3EVKA

Crystal structure of the metal-bound superoxide dismutase from pyrobaculum aerophilum
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
211
structure length
211
Chain Sequence
SVTTKRYTLPPLPYAYNALEPYISAEIMQLHHQKHHQGYVNGANAALEKLEKFRKGEAQIDIRAVLRDLSFHLNGHILHSIFWPNMAPPGKGGGKPGGKIADLINKFFGSFEKFKEEFSQAAKNVEGVGWAILVYEPLEEQLLILQIEKHNLMHAADAQVLLALDVWEHAYYLQYKNDRGSYVDNWWNVVNWDDVERRLQKALNGQIALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Fe]
publication title Crystal Structure of the Metal-bound Superoxide Dismutase from Pyrobaculum aerophilum and Comparison with the Metal-free Form
rcsb
source organism Pyrobaculum aerophilum
total genus 78
structure length 211
sequence length 211
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3evkA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3evkA02
3C3TA 3BFRA 1XDCA 3MDSA 1EN6A 3TJTA 1BSMA 1D5NA 4JZ2A 4F6EA 1IXBA 1I0HA 4X9QA 2QKCA 1WB8A 2RCVA 1GN4A 3DC5A 1AR5A 3AK2A 4YIOA 1EN5A 1PM9A 4GUNA 1MSDA 2ADPA 3AK3A 3QVNA 2CDYA 4BR6A 1VARA 1Y67A 1AP6A 1IX9A 1KKCA 3DC6A 1PL4A 4C7UA 1B06A 1XUQA 2CE4A 1GN2A 2QKAA 2ADQB 1ZUQA 3AK1A 1GN6A 1LUVA 1MMMA 2P4KA 5A9GA 1XREA 4YIPA 3EVKA 3KKYA 2GDSA 1EM1A 1N0NA 1MNGA 3RN4A 1AR4A 1BS3A 1N0JA 1JR9A 1LUWA 4FFKA 3CEIA 1AP5A 1EN4A 1SZXA 4JZGA 1ZLZA 1JA8A 1IDSA 1GN3A 2AW9A 3IC9A 1MA1A 4E4EA 3OT7A 1I08A 5AG2A 1ZTEA 1ZSPA 3K9SA 3LSUA 1WB7A 1AVMA 1P7GA 3C3SA 1VEWA 1BT8A 1QNMA 1XILA 4JYYA
chains in the Genus database with same CATH superfamily
3ABKC 5C93A 3OAAG 1AJNA 1DTOA 1TUBB 4O2BA 5IYBO 4RAIA 4ZBMA 4O4HB 4W4KA 3HKCA 3P32A 3ABMC 4YXWG 2K1EA 3HKBA 2BOCC 1KKDA 2GTAA 3ZRXA 1Q43A 4FVMA 2P90A 5FPRA 4FLTA 5GTHZ 1YSCA 2UU9B 4YY3O 4YJ3B 5LP6A 3G6BA 1DGSA 4DR5O 1L0LH 5EC2C 3CS5A 2CTWA 4LF9B 1K92A 2ZNJA 5LMUO 1TUEB 2BTOA 2IJKA 2M6YA 2F93B 4FFBA 4N21A 2ZE8A 2GSMB 5EBMC 1Q3EA 3S3XA 3K5OA 1Q6UA 4B3RB 3ICXA 5IYZB 4UCSA 3ZIAG 2X6AA 5IT9N 2DN9A 4EB6A 3F7YC 3F5TA 5JQGB 5IYZA 3EVKA 1IXMA 2QE7G 5JQGA 1L0NH 4DV3O 4J7ZA 4XDLA 4UV8A 4LWSA 3A0HZ 2OT5A 1WP7A 2Y4TA 3W7TA 3NXSA 3CRQA 4CH3A 5JVDB 3ZMZA 4DYLA 4FZ1A 1AP5A 5CMUA 4PDVA 4AQYO 2ITDC 1IBKO 2Q7HA 3OMAB 4JI3B 5IY5C 2WA4A 3ZEDA 3OUSA 1GMGA 3CWBH 1B3QA 3K9SA 1Q5OA 3SJAC 3KG2A 2IM9A 2ZIOA 2WAMA 3CCLV 2ZR2A 3E8HA 2G38A 3H01A 5EC1C 4ICGA 1QU7A 2QWQB 2R72A 3N2GB 4PA9A 4GKKB 4DV4O 2CGOA 4I9WA 3E8FA 4YJ2A 3N2GA 3SPGA 5B5EZ 4UVBA 3I55V 3QO7A 2PYLA 1N8RW 1TAEA 3CP1A 3T1CA 1VQLV 1OCRB 4JI6B 3WB1A 1I7FA 4X9QA 4O4LA 4O4JA 2E75B 1M90W 2Q69A 3STLC 1WB8A 4K8ZA 2YICA 1AR5A 1I94B 5K1PA 4F4LA 1JMKC 1M1KW 4TUYB 4NKGB 2YEVB 1HR0B 3KCXA 5BR8O 1URFA 4CH4A 4TUYA 1GM9A 3L73H 4LFBB 4PI0A 2YEVA 1BE3H 4LR3A 3UKMA 1YXBA 2JVDA 1HWYA 1FJGB 3FAVB 5DM6V 4NTYA 3TGUH 2ADQB 3CCMV 5KHJA 3AK1A 3FAVA 1VP7A 1GN6A 1VQOV 2RDCA 4LH6A 3N27A 3OMNB 2CTPA 5CBFA 1TGOA 2EINB 2A3QA 3GWKC 1M56B 4X1KB 2NNUA 2WWWA 5KA6A 4R8CA 4IGGA 4JAUA 2ZQMA 4GX0A 4GKKO 4WBNB 3U11A 3ABMB 4B3MB 2DYRB 2ZT9B 3FKSG 3L72H 2KSDA 3K03A 3BA8A 2W6IG 4X8AA 1OCOB 4BW5A 4MVMA 3K5MA 4JI6O 4UXNA 2UXBO 4UVCA 3QF7A 1PD3A 3X2QB 2Y0IA 1Z5WA 2Y4UA 1ZSPA 4D7SA 2DYSC 1VQMV 3IJ4A 5H5NA 4RWUA 3RYIB 4I55A 4PA6A 1PPJH 1HR0O 3VQXA 2DW4A 3RYIA 1EZJA 2AXTZ 1Q81W 3TJTA 4L8JA 1D2DA 1IURA 2YS8A 2A79B 4B7EA 3JAKB 1SQVH 3T1YB 2EILB 4NXMO 1NR1A 4A5UB 5LMNB 4DR2O 4B3TO 3JAKA 5LHIA 3ZMTA 2JJ1G 4IHJA 5JJEB 4JYBA 1BGYH 5CA0B 4B08A 4DUYO 1DK1A 4JTDB 2Q7GA 4FJCC 3ZHRA 1QR9A 1BHAA 4H0LB 3ZHUA 4QNHB 1R3LC 3RT3C 1K5QA 1BQ0A 1YJ9V 2X6CA 4C7UA 1B06A 2BE3A 3TCUA 1RFYA 1XL6A 1MSWD 1WP8A 1FAFA 1E1RG 1N4CA 4B7KA 1AR4A 3TK1A 1SA0A 3VOUA 4MVSA 5DECA 2EIJB 5EK0A 3ZRVA 2PGGA 2HHHO 2CK3G 2RQ6A 1H38A 3RYHB 5A2QN 3UO2A 4U7NA 2EIKC 3BAAA 5BMVB 2IJIA 3CC2V 4DR6O 3RYHA 1DLBA 1JJ2U 3ABLB 4GYCB 1GN3A 5KMGA 2AW9A 2CH7B 3T1YO 5LMNO 1N36O 1IBLO 5IJ0B 2CH7A 1S5HC 3M8AA 2ZR3A 1I08A 3M99B 5IJ0A 3JD2A 1FFXB 4DR3O 2XAQA 3K04A 4JTAB 3JALB 2CTQA 2UXXA 4I7ZB 4X64B 3JALA 1HW7A 1AI5A 2YXYA 1KUQA 2Q73A 4MTOA 5B1BB 3F7VC 3L74H 1P7BA 1MABG 1GK9A 4DV2O 4QPKA 4MVUA 5B3SB 1SRYA 1XOUA 5KUMA 3ASOB 4IYHA 2AHYA 4MVQA 4BWAA 2WLNA 3JAWA 4Q6GA 1H8EG 3LDCA 3OR6C 5KAIZ 3CCEV 4ZHQB 2XASA 2ADPA 1AI4A 3SDLA 5BZBA 2KG7A 3RFRA 2Y69B 