3RN4A

Crystal structure of iron-substituted sod2 from saccharomyces cerevisiae
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 82
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3rn4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3rn4A02
3QVNA 3CEIA 4JYYA 3RN4A 1N0NA 1I08A 1Y67A 1I0HA 4JZ2A 4FFKA 3EVKA 4YIOA 1XILA 3IC9A 1AP5A 3C3SA 1BS3A 4E4EA 1N0JA 1EN5A 1AP6A 1AVMA 1MSDA 2CDYA 2GDSA 2QKAA 1EN6A 1GN4A 1BT8A 1PL4A 1ZSPA 1GN3A 1ZUQA 4JZGA 5A9GA 2RCVA 3BFRA 4F6EA 1EN4A 1XDCA 1JA8A 1XUQA 1GN6A 2CE4A 2ADPA 3AK2A 1SZXA 1D5NA 1IXBA 3DC5A 2QKCA 2AW9A 1P7GA 1JR9A 3AK3A 1LUVA 3KKYA 4GUNA 1GN2A 3K9SA 1B06A 1EM1A 1PM9A 1AR5A 4YIPA 1LUWA 4X9QA 3OT7A 1ZTEA 1KKCA 3LSUA 3AK1A 4C7UA 1IX9A 3C3TA 1QNMA 1MA1A 2ADQB 1IDSA 1BSMA 1WB7A 3MDSA 3TJTA 1MNGA 5AG2A 1VEWA 1VARA 2P4KA 1XREA 4BR6A 1WB8A 3DC6A 1MMMA 1ZLZA 1AR4A
chains in the Genus database with same CATH superfamily
4IL6Z 4O2BB 1VF6A 3SJCC 4FM0A 2XT9A 5FLXN 2B1IA 3X2QB 3GVMA 1ENVA 2P67A 5LHGA 4FPPA 3AG1B 1WNSA 2RQ6A 1QU7A 2ZR2A 5IWAO 2UXXA 3UKMA 5CA1B 4E4EA 4G2KA 4FM2A 2BOCC 2KG7A 1TGOA 1WPXA 3RVYA 5L3BA 5E1AC 3HKDA 3EFFK 1FPOA 4I50B 4LFCB 1QLEB 4LFBO 5LGTA 2ZE5A 3DTUB 5KUKA 4B3MB 4AILC 2JJ2G 1URFA 5CMUA 4EB6B 2VQFO 5JJEB 2BCCH 3RWRD 5C93A 2BE3A 2P6JA 4OPAA 2P90A 4QE7A 4W4LA 1N34O 2A7WA 2W0FC 3N2GB 2HVJC 1Q90D 3DSQA 1SESA 4LH7A 3JD1A 3LDDA 3HKCB 2UUCO 4PELA 3OUSA 3JALA 5KUMA 4YY3O 2VQEO 5LL6Y 2P06A 2BTOA 4UCVA 1E79G 3AEIA 3EXAA 4CH5A 3ZHQA 5B3SC 3EHBB 1NH2B 4XDKA 5IDJA 2WAMA 4X66O 3UO3A 3UO2A 1D5AA 3ZRWA 4Z2WA 4LF9B 2YUAA 5CB4B 3THOA 2OIEA 5K1PA 3O65A 3K0GA 2RN9A 1JMKC 3I56V 1Z5VA 3IJ4A 2KG7B 2JGDB 3K0DA 4Q6GA 2Y0PA 4F4LA 3BABA 5F2VO 5B1OA 3HKDB 3ZHSA 2ZQMA 3ZJZA 4L87A 2HLDG 2QM8A 4WFGA 