 A;  2GUZ A;  1IBK O;  2JIZ G;  1YZB A;  4X64 B;  2EIL B;  1PM9 A;  3HKB B;  2BTO A;  3SPI A;  4O4J B;  2G38 A;  2XAF A;  4GKK O;  3AK2 A;  1KBH A;  4QE9 A;  4O2A B;  2A06 H;  3E8G A;  1AB3 A;  2QM7 A;  5BMV B;  4X1Y A;  3K9S A;  4KHP O;  2KG7 B;  4DV7 O;  4LF9 B;  1OJH A;  4H33 A;  4PA6 A;  2HHH O;  2Q5Z A;  1IBL O;  1E1R G;  3L73 H;  3RW0 A;  3QTC A;  4X1I A;  2LGQ A;  4B3M O;  1QHT A;  4B3R B;  5IY5 C;  1YHQ V;  3ZX6 A;  3ZHV A;  4LFB B;  4JZ2 A;  4K0K B;  1FFX A;  2IJI A;  4JTA B;  2PI5 A;  1GN4 A;  1FXK C;  1SRY A;  2EIJ B;  1ZAU A;  4TWK A;  2UUB O;  1N33 O;  2UUC B;  2GHY A;  3H1H H;  3JAK B;  3CCS V;  3E8B A;  5LL6 Y;  4WBN B;  2IM9 A;  1TA8 A;  2JS5 A;  3K5N A;  3X2Q B;  4F4L A;  2IW5 A;  5KUK A;  3AG1 C;  4NR1 A;  1QBZ A;  5BZB A;  2QTS A;  2ARH A;  2ZKO A;  1GMG A;  1XNQ B;  1DF5 A;  1T5E A;  3CYO A;  1GK9 A;  1JR9 A;  4FLZ A;  1FXV A;  2Y0I A;  5KA5 A;  5J2U A;  3CC2 V;  4PI2 A;  1XRE A;  4IGG A;  2Y0P A;  5L3B A;  3UT5 B;  1V55 C;  3AEI A;  3ZRV A;  4K3A A;  1K8A W;  2OTJ V;  1JVM A;  3Q4H A;  3JAT A;  1OCO B;  4O4I A;  2YI9 A;  2XTA A;  2GUZ B;  1NZ6 A;  1IXB A;  2EBO A;  1Q5O A;  4OPA A;  4OPH A;  4U3F H;  3HB3 B;  2E76 B;  3D3I A;  3SYQ A;  5IE9 A;  2N04 A;  4EEQ A;  3LDC A;  2HJF C;  1NTM H;  3CME V;  1PPJ H;  3J7A U;  1HW7 A;  3E8F A;  2P6J A;  5L3D A;  1VF5 B;  3M99 B;  4X1Y B;  2GV9 A;  2P4V A;  4XDJ A;  1RPR A;  1H2G A;  4ZIB A;  1YTF D;  2DYR C;  1CP9 A;  1AIL A;  4OX9 O;  3K5M A;  2GBO A;  3SYP A;  2ZNJ A;  1H2L A;  4AHC A;  3CXH F;  5GTI Z;  4X1I B; 
#chains in the Genus database with same CATH homology
 4JZ2 A;  1JA8 A;  2RCV A;  1GN6 A;  1GN4 A;  3LSU A;  1MSD A;  3CEI A;  1Y67 A;  1BSM A;  1N0J A;  4FFK A;  1EN6 A;  3C3T A;  1XUQ A;  1AP5 A;  4X9Q A;  1IX9 A;  3AK1 A;  2CE4 A;  1WB8 A;  3QVN A;  2QKC A;  1P7G A;  1XDC A;  3EVK A;  1AVM A;  1LUW A;  1ZLZ A;  1SZX A;  3TJT A;  1B06 A;  1VAR A;  3AK3 A;  1EM1 A;  3BFR A;  3DC6 A;  4F6E A;  1WB7 A;  1JR9 A;  3C3S A;  1XIL A;  4C7U A;  3DC5 A;  1AR5 A;  1EN4 A;  1AP6 A;  1I0H A;  1XRE A;  1IDS A;  1LUV A;  2QKA A;  1I08 A;  1D5N A;  5A9G A;  2ADP A;  1KKC A;  4BR6 A;  1ZUQ A;  1MMM A;  5AG2 A;  1EN5 A;  4YIP A;  4GUN A;  1MA1 A;  2GDS A;  1BS3 A;  3IC9 A;  3OT7 A;  1IXB A;  1PM9 A;  2ADQ B;  4YIO A;  1MNG A;  3AK2 A;  3KKY A;  1QNM A;  4JYY A;  2P4K A;  1ZSP A;  3KDR A;  3K9S A;  4E4E A;  1N0N A;  1PL4 A;  1ZTE A;  1AR4 A;  1BT8 A;  1VEW A;  3MDS A;  4JZG A;  1GN3 A;  1GN2 A;  3RN4 A;  2CDY A;  2AW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...