1VQ6V 1G4YB 2YIBD 4YHHB 1YF2A 3J7AU 1TVKB 1E1QG 3RBZA 1FPOA 2ATKC 4JI4B 4DK0A 4RO2A 1H2LA 3UCSC 2UUBB 3AG4B 1K33A 4JI0B 2ZE6A 1MNGA 1K8AW 3P30A 1SQBH 2N74A 4U3FH 4X64O 2VS0A 4DV6O 3SPHA 1SZTA 3S3WA 4GLXA 3I5DA 4X62O 1N34B 1SZXA 4JZGA 2UUCB 3QG5A 4FLZA 3PN1A 3VQVA 3FX7A 2YI8A 4X20B 4MW3A 1FOUA 3B8MA 2UXDO 4PELA 3ZRWB 1H8HG 1Q6HA 2PF4E 3L70H 1WB7A 3MHHC 3C3SA 4PA3A 4B3SB 5GW7A 5JWPA 5KA5A 5LBQA 3ZMSA 4MTGA 1S5LZ 4KHPO 3B77A 4FLYA 3A2FA 3ZHTA 3NR7A 2UUAO 4DXWA 2WLMA 4MS2A 1XMOB 1SS3A 3MHSC 3OGCC 4H13B 4LCUC 4NTWA 4TV9B 1IXBA 1XHXA 2B5UA 4TV9A 3WB2A 4CC5A 5KHGA 4JI0O 3H1KH 4H37A 3JD1A 1G1XB 1GN4A 2C2AA 2IH3C 1YI2V 4PV1B 1YITV 4NXNB 1WJZA 2H3OA 2EJ7A 3JARA 3OTFA 3OW2U 1SERA 4JYCA 2GUZA 3RYCB 1H2MA 1PL4A 1Y66A 5IJ9A 5FLXN 4FM0A 1AI7A 4H33A 5F2VO 1PL0A 5L3FA 1CEZA 1MMMA 1ZX3A 4FLXA 2BSKB 5FNVB 5HFMA 1Y76B 3SPJA 5FNVA 4KL1A 4UFZA 1V9PA 4B3SO 1Y76A 5L3DA 5LGNA 2V1DA 5KHKA 2JGDB 3ZRSA 2HJDA 4LF6O 3LDEA 1XL4A 4QIWF 4X66O 4YY3B 3IC9A 4CC6A 1OCRC 2LFSA 4DR5B 3A0BZ 2VQFO 2FTKA 2VQEB 1HNZO 1SQGA 2ZNIA 5LMUB 1XILA 1Q6IA 2CUGA 4FIPC 4NXNO 1SC5B 4GCZA 3C3TA 5CA3A 1QHTA 5EZYA 5GTIZ 3D36C 1OJHA 4OX9B 5KHHA 3QO5A 4HAMA 1NBMG 5JH7A 1HP8A 2GTSA 4RUEA 4Q20A 2YUAA 4DV3B 2EINC 5LOVA 2JDIG 5EBWC 1M56C 1XNRB 2PI4A 1BHBA 4XDKA 2PY5A 1WPXA 3BY6A 4EFEA 4WFGA 3SR2C 4AQYB 1XQ8A 1TUBA 1IBKB 1KD1W 3K59A 2DYRC 4O4HA 4JYAO 1UPGA 4QPJA 2WLJA 1OCOC 5L3CA 2QGNA 3H1IH 2RMKB 1O9HA 3SJQC 1EZVH 3X2QC 2WLHA 4JI2O 1KP2A 4YJ3A 3WG7B 1H2NA 4DO2A 3FB8C 4U7OA 1EM1A 3EFFK 3HR0A 3D8CA 5GONB 2VQEO 1S77D 1U97A 4DV4B 3TXQA 1Q7YW 2JIZG 1NH2D 4K3AA 4O2AB 1E79G 3JATB 4OX9O 2IU0A 2HFEC 3JATA 2EILC 1QLEB 1YJNV 4CBCA 2P6JA 2YDEA 4LFAB 4G2KA 2WLLB 1ZL8B 3N2KB 3H1JH 5JJJB 3LSUA 2WLLA 1ZL8A 1XNRO 1W0KG 5BR8B 2EX3A 2LGWA 3SPCA 1YZBA 2FKXA 5JVDA 1M93A 1N32O 2ZDIA 2YIDA 4CS2A 1BSMA 1PV0A 2YSUB 5EIBC 4AILC 2OIGA 2Z3YA 1MG1A 4AHCA 3AEIA 1W2BU 1JQ0A 4RQEA 5J2TB 2IJHA 1HDJA 4QGPA 3UO3A 2GBOA 1WA8B 3ABTA 4CS3A 3ZMUA 3CE2A 4WF9V 2EIJC 1WA8A 1Z2GA 3UM7A 1VQ4V 3ASNB 4OPHA 5IYDO 3ZHQA 3W7XA 2QWNB 4R50A 3ABLC 4ZI7B 3WFVA 5CA1B 4JI1O 4IT5A 2UXBB 2CE4A 1GN2A 4QE7A 3ZCCA 5ITZB 3SPIA 1J5EO 4LFAO 2V7QG 3CMAV 5ITZA 2HP8A 4UCVA 1Y74B 2YXHA 3VBBA 1VQ7V 3RVYA 1X59A 1M57B 1FYJA 1GAXA 4J9ZB 5B1BC 2OTLV 2HJFC 3D36A 4TV8B 3JSNA 3SJCC 4AI8A 4NXMB 4LH7A 1N33B 4DR2B 4B3TB 3AG3B 5B3SC 3A8TA 3G4SV 2P67A 1W0JG 3ASOC 1MA1A 2X7RB 3JAMN 3GB7C 3LDDA 4DUYB 2ZKOA 5D5QA 1P7GA 4FMTA 3FYEB 4ASUG 4X1KA 3MD0A 1XHZA 4J7KA 5EBLC 2Y69C 2R9AA 4WBNA 3DXRB 3MDSA 1CPYA 2OCCB 1J95A 3DXRA 1G6UA 4OPAA 4X1YB 1NJIW 4X1YA 2MW2B 2E74B 5CBHA 1AB3A 4F6EA 3AG4C 1PNMA 4JI5O 2D2CB 1I0HA 2XHBA 4DV0B 3F5WC 2HHHB 2GV9A 2M7WA 2XAHA 1QR8A 2NR5A 3U0ZA 1VIBA 4DR6B 2Q0AA 3JD4A 4G28B 2BCCH 3B8NA 3K0GA 1AP6A 2AHZA 2IU3A 2HR3A 1JNBA 4DR7O 3CD6V 2EBOA 1N36B 1IBLB 1N33O 3OUFA 2F23A 3H1LH 3CXCU 2CAZC 4JV5B 1CXZB 1XUQA 5LA6B 1GTOA 3ETDA 5E79Z 1ZUQA 3LNMB 4DR3B 5LA6A 2LW1A 1UFIA 5L3EA 2YXLA 1QVGU 2LGQA 5CA0A 1H2KA 1XMQB 1KB9F 1GKFA 2P4VA 1BS3A 4DV2B 2RN9A 1NT2B 2IBZH 2LFRA 1P4RA 5TISZ 4RQFA 5FL7G 1IDSA 2CGNA 1W59A 4P30A 3SYAA 5LXTB 4PHZA 4ABMA 1R3JC 2QSAA 1S3JA 3RW0A 4TWKA 4DV0O 1XNQB 3APOA 3R65A 1ZAUA 2Q5ZA 1BZKA 3BRCA 4J41A 2PYJA 5BMVA 1SQFA 3W7UA 4W4LA 4JGSA 4IIJB 1EN6A 3K57A 1XBLA 5LYJB 4KFMA 2K9PA 4GKJB 4IIJA 1I5YA 2QEXV 4JV5O 3SYOA 1L8DA 1ENVA 1R3KC 2BTQB 1P84F 4K0KB 4JF3A 1F7YA 1FFXA 3OMIB 2ITCC 4DV6B 1K3EA 5B1AB 4LF5O 1XMQO 1HNWO 3RGBA 4X62B 4X1IB 2N04A 3G67A 1KECA 1PNLA 3QVNA 5LHGA 3UQ8A 1O9GA 1OHHG 3CYOA 2JGUA 3UT5B 4P9OA 4UB8Z 4I0XB 4HZ3A 4LNUB 3T4DA 3UT5A 4MT8A 1YCIA 1K73W 1FFTB 3CRCA 2UXDB 4I0XA 4FLWA 3K5LA 1YTFD 4DV1O 5L3BA 4KUMA 2A7WA 1SF9A 3Q4HB 2WSSG 4YIPA 5KLVH 3E86A 1FXKB 4KHPB 1ROPA 4PDRA 3JASB 3RN4A 1V55B 1XNQO 1R3IC 1L1FA 4ZHQA 3R66A 1KC8W 2UUAB 1ZWIC 1LUWA 2LJ2A 4ZOLB 1FD9A 2ZE5A 1TVKA 5H9CA 4MSWC 4BW9A 4GKJO 3FB6C 2UXCO 2XAFA 3O65A 5B66Z 2ZCEA 1NZ6A 1R73A 1NH2B 1VF5B 2F1MA 3OGIB 4K0KO 1NVPD 2OIEA 4JAAA 3CJHB 4LF8O 3T4ZA 4UCTA 3CCSV 1RSOB 5KAFZ 3ETQA 2FMLA 1RSOA 3JD0A 4IYIA 2DE0X 3BFRA 3C90A 1MZFA 1F23A 1BCCH 2Q7EA 1K4DC 3PJSK 4WFHA 3CXHF 4X20A 3ZHSA 2LQTA 3ZRWA 3WG7C 3A0RA 2QKCA 2P06A 4MTFA 3RVZA 1M4UA 1F4NA 1YIJV 2QM7A 1VF6C 4LF6B 1K7DA 2A9HA 3CCRV 4PA4A 1K9MW 1VARA 4X66B 4CS4A 1VQ5V 4TQDA 2AZ2A 1YJWV 1QLEC 1BL8A 5B1OA 3U10A 3OTOO 2QKSA 2VQFB 1YHQV 1HNZB 1XREA 2KB1A 2WPDG 2VWKA 4L87A 4X65O 1Q8IA 3BA9A 4KXRA 4UUJC 3ETGA 4PD4F 2WA3A 3DTUB 4BAYA 4DR1O 4HNAB 2ZDIC 4D7TA 2ILMA 4PA7A 4DUZB 4LC1A 4X88A 4HNAA 3RYCA 2X0LA 4GZRB 4WFAV 2XOKG 2MK3A 2JS3A 5KX5B 2XAGA 2JEUA 3E22B 5BXZA 3RYFB 5KX5A 3WU2Z 1IBMO 1DF5A 2LW7A 2BSKA 3OM3B 4UVAA 5AG2A 3L71H 1TA8A 4U3JB 3CCUV 1A32A 1AVMA 1V54B 2W0XA 4U3JA 1IZ3A 2EIMB 3P3PA 4JYAB 1FXHA 3ASNC 2JGDA 3H9VA 2XTAA 1NI8A 1YVWA 4NYKA 3HKEB 3L9DA 2JK5C 2YIAA 4H44B 1D5AA 4JI2B 4MTXA 4PJ0Z 4BIZA 3JYCA 2QWOB 4ZKIA 3MAQA 2EJRA 3LSSA 3W7WA 2QWPB 1M57C 4I50B 3BCCH 3BABA 3OEHG 4Z1MG 3AK2A 5J2UB 2ZXWB 3H1HH 3SYPA 4DUZO 1EFRG 4BR6A 1VQNV 1UJWB 4CH6A 2E5LO 3AG3C 2A06H 2HEPA 1M5IA 3GVMA 1XEQA 1QCEA 4P9PA 4OGQB 2JRIA 2E76B 1WNSA 2H94A 2Z0AA 1QVFU 3TXSA 3HB3B 3HPLC 5CBGA 3CRRA 1N0NA 1OCZB 4WFFA 2OCHA 3G71V 3TETA 1N32B 4PDLA 2Q67A 3LUTB 1JR9A 4FK5C 4R7CA 3AG2B 1M9NA 1EBOA 2WLIB 3D3IA 4UV9A 2OCCC 4NB5A 4JI7O 4O2BB 1NU1H 1QLNA 2WLIA 1SQPH 4G27B 4BIUA 3CC4V 1BMFG 4JI8O 3HKCB 2B9ZA 2OWOA 2DWEC 4N23A 3HKBB 3IC7A 4J7JA 4DV5O 4PDMA 2ZE7A 1WAZA 2B1GA 5GONA 5LP6B 1RPRA 4J80A 1VEWA 1KYOF 2JEXA 3CMEV 1BT8A 2F66C 3ZBHA 4JYYA 1SESA 1VF6A 2HLDG 1I5XA 4O2AA 4JI1B 2F4VO 4O4IB 2ARHA 3E83A 4UCRA 1XDCA 4P2ZA 2FB5A 5HFLA 2QDOA 4O4IA 2UXNA 1J5EB 4FFBB 1CP9A 3IFXA 1AJQA 4EFBA 1MZEA 3K9AA 3N2KA 3DGEA 4EB6B 2CTRA 4DW1A 1JPXA 4FPPA 5H2FZ 2HVJC 2IH1C 3DC5A 1VQPV 3KDRA 5J9PC 4DV7O 2HVKC 1PM9A 1MSDA 4LWSB 4DRXB 5CN0A 1IJGA 4DRXA 1KP3A 2VRZA 3T2MA 4WFBV 4TT3G 3ZMVA 1OCCB 1RM1B 3BPZA 2V4DA 3ZJZA 2F43G 1THZA 5J2TA 2WLKA 2QA4V 4TQFA 1AR1B 1YEWA 3OE7G 2EULA 2DQ0A 1P49A 3CB2A 2ZIMA 1KQSU 1OV9A 2UU9O 2P5OA 3FB7C 3CCJV 1YTFB 1NKDA 5C8YB 1SETA 5BY1A 1JCHA 4GT1A 3CEIA 5C8YA 1KMIZ 4YJ2B 4ZI7A 5CA1A 2L6LA 1IVSA 2KKWA 4LF9O 3AG1B 4JI5B 1WLEA 1GH6A 3OT7A 2R9IA 5DN6G 5LGTA 4QJFB 2ETNA 2IJJA 1Y74A 1T5EA 3GWOA 2HKOA 1PKXA 2L35A 5B1AC 4B3RO 4O4LB 4O4JB 2FL4A 2YIBA 3P3NA 1K5SA 1QNMA 4K8XA 4DR7B 3IGAC 1COWG 3D3QA 1U96A 2Z5UA 4TV8A 2QWRB 3QNEA 2BOBC 1NVPB 1K34A 4JTCB 1US6A 4DR4B 2AGAA 4JZ2A 2YC0A 5E1AC 4JI3O 5K1XA 1FXKC 3CSXA 1GM8A 2QJ1A 1V55C 2EZOA 2RCVA 1MOFA 1S76D 3OFNG 3O9OA 5B1NA 3ABKB 2Q0OC 2XT9A 4LF7B 4IL6Z 3AG7A 1VQKV 2RNBA 1NR7A 3OR7C 2QKAA 2X6BA 1LUVA 4WFEA 5A9GA 4XBFA 3B09A 3ETEA 1Q82W 4OXSA 2FYUH 3G80A 2PUSA 4FFKA 4CZZA 4NR1A 3K06A 4I55B 1I94O 2AZ0A 1Y6XA 3FFQA 1X4TA 2ZM6B 3VQWA 5CB4B 3ZS8C 4LFBO 4DR4O 2F95B 5CB4A 4LF5B 1FJGO 1WN7A 1HNWB 1ZTEA 4WCEV 4IHJB 3B40A 2NN4A 4UCOA 3CRMA 3I56V 2DQ3A 4DV1B 2JJ2G 1FKAO 3E35A 4LF7O 1JJOA 1D5NA 4HYOA 1XI1A 4FM1A 5LXTA 4B3MO 5KHIA 5IY5B 4FLVA 3QTCA 1F51A 5LGUA 2YI9A 4EEQA 1Q86W 5IDJA 3K5NA 5H6RA 3JSLA 2KQXA 2Q9LA 1SA0B 2DOSA 1LR1A 3CHXA 1VQ8V 2RJZA 2CDYA 2LO1A 1RPOA 3B2EE 4I4TB 2UXCB 5LYJA 4I4TA 1OZ0A 2XAJA 3CRAA 2ZM6O 2OTJV 3J81N 5KMGB 3ZX6A 2BTQA 3BEHA 3W7SA 1F4MA 4LF8B 4CH5A 1KU9A 1B04A 3E89A 1V54C 2GDSA 1DF4A 3OD4A 4TOIA 3KCYA 5JJNB 2PZSA 2EIMC 4X1IA 4MW8A 1K97A 4LNUA 1YDXA 4UB6Z 1AROP 1NTMH 5LL6Y 1JOYA 4E4EA 3Q4HA 3WB0A 3CPWU 2Y0PA 3L75H 3T1HB 3K3WA 2Q68A 1FXKA 2R70A 4F6RB 3JASA 2DMXA 4PI2A 3JAWB 3CCQV 4J11A 3FB5C 4F6RA 2ZXWC 4DW0A 3LSQA 2R9RB 4ZOLA 4K35A 1NQTA 2KG7B 1NTZH 3E8GA 1VMGA 2P22C 3OTOB 4MVRA 3KZIZ 1FS0G 4QE9A 4X65B 1Z5VA 3JD3A 5IE9A 5JCOC 2ZINA 4I9QA 4GX2A 4D6TH 4EKWA 2Q4PA 4DR1B 1NTKH 1GM7A 1OCZC 2E3CA 3CJHA 1S0VA 1AI6A 4R6ZA 2LP7A 2DYSB 2XUMA 2B1IA 3AG2C 1EN5A 4GUNA 3IAYA 3AK3A 3K79A 3RWRD 4Z2WA 3FYIB 1IBMB 4JAVA 3BVOA 4BIOA 5IWAB 4MVOA 2P4KA 4KP4A 1H5WA 3T1HO 1VQ9V 2PTMA 5LP6C 2W0FC 3SYCA 3CC7V 4LP8A 4LFCB 1N0JA 3SGIA 1SQQH 3CX5F 2DJVA 4X89A 4DK1A 3E8BA 1GRJA 1EN4A 1PP9H 5D5PA 4XDJA 1JA8A 2JS5A 2QTSA 2QM8A 4LBEC 4I5SA 1H2GA 2Y48A 3ABUA 5L3GA 5DEDA 1JVMA 4YHHO 2Q8VA 4E2LA 1K4CC 1Q90D 3K0DA 2HG5C 4JI4O 1S5JA 1KBHA 1BQZA 2UUBO 1QQCA 1HNXB 1SKVA 1WPBA 2QR4A 2E5LB 1S72V 3JCUZ 3VQYA 1Y4MA 3JARB 3M7MX 4UCUA 4TSFG 4ZIBA 3ZN1A 2GUZB 4JPRA 2EZPA 2EIKB 2QM4A 1AILA 3JCZA 3K58A 5EYPB 1OCCC 3E22A 5IJ9B 3G6EV 1RM1C 2ZD9A 3RYFA 1NS1A 1N34O 5EYPA 5IWAO 2UUCO 2XNDG 1GO3F 3ZHVA 2QTOA 1SQXH 3SJBC 2OYQA 2PI5A 4FLUA 1JX9A 4LFCO 5EIBD 5IYCO 3LNNA 2NLJC 4YIOA 4JI7B 4LF4B 4HBNA 2DWDC 3HKEA 4JI8B 1VF7A 1Y67A 1IX9A 3STZC 3FD9A 3OEEG 1KKCA 3HKDB 5H6QA 3APQA 3DC6A 3EHBB 3AG1C 4NVPA 5KUKA 3QO8A 4DV5B 3HKDA 3J80N 2GHYA 1XMOO 2VWJA 4GX1A 1ORQC 2A0LA 5FPOA 4I50A 1B6QA 3KKYA 3B4SA 2F4VB 5J2UA 4RUFA 1PNKA 1RP3B 3ZN0A 1HNXO 1R1BA 1JFFB 3E2EA 2N05A 4FZ0A 2ODMA 4MVZA 1JFFA 2D3OW 3ML0A 5EZYB 4J9YB 5LHHA 1ZLZA 3CCVV 3SYQA 3EXAA 1LNQA 5JH7B 4NTXA 4J42A 4FM2A 5JCOA 1G8MA 1R6TA 2W6JG 1R6NA 3K08A 4GX5A 3THOA 3BHPA 4Z1VA 1QBZA 4DV7B 4J10A 4JASA 2H8PC 5LOVB 1R6KA 2P7TC 2IW5A 1FXVA 2Q6AA 1H2SB 2O57A 3DSQA 4LF4O 1AJPA
chains in the Genus database with same CATH topology
3C3TA 3BFRA 1XDCA 3MDSA 1EN6A 3TJTA 1BSMA 1D5NA 4JZ2A 4F6EA 1IXBA 1I0HA 4X9QA 2QKCA 1WB8A 2RCVA 1GN4A 3DC5A 3KDRA 1AR5A 3AK2A 4YIOA 1EN5A 1PM9A 4GUNA 1MSDA 2ADPA 3AK3A 3QVNA 2CDYA 4BR6A 1VARA 1Y67A 1AP6A 1IX9A 1KKCA 3DC6A 1PL4A 4C7UA 1B06A 1XUQA 2CE4A 1GN2A 2QKAA 2ADQB 1ZUQA 3AK1A 1GN6A 1LUVA 1MMMA 2P4KA 5A9GA 1XREA 4YIPA 3EVKA 3KKYA 2GDSA 1EM1A 1N0NA 1MNGA 3RN4A 1AR4A 1BS3A 1N0JA 1JR9A 1LUWA 4FFKA 3CEIA 1AP5A 1EN4A 1SZXA 4JZGA 1ZLZA 1JA8A 1IDSA 1GN3A 2AW9A 3IC9A 1MA1A 4E4EA 3OT7A 1I08A 5AG2A 1ZTEA 1ZSPA 3K9SA 3LSUA 1WB7A 1AVMA 1P7GA 3C3SA 1VEWA 1BT8A 1QNMA 1XILA 4JYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C3T A;  3BFR A;  1XDC A;  3MDS A;  1EN6 A;  3TJT A;  1BSM A;  1D5N A;  4JZ2 A;  4F6E A;  1IXB A;  1I0H A;  4X9Q A;  2QKC A;  1WB8 A;  2RCV A;  1GN4 A;  3DC5 A;  1AR5 A;  3AK2 A;  4YIO A;  1EN5 A;  1PM9 A;  4GUN A;  1MSD A;  2ADP A;  3AK3 A;  3QVN A;  2CDY A;  4BR6 A;  1VAR A;  1Y67 A;  1AP6 A;  1IX9 A;  1KKC A;  3DC6 A;  1PL4 A;  4C7U A;  1B06 A;  1XUQ A;  2CE4 A;  1GN2 A;  2QKA A;  2ADQ B;  1ZUQ A;  3AK1 A;  1GN6 A;  1LUV A;  1MMM A;  2P4K A;  5A9G A;  1XRE A;  4YIP A;  3EVK A;  3KKY A;  2GDS A;  1EM1 A;  1N0N A;  1MNG A;  3RN4 A;  1AR4 A;  1BS3 A;  1N0J A;  1JR9 A;  1LUW A;  4FFK A;  3CEI A;  1AP5 A;  1EN4 A;  1SZX A;  4JZG A;  1ZLZ A;  1JA8 A;  1IDS A;  1GN3 A;  2AW9 A;  3IC9 A;  1MA1 A;  4E4E A;  3OT7 A;  1I08 A;  5AG2 A;  1ZTE A;  1ZSP A;  3K9S A;  3LSU A;  1WB7 A;  1AVM A;  1P7G A;  3C3S A;  1VEW A;  1BT8 A;  1QNM A;  1XIL A;  4JYY A; 
#chains in the Genus database with same CATH topology
 3ABK C;  5C93 A;  3OAA G;  1AJN A;  1DTO A;  1TUB B;  4O2B A;  5IYB O;  4RAI A;  4ZBM A;  4O4H B;  4W4K A;  3HKC A;  3P32 A;  3ABM C;  4YXW G;  2K1E A;  3HKB A;  2BOC C;  1KKD A;  2GTA A;  3ZRX A;  1Q43 A;  4FVM A;  2P90 A;  5FPR A;  4FLT A;  5GTH Z;  1YSC A;  2UU9 B;  4YY3 O;  4YJ3 B;  5LP6 A;  3G6B A;  1DGS A;  4DR5 O;  1L0L H;  5EC2 C;  3CS5 A;  2CTW A;  4LF9 B;  1K92 A;  2ZNJ A;  5LMU O;  1TUE B;  2BTO A;  2IJK A;  2M6Y A;  2F93 B;  4FFB A;  4N21 A;  2ZE8 A;  2GSM B;  5EBM C;  1Q3E A;  3S3X A;  3K5O A;  1Q6U A;  4B3R B;  3ICX A;  5IYZ B;  4UCS A;  3ZIA G;  2X6A A;  5IT9 N;  2DN9 A;  4EB6 A;  3F7Y C;  3F5T A;  5JQG B;  5IYZ A;  3EVK A;  1IXM A;  2QE7 G;  5JQG A;  1L0N H;  4DV3 O;  4J7Z A;  4XDL A;  4UV8 A;  4LWS A;  3A0H Z;  2OT5 A;  1WP7 A;  2Y4T A;  3W7T A;  3NXS A;  3CRQ A;  4CH3 A;  5JVD B;  3ZMZ A;  4DYL A;  4FZ1 A;  1AP5 A;  5CMU A;  4PDV A;  4AQY O;  2ITD C;  1IBK O;  2Q7H A;  3OMA B;  4JI3 B;  5IY5 C;  2WA4 A;  3ZED A;  3OUS A;  1GMG A;  3CWB H;  1B3Q A;  3K9S A;  1Q5O A;  3SJA C;  3KG2 A;  2IM9 A;  2ZIO A;  2WAM A;  3CCL V;  2ZR2 A;  3E8H A;  2G38 A;  3H01 A;  5EC1 C;  4ICG A;  1QU7 A;  2QWQ B;  2R72 A;  3N2G B;  4PA9 A;  4GKK B;  4DV4 O;  2CGO A;  4I9W A;  3E8F A;  4YJ2 A;  3N2G A;  3SPG A;  5B5E Z;  4UVB A;  3I55 V;  3QO7 A;  2PYL A;  1N8R W;  1TAE A;  3CP1 A;  3T1C A;  1VQL V;  1OCR B;  4JI6 B;  3WB1 A;  1I7F A;  4X9Q A;  4O4L A;  4O4J A;  2E75 B;  1M90 W;  2Q69 A;  3STL C;  1WB8 A;  4K8Z A;  2YIC A;  1AR5 A;  1I94 B;  5K1P A;  4F4L A;  1JMK C;  1M1K W;  4TUY B;  4NKG B;  2YEV B;  1HR0 B;  3KCX A;  5BR8 O;  1URF A;  4CH4 A;  4TUY A;  1GM9 A;  3L73 H;  4LFB B;  4PI0 A;  2YEV A;  1BE3 H;  4LR3 A;  3UKM A;  1YXB A;  2JVD A;  1HWY A;  1FJG B;  3FAV B;  5DM6 V;  4NTY A;  3TGU H;  2ADQ B;  3CCM V;  5KHJ A;  3AK1 A;  3FAV A;  1VP7 A;  1GN6 A;  1VQO V;  2RDC A;  4LH6 A;  3N27 A;  3OMN B;  2CTP A;  5CBF A;  1TGO A;  2EIN B;  2A3Q A;  3GWK C;  1M56 B;  4X1K B;  2NNU A;  2WWW A;  5KA6 A;  4R8C A;  4IGG A;  4JAU A;  2ZQM A;  4GX0 A;  4GKK O;  4WBN B;  3U11 A;  3ABM B;  4B3M B;  2DYR B;  2ZT9 B;  3FKS G;  3L72 H;  2KSD A;  3K03 A;  3BA8 A;  2W6I G;  4X8A A;  1OCO B;  4BW5 A;  4MVM A;  3K5M A;  4JI6 O;  4UXN A;  2UXB O;  4UVC A;  3QF7 A;  1PD3 A;  3X2Q B;  2Y0I A;  1Z5W A;  2Y4U A;  1ZSP A;  4D7S A;  2DYS C;  1VQM V;  3IJ4 A;  5H5N A;  4RWU A;  3RYI B;  4I55 A;  4PA6 A;  1PPJ H;  1HR0 O;  3VQX A;  2DW4 A;  3RYI A;  1EZJ A;  2AXT Z;  1Q81 W;  3TJT A;  4L8J A;  1D2D A;  1IUR A;  2YS8 A;  2A79 B;  4B7E A;  3JAK B;  1SQV H;  3T1Y B;  2EIL B;  4NXM O;  1NR1 A;  4A5U B;  5LMN B;  4DR2 O;  4B3T O;  3JAK A;  5LHI A;  3ZMT A;  2JJ1 G;  4IHJ A;  5JJE B;  4JYB A;  1BGY H;  5CA0 B;  4B08 A;  4DUY O;  1DK1 A;  4JTD B;  2Q7G A;  4FJC C;  3ZHR A;  1QR9 A;  1BHA A;  4H0L B;  3ZHU A;  4QNH B;  1R3L C;  3RT3 C;  1K5Q A;  1BQ0 A;  1YJ9 V;  2X6C A;  4C7U A;  1B06 A;  2BE3 A;  3TCU A;  1RFY A;  1XL6 A;  1MSW D;  1WP8 A;  1FAF A;  1E1R G;  1N4C A;  4B7K A;  1AR4 A;  3TK1 A;  1SA0 A;  3VOU A;  4MVS A;  5DEC A;  2EIJ B;  5EK0 A;  3ZRV A;  2PGG A;  2HHH O;  2CK3 G;  2RQ6 A;  1H38 A;  3RYH B;  5A2Q N;  3UO2 A;  4U7N A;  2EIK C;  3BAA A;  5BMV B;  2IJI A;  3CC2 V;  4DR6 O;  3RYH A;  1DLB A;  1JJ2 U;  3ABL B;  4GYC B;  1GN3 A;  5KMG A;  2AW9 A;  2CH7 B;  3T1Y O;  5LMN O;  1N36 O;  1IBL O;  5IJ0 B;  2CH7 A;  1S5H C;  3M8A A;  2ZR3 A;  1I08 A;  3M99 B;  5IJ0 A;  3JD2 A;  1FFX B;  4DR3 O;  2XAQ A;  3K04 A;  4JTA B;  3JAL B;  2CTQ A;  2UXX A;  4I7Z B;  4X64 B;  3JAL A;  1HW7 A;  1AI5 A;  2YXY A;  1KUQ A;  2Q73 A;  4MTO A;  5B1B B;  3F7V C;  3L74 H;  1P7B A;  1MAB G;  1GK9 A;  4DV2 O;  4QPK A;  4MVU A;  5B3S B;  1SRY A;  1XOU A;  5KUM A;  3ASO B;  4IYH A;  2AHY A;  4MVQ A;  4BWA A;  2WLN A;  3JAW A;  4Q6G A;  1H8E G;  3LDC A;  3OR6 C;  5KAI Z;  3CCE V;  4ZHQ B;  2XAS A;  2ADP A;  1AI4 A;  3SDL A;  5BZB A;  2KG7 A;  3RFR A;  2Y69 B;  1VQ6 V;  1G4Y B;  2YIB D;  4YHH B;  1YF2 A;  3J7A U;  1TVK B;  1E1Q G;  3RBZ A;  1FPO A;  2ATK C;  4JI4 B;  4DK0 A;  4RO2 A;  1H2L A;  3UCS C;  2UUB B;  3AG4 B;  1K33 A;  4JI0 B;  2ZE6 A;  1MNG A;  1K8A W;  3P30 A;  1SQB H;  2N74 A;  4U3F H;  4X64 O;  2VS0 A;  4DV6 O;  3SPH A;  1SZT A;  3S3W A;  4GLX A;  3I5D A;  4X62 O;  1N34 B;  1SZX A;  4JZG A;  2UUC B;  3QG5 A;  4FLZ A;  3PN1 A;  3VQV A;  3FX7 A;  2YI8 A;  4X20 B;  4MW3 A;  1FOU A;  3B8M A;  2UXD O;  4PEL A;  3ZRW B;  1H8H G;  1Q6H A;  2PF4 E;  3L70 H;  1WB7 A;  3MHH C;  3C3S A;  4PA3 A;  4B3S B;  5GW7 A;  5JWP A;  5KA5 A;  5LBQ A;  3ZMS A;  4MTG A;  1S5L Z;  4KHP O;  3B77 A;  4FLY A;  3A2F A;  3ZHT A;  3NR7 A;  2UUA O;  4DXW A;  2WLM A;  4MS2 A;  1XMO B;  1SS3 A;  3MHS C;  3OGC C;  4H13 B;  4LCU C;  4NTW A;  4TV9 B;  1IXB A;  1XHX A;  2B5U A;  4TV9 A;  3WB2 A;  4CC5 A;  5KHG A;  4JI0 O;  3H1K H;  4H37 A;  3JD1 A;  1G1X B;  1GN4 A;  2C2A A;  2IH3 C;  1YI2 V;  4PV1 B;  1YIT V;  4NXN B;  1WJZ A;  2H3O A;  2EJ7 A;  3JAR A;  3OTF A;  3OW2 U;  1SER A;  4JYC A;  2GUZ A;  3RYC B;  1H2M A;  1PL4 A;  1Y66 A;  5IJ9 A;  5FLX N;  4FM0 A;  1AI7 A;  4H33 A;  5F2V O;  1PL0 A;  5L3F A;  1CEZ A;  1MMM A;  1ZX3 A;  4FLX A;  2BSK B;  5FNV B;  5HFM A;  1Y76 B;  3SPJ A;  5FNV A;  4KL1 A;  4UFZ A;  1V9P A;  4B3S O;  1Y76 A;  5L3D A;  5LGN A;  2V1D A;  5KHK A;  2JGD B;  3ZRS A;  2HJD A;  4LF6 O;  3LDE A;  1XL4 A;  4QIW F;  4X66 O;  4YY3 B;  3IC9 A;  4CC6 A;  1OCR C;  2LFS A;  4DR5 B;  3A0B Z;  2VQF O;  2FTK A;  2VQE B;  1HNZ O;  1SQG A;  2ZNI A;  5LMU B;  1XIL A;  1Q6I A;  2CUG A;  4FIP C;  4NXN O;  1SC5 B;  4GCZ A;  3C3T A;  5CA3 A;  1QHT A;  5EZY A;  5GTI Z;  3D36 C;  1OJH A;  4OX9 B;  5KHH A;  3QO5 A;  4HAM A;  1NBM G;  5JH7 A;  1HP8 A;  2GTS A;  4RUE A;  4Q20 A;  2YUA A;  4DV3 B;  2EIN C;  5LOV A;  2JDI G;  5EBW C;  1M56 C;  1XNR B;  2PI4 A;  1BHB A;  4XDK A;  2PY5 A;  1WPX A;  3BY6 A;  4EFE A;  4WFG A;  3SR2 C;  4AQY B;  1XQ8 A;  1TUB A;  1IBK B;  1KD1 W;  3K59 A;  2DYR C;  4O4H A;  4JYA O;  1UPG A;  4QPJ A;  2WLJ A;  1OCO C;  5L3C A;  2QGN A;  3H1I H;  2RMK B;  1O9H A;  3SJQ C;  1EZV H;  3X2Q C;  2WLH A;  4JI2 O;  1KP2 A;  4YJ3 A;  3WG7 B;  1H2N A;  4DO2 A;  3FB8 C;  4U7O A;  1EM1 A;  3EFF K;  3HR0 A;  3D8C A;  5GON B;  2VQE O;  1S77 D;  1U97 A;  4DV4 B;  3TXQ A;  1Q7Y W;  2JIZ G;  1NH2 D;  4K3A A;  4O2A B;  1E79 G;  3JAT B;  4OX9 O;  2IU0 A;  2HFE C;  3JAT A;  2EIL C;  1QLE B;  1YJN V;  4CBC A;  2P6J A;  2YDE A;  4LFA B;  4G2K A;  2WLL B;  1ZL8 B;  3N2K B;  3H1J H;  5JJJ B;  3LSU A;  2WLL A;  1ZL8 A;  1XNR O;  1W0K G;  5BR8 B;  2EX3 A;  2LGW A;  3SPC A;  1YZB A;  2FKX A;  5JVD A;  1M93 A;  1N32 O;  2ZDI A;  2YID A;  4CS2 A;  1BSM A;  1PV0 A;  2YSU B;  5EIB C;  4AIL C;  2OIG A;  2Z3Y A;  1MG1 A;  4AHC A;  3AEI A;  1W2B U;  1JQ0 A;  4RQE A;  5J2T B;  2IJH A;  1HDJ A;  4QGP A;  3UO3 A;  2GBO A;  1WA8 B;  3ABT A;  4CS3 A;  3ZMU A;  3CE2 A;  4WF9 V;  2EIJ C;  1WA8 A;  1Z2G A;  3UM7 A;  1VQ4 V;  3ASN B;  4OPH A;  5IYD O;  3ZHQ A;  3W7X A;  2QWN B;  4R50 A;  3ABL C;  4ZI7 B;  3WFV A;  5CA1 B;  4JI1 O;  4IT5 A;  2UXB B;  2CE4 A;  1GN2 A;  4QE7 A;  3ZCC A;  5ITZ B;  3SPI A;  1J5E O;  4LFA O;  2V7Q G;  3CMA V;  5ITZ A;  2HP8 A;  4UCV A;  1Y74 B;  2YXH A;  3VBB A;  1VQ7 V;  3RVY A;  1X59 A;  1M57 B;  1FYJ A;  1GAX A;  4J9Z B;  5B1B C;  2OTL V;  2HJF C;  3D36 A;  4TV8 B;  3JSN A;  3SJC C;  4AI8 A;  4NXM B;  4LH7 A;  1N33 B;  4DR2 B;  4B3T B;  3AG3 B;  5B3S C;  3A8T A;  3G4S V;  2P67 A;  1W0J G;  3ASO C;  1MA1 A;  2X7R B;  3JAM N;  3GB7 C;  3LDD A;  4DUY B;  2ZKO A;  5D5Q A;  1P7G A;  4FMT A;  3FYE B;  4ASU G;  4X1K A;  3MD0 A;  1XHZ A;  4J7K A;  5EBL C;  2Y69 C;  2R9A A;  4WBN A;  3DXR B;  3MDS A;  1CPY A;  2OCC B;  1J95 A;  3DXR A;  1G6U A;  4OPA A;  4X1Y B;  1NJI W;  4X1Y A;  2MW2 B;  2E74 B;  5CBH A;  1AB3 A;  4F6E A;  3AG4 C;  1PNM A;  4JI5 O;  2D2C B;  1I0H A;  2XHB A;  4DV0 B;  3F5W C;  2HHH B;  2GV9 A;  2M7W A;  2XAH A;  1QR8 A;  2NR5 A;  3U0Z A;  1VIB A;  4DR6 B;  2Q0A A;  3JD4 A;  4G28 B;  2BCC H;  3B8N A;  3K0G A;  1AP6 A;  2AHZ A;  2IU3 A;  2HR3 A;  1JNB A;  4DR7 O;  3CD6 V;  2EBO A;  1N36 B;  1IBL B;  1N33 O;  3OUF A;  2F23 A;  3H1L H;  3CXC U;  2CAZ C;  4JV5 B;  1CXZ B;  1XUQ A;  5LA6 B;  1GTO A;  3ETD A;  5E79 Z;  1ZUQ A;  3LNM B;  4DR3 B;  5LA6 A;  2LW1 A;  1UFI A;  5L3E A;  2YXL A;  1QVG U;  2LGQ A;  5CA0 A;  1H2K A;  1XMQ B;  1KB9 F;  1GKF A;  2P4V A;  1BS3 A;  4DV2 B;  2RN9 A;  1NT2 B;  2IBZ H;  2LFR A;  1P4R A;  5TIS Z;  4RQF A;  5FL7 G;  1IDS A;  2CGN A;  1W59 A;  4P30 A;  3SYA A;  5LXT B;  4PHZ A;  4ABM A;  1R3J C;  2QSA A;  1S3J A;  3RW0 A;  4TWK A;  4DV0 O;  1XNQ B;  3APO A;  3R65 A;  1ZAU A;  2Q5Z A;  1BZK A;  3BRC A;  4J41 A;  2PYJ A;  5BMV A;  1SQF A;  3W7U A;  4W4L A;  4JGS A;  4IIJ B;  1EN6 A;  3K57 A;  1XBL A;  5LYJ B;  4KFM A;  2K9P A;  4GKJ B;  4IIJ A;  1I5Y A;  2QEX V;  4JV5 O;  3SYO A;  1L8D A;  1ENV A;  1R3K C;  2BTQ B;  1P84 F;  4K0K B;  4JF3 A;  1F7Y A;  1FFX A;  3OMI B;  2ITC C;  4DV6 B;  1K3E A;  5B1A B;  4LF5 O;  1XMQ O;  1HNW O;  3RGB A;  4X62 B;  4X1I B;  2N04 A;  3G67 A;  1KEC A;  1PNL A;  3QVN A;  5LHG A;  3UQ8 A;  1O9G A;  1OHH G;  3CYO A;  2JGU A;  3UT5 B;  4P9O A;  4UB8 Z;  4I0X B;  4HZ3 A;  4LNU B;  3T4D A;  3UT5 A;  4MT8 A;  1YCI A;  1K73 W;  1FFT B;  3CRC A;  2UXD B;  4I0X A;  4FLW A;  3K5L A;  1YTF D;  4DV1 O;  5L3B A;  4KUM A;  2A7W A;  1SF9 A;  3Q4H B;  2WSS G;  4YIP A;  5KLV H;  3E86 A;  1FXK B;  4KHP B;  1ROP A;  4PDR A;  3JAS B;  3RN4 A;  1V55 B;  1XNQ O;  1R3I C;  1L1F A;  4ZHQ A;  3R66 A;  1KC8 W;  2UUA B;  1ZWI C;  1LUW A;  2LJ2 A;  4ZOL B;  1FD9 A;  2ZE5 A;  1TVK A;  5H9C A;  4MSW C;  4BW9 A;  4GKJ O;  3FB6 C;  2UXC O;  2XAF A;  3O65 A;  5B66 Z;  2ZCE A;  1NZ6 A;  1R73 A;  1NH2 B;  1VF5 B;  2F1M A;  3OGI B;  4K0K O;  1NVP D;  2OIE A;  4JAA A;  3CJH B;  4LF8 O;  3T4Z A;  4UCT A;  3CCS V;  1RSO B;  5KAF Z;  3ETQ A;  2FML A;  1RSO A;  3JD0 A;  4IYI A;  2DE0 X;  3BFR A;  3C90 A;  1MZF A;  1F23 A;  1BCC H;  2Q7E A;  1K4D C;  3PJS K;  4WFH A;  3CXH F;  4X20 A;  3ZHS A;  2LQT A;  3ZRW A;  3WG7 C;  3A0R A;  2QKC A;  2P06 A;  4MTF A;  3RVZ A;  1M4U A;  1F4N A;  1YIJ V;  2QM7 A;  1VF6 C;  4LF6 B;  1K7D A;  2A9H A;  3CCR V;  4PA4 A;  1K9M W;  1VAR A;  4X66 B;  4CS4 A;  1VQ5 V;  4TQD A;  2AZ2 A;  1YJW V;  1QLE C;  1BL8 A;  5B1O A;  3U10 A;  3OTO O;  2QKS A;  2VQF B;  1YHQ V;  1HNZ B;  1XRE A;  2KB1 A;  2WPD G;  2VWK A;  4L87 A;  4X65 O;  1Q8I A;  3BA9 A;  4KXR A;  4UUJ C;  3ETG A;  4PD4 F;  2WA3 A;  3DTU B;  4BAY A;  4DR1 O;  4HNA B;  2ZDI C;  4D7T A;  2ILM A;  4PA7 A;  4DUZ B;  4LC1 A;  4X88 A;  4HNA A;  3RYC A;  2X0L A;  4GZR B;  4WFA V;  2XOK G;  2MK3 A;  2JS3 A;  5KX5 B;  2XAG A;  2JEU A;  3E22 B;  5BXZ A;  3RYF B;  5KX5 A;  3WU2 Z;  1IBM O;  1DF5 A;  2LW7 A;  2BSK A;  3OM3 B;  4UVA A;  5AG2 A;  3L71 H;  1TA8 A;  4U3J B;  3CCU V;  1A32 A;  1AVM A;  1V54 B;  2W0X A;  4U3J A;  1IZ3 A;  2EIM B;  3P3P A;  4JYA B;  1FXH A;  3ASN C;  2JGD A;  3H9V A;  2XTA A;  1NI8 A;  1YVW A;  4NYK A;  3HKE B;  3L9D A;  2JK5 C;  2YIA A;  4H44 B;  1D5A A;  4JI2 B;  4MTX A;  4PJ0 Z;  4BIZ A;  3JYC A;  2QWO B;  4ZKI A;  3MAQ A;  2EJR A;  3LSS A;  3W7W A;  2QWP B;  1M57 C;  4I50 B;  3BCC H;  3BAB A;  3OEH G;  4Z1M G;  3AK2 A;  5J2U B;  2ZXW B;  3H1H H;  3SYP A;  4DUZ O;  1EFR G;  4BR6 A;  1VQN V;  1UJW B;  4CH6 A;  2E5L O;  3AG3 C;  2A06 H;  2HEP A;  1M5I A;  3GVM A;  1XEQ A;  1QCE A;  4P9P A;  4OGQ B;  2JRI A;  2E76 B;  1WNS A;  2H94 A;  2Z0A A;  1QVF U;  3TXS A;  3HB3 B;  3HPL C;  5CBG A;  3CRR A;  1N0N A;  1OCZ B;  4WFF A;  2OCH A;  3G71 V;  3TET A;  1N32 B;  4PDL A;  2Q67 A;  3LUT B;  1JR9 A;  4FK5 C;  4R7C A;  3AG2 B;  1M9N A;  1EBO A;  2WLI B;  3D3I A;  4UV9 A;  2OCC C;  4NB5 A;  4JI7 O;  4O2B B;  1NU1 H;  1QLN A;  2WLI A;  1SQP H;  4G27 B;  4BIU A;  3CC4 V;  1BMF G;  4JI8 O;  3HKC B;  2B9Z A;  2OWO A;  2DWE C;  4N23 A;  3HKB B;  3IC7 A;  4J7J A;  4DV5 O;  4PDM A;  2ZE7 A;  1WAZ A;  2B1G A;  5GON A;  5LP6 B;  1RPR A;  4J80 A;  1VEW A;  1KYO F;  2JEX A;  3CME V;  1BT8 A;  2F66 C;  3ZBH A;  4JYY A;  1SES A;  1VF6 A;  2HLD G;  1I5X A;  4O2A A;  4JI1 B;  2F4V O;  4O4I B;  2ARH A;  3E83 A;  4UCR A;  1XDC A;  4P2Z A;  2FB5 A;  5HFL A;  2QDO A;  4O4I A;  2UXN A;  1J5E B;  4FFB B;  1CP9 A;  3IFX A;  1AJQ A;  4EFB A;  1MZE A;  3K9A A;  3N2K A;  3DGE A;  4EB6 B;  2CTR A;  4DW1 A;  1JPX A;  4FPP A;  5H2F Z;  2HVJ C;  2IH1 C;  3DC5 A;  1VQP V;  3KDR A;  5J9P C;  4DV7 O;  2HVK C;  1PM9 A;  1MSD A;  4LWS B;  4DRX B;  5CN0 A;  1IJG A;  4DRX A;  1KP3 A;  2VRZ A;  3T2M A;  4WFB V;  4TT3 G;  3ZMV A;  1OCC B;  1RM1 B;  3BPZ A;  2V4D A;  3ZJZ A;  2F43 G;  1THZ A;  5J2T A;  2WLK A;  2QA4 V;  4TQF A;  1AR1 B;  1YEW A;  3OE7 G;  2EUL A;  2DQ0 A;  1P49 A;  3CB2 A;  2ZIM A;  1KQS U;  1OV9 A;  2UU9 O;  2P5O A;  3FB7 C;  3CCJ V;  1YTF B;  1NKD A;  5C8Y B;  1SET A;  5BY1 A;  1JCH A;  4GT1 A;  3CEI A;  5C8Y A;  1KMI Z;  4YJ2 B;  4ZI7 A;  5CA1 A;  2L6L A;  1IVS A;  2KKW A;  4LF9 O;  3AG1 B;  4JI5 B;  1WLE A;  1GH6 A;  3OT7 A;  2R9I A;  5DN6 G;  5LGT A;  4QJF B;  2ETN A;  2IJJ A;  1Y74 A;  1T5E A;  3GWO A;  2HKO A;  1PKX A;  2L35 A;  5B1A C;  4B3R O;  4O4L B;  4O4J B;  2FL4 A;  2YIB A;  3P3N A;  1K5S A;  1QNM A;  4K8X A;  4DR7 B;  3IGA C;  1COW G;  3D3Q A;  1U96 A;  2Z5U A;  4TV8 A;  2QWR B;  3QNE A;  2BOB C;  1NVP B;  1K34 A;  4JTC B;  1US6 A;  4DR4 B;  2AGA A;  4JZ2 A;  2YC0 A;  5E1A C;  4JI3 O;  5K1X A;  1FXK C;  3CSX A;  1GM8 A;  2QJ1 A;  1V55 C;  2EZO A;  2RCV A;  1MOF A;  1S76 D;  3OFN G;  3O9O A;  5B1N A;  3ABK B;  2Q0O C;  2XT9 A;  4LF7 B;  4IL6 Z;  3AG7 A;  1VQK V;  2RNB A;  1NR7 A;  3OR7 C;  2QKA A;  2X6B A;  1LUV A;  4WFE A;  5A9G A;  4XBF A;  3B09 A;  3ETE A;  1Q82 W;  4OXS A;  2FYU H;  3G80 A;  2PUS A;  4FFK A;  4CZZ A;  4NR1 A;  3K06 A;  4I55 B;  1I94 O;  2AZ0 A;  1Y6X A;  3FFQ A;  1X4T A;  2ZM6 B;  3VQW A;  5CB4 B;  3ZS8 C;  4LFB O;  4DR4 O;  2F95 B;  5CB4 A;  4LF5 B;  1FJG O;  1WN7 A;  1HNW B;  1ZTE A;  4WCE V;  4IHJ B;  3B40 A;  2NN4 A;  4UCO A;  3CRM A;  3I56 V;  2DQ3 A;  4DV1 B;  2JJ2 G;  1FKA O;  3E35 A;  4LF7 O;  1JJO A;  1D5N A;  4HYO A;  1XI1 A;  4FM1 A;  5LXT A;  4B3M O;  5KHI A;  5IY5 B;  4FLV A;  3QTC A;  1F51 A;  5LGU A;  2YI9 A;  4EEQ A;  1Q86 W;  5IDJ A;  3K5N A;  5H6R A;  3JSL A;  2KQX A;  2Q9L A;  1SA0 B;  2DOS A;  1LR1 A;  3CHX A;  1VQ8 V;  2RJZ A;  2CDY A;  2LO1 A;  1RPO A;  3B2E E;  4I4T B;  2UXC B;  5LYJ A;  4I4T A;  1OZ0 A;  2XAJ A;  3CRA A;  2ZM6 O;  2OTJ V;  3J81 N;  5KMG B;  3ZX6 A;  2BTQ A;  3BEH A;  3W7S A;  1F4M A;  4LF8 B;  4CH5 A;  1KU9 A;  1B04 A;  3E89 A;  1V54 C;  2GDS A;  1DF4 A;  3OD4 A;  4TOI A;  3KCY A;  5JJN B;  2PZS A;  2EIM C;  4X1I A;  4MW8 A;  1K97 A;  4LNU A;  1YDX A;  4UB6 Z;  1ARO P;  1NTM H;  5LL6 Y;  1JOY A;  4E4E A;  3Q4H A;  3WB0 A;  3CPW U;  2Y0P A;  3L75 H;  3T1H B;  3K3W A;  2Q68 A;  1FXK A;  2R70 A;  4F6R B;  3JAS A;  2DMX A;  4PI2 A;  3JAW B;  3CCQ V;  4J11 A;  3FB5 C;  4F6R A;  2ZXW C;  4DW0 A;  3LSQ A;  2R9R B;  4ZOL A;  4K35 A;  1NQT A;  2KG7 B;  1NTZ H;  3E8G A;  1VMG A;  2P22 C;  3OTO B;  4MVR A;  3KZI Z;  1FS0 G;  4QE9 A;  4X65 B;  1Z5V A;  3JD3 A;  5IE9 A;  5JCO C;  2ZIN A;  4I9Q A;  4GX2 A;  4D6T H;  4EKW A;  2Q4P A;  4DR1 B;  1NTK H;  1GM7 A;  1OCZ C;  2E3C A;  3CJH A;  1S0V A;  1AI6 A;  4R6Z A;  2LP7 A;  2DYS B;  2XUM A;  2B1I A;  3AG2 C;  1EN5 A;  4GUN A;  3IAY A;  3AK3 A;  3K79 A;  3RWR D;  4Z2W A;  3FYI B;  1IBM B;  4JAV A;  3BVO A;  4BIO A;  5IWA B;  4MVO A;  2P4K A;  4KP4 A;  1H5W A;  3T1H O;  1VQ9 V;  2PTM A;  5LP6 C;  2W0F C;  3SYC A;  3CC7 V;  4LP8 A;  4LFC B;  1N0J A;  3SGI A;  1SQQ H;  3CX5 F;  2DJV A;  4X89 A;  4DK1 A;  3E8B A;  1GRJ A;  1EN4 A;  1PP9 H;  5D5P A;  4XDJ A;  1JA8 A;  2JS5 A;  2QTS A;  2QM8 A;  4LBE C;  4I5S A;  1H2G A;  2Y48 A;  3ABU A;  5L3G A;  5DED A;  1JVM A;  4YHH O;  2Q8V A;  4E2L A;  1K4C C;  1Q90 D;  3K0D A;  2HG5 C;  4JI4 O;  1S5J A;  1KBH A;  1BQZ A;  2UUB O;  1QQC A;  1HNX B;  1SKV A;  1WPB A;  2QR4 A;  2E5L B;  1S72 V;  3JCU Z;  3VQY A;  1Y4M A;  3JAR B;  3M7M X;  4UCU A;  4TSF G;  4ZIB A;  3ZN1 A;  2GUZ B;  4JPR A;  2EZP A;  2EIK B;  2QM4 A;  1AIL A;  3JCZ A;  3K58 A;  5EYP B;  1OCC C;  3E22 A;  5IJ9 B;  3G6E V;  1RM1 C;  2ZD9 A;  3RYF A;  1NS1 A;  1N34 O;  5EYP A;  5IWA O;  2UUC O;  2XND G;  1GO3 F;  3ZHV A;  2QTO A;  1SQX H;  3SJB C;  2OYQ A;  2PI5 A;  4FLU A;  1JX9 A;  4LFC O;  5EIB D;  5IYC O;  3LNN A;  2NLJ C;  4YIO A;  4JI7 B;  4LF4 B;  4HBN A;  2DWD C;  3HKE A;  4JI8 B;  1VF7 A;  1Y67 A;  1IX9 A;  3STZ C;  3FD9 A;  3OEE G;  1KKC A;  3HKD B;  5H6Q A;  3APQ A;  3DC6 A;  3EHB B;  3AG1 C;  4NVP A;  5KUK A;  3QO8 A;  4DV5 B;  3HKD A;  3J80 N;  2GHY A;  1XMO O;  2VWJ A;  4GX1 A;  1ORQ C;  2A0L A;  5FPO A;  4I50 A;  1B6Q A;  3KKY A;  3B4S A;  2F4V B;  5J2U A;  4RUF A;  1PNK A;  1RP3 B;  3ZN0 A;  1HNX O;  1R1B A;  1JFF B;  3E2E A;  2N05 A;  4FZ0 A;  2ODM A;  4MVZ A;  1JFF A;  2D3O W;  3ML0 A;  5EZY B;  4J9Y B;  5LHH A;  1ZLZ A;  3CCV V;  3SYQ A;  3EXA A;  1LNQ A;  5JH7 B;  4NTX A;  4J42 A;  4FM2 A;  5JCO A;  1G8M A;  1R6T A;  2W6J G;  1R6N A;  3K08 A;  4GX5 A;  3THO A;  3BHP A;  4Z1V A;  1QBZ A;  4DV7 B;  4J10 A;  4JAS A;  2H8P C;  5LOV B;  1R6K A;  2P7T C;  2IW5 A;  1FXV A;  2Q6A A;  1H2S B;  2O57 A;  3DSQ A;  4LF4 O;  1AJP A; 
#chains in the Genus database with same CATH homology
 3C3T A;  3BFR A;  1XDC A;  3MDS A;  1EN6 A;  3TJT A;  1BSM A;  1D5N A;  4JZ2 A;  4F6E A;  1IXB A;  1I0H A;  4X9Q A;  2QKC A;  1WB8 A;  2RCV A;  1GN4 A;  3DC5 A;  3KDR A;  1AR5 A;  3AK2 A;  4YIO A;  1EN5 A;  1PM9 A;  4GUN A;  1MSD A;  2ADP A;  3AK3 A;  3QVN A;  2CDY A;  4BR6 A;  1VAR A;  1Y67 A;  1AP6 A;  1IX9 A;  1KKC A;  3DC6 A;  1PL4 A;  4C7U A;  1B06 A;  1XUQ A;  2CE4 A;  1GN2 A;  2QKA A;  2ADQ B;  1ZUQ A;  3AK1 A;  1GN6 A;  1LUV A;  1MMM A;  2P4K A;  5A9G A;  1XRE A;  4YIP A;  3EVK A;  3KKY A;  2GDS A;  1EM1 A;  1N0N A;  1MNG A;  3RN4 A;  1AR4 A;  1BS3 A;  1N0J A;  1JR9 A;  1LUW A;  4FFK A;  3CEI A;  1AP5 A;  1EN4 A;  1SZX A;  4JZG A;  1ZLZ A;  1JA8 A;  1IDS A;  1GN3 A;  2AW9 A;  3IC9 A;  1MA1 A;  4E4E A;  3OT7 A;  1I08 A;  5AG2 A;  1ZTE A;  1ZSP A;  3K9S A;  3LSU A;  1WB7 A;  1AVM A;  1P7G A;  3C3S A;  1VEW A;  1BT8 A;  1QNM A;  1XIL A;  4JYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...