2XAHA 4DR7B 4JGSA 2K1EA 3CXCU 5JCOA 3U10A 1M90W 1NT2B 2CDYA 4KFMA 1XNQO 1JQ0A 3B40A 3LDEA 2JJ1G 4YJ2A 4DXWA 5EIBD 3I55V 4PDRA 3JALB 3T2MA 1KC8W 2X7RB 3WG7B 4LF7O 4X88A 1GN6A 2X0LA 1OV9A 3CCJV 1SQFA 4ZHQA 2Y0IA 4KHPO 3AK2A 1D5NA 1EBOA 4JV5O 4DR5O 2CTRA 1JPXA 5KHIA 2GV9A 2QTOA 4CS2A 1KB9F 3G80A 5LYJA 4X64O 1BQZA 4UVAA 2Y4TA 4X65B 2YXLA 2RMKB 3ZRWB 3MAQA 1OCZB 1DGSA 4MTGA 1XNRO 1B06A 4FFBA 4JTDB 4HNAA 4MVQA 1V9PA 4B3TO 3CWBH 2CAZC 4NB5A 3OTOO 2WLNA 3SPCA 1NH2D 2UUAB 1H2SB 5IJ0B 2DJVA 1Q82W 1UPGA 1J95A 1X59A 4UB8Z 3G71V 2UU9O 4K0KB 3ZMVA 1BSMA 2D3OW 2E75B 2AGAA 2YSUB 3K58A 2OT5A 4FLWA 1YITV 3CP1A 1JOYA 1BQ0A 1HNXB 3CEIA 1FFXA 1TAEA 4UCUA 4NTWA 5LMUO 1I0HA 3N2KB 4YJ2B 2L6LA 3RFRA 3U11A 3JD0A 3A2FA 4NVPA 3SYOA 4X1IA 3OMIB 1BCCH 1AP5A 2ZR3A 4ZHQB 1N0JA 4DV5B 3QO8A 4DV4B 2JRIA 3D3IA 3WB2A 4DR3O 5C8YA 2WLLA 4NXNB 2N74A 1U96A 4DW1A 4X20B 5LYJB 3DXRA 3STZC 4JI3B 2RCVA 1RSOA 3BPZA 3OD4A 1MG1A 5IYCO 3SGIA 4J80A 4FFBB 4ICGA 3IAYA 5EBWC 4HNAB 1E1RG 4DV3B 1FJGB 1SZXA 4DR4O 2ZM6O 4DV0O 2Q69A 3K5NA 3RYHA 2V1DA 3SR2C 4DR2B 5BXZA 2QWPB 4UCTA 2WLMA 4B3SO 3CRRA 1THZA 1P7GA 1NJIW 1B3QA 4LH6A 3K5MA 4MW3A 4WF9V 1FXKA 1H8EG 4KUMA 3H1KH 3GWOA 3ZMSA 1EFRG 3CE2A 2FYUH 4A5UB 2IH1C 4LR3A 5GW7A 2CTWA 5DM6V 1FFXB 3G67A 1WP8A 1GMGA 3B4SA 4EFEA 2XOKG 5HFMA 3B8NA 1W2BU 4JYAO 1BZKA 3J81N 2CK3G 1MZFA 2ETNA 3SJQC 4X1IB 2EIKB 1GK9A 4ZOLA 5LP6C 2EBOA 5GONA 3ABKB 2W6JG 5D5QA 1Q6HA 2F23A 1NI8A 2R9IA 5IY5B 5C8YB 2WLLB 3LDCA 3SJAC 2YIDA 4JASA 3DXRB 4ZI7A 3TK1A 3HKEA 4FLXA 4FIPC 1SZTA 4JI6B 1RSOB 2ATKC 1AI4A 2XUMA 2DWDC 4GT1A 2VRZA 1I5YA 1PV0A 2GUZA 1Z5WA 4B3RO 3JSLA 2NN4A 5EC1C 3RYHB 4TOIA 4U7NA 4J7ZA 2GTAA 3QO7A 2AZ2A 5KHJA 3F5TA 2UUBO 4WFBV 1KQSU 3BFRA 1V54C 1IURA 1DF5A 1NS1A 2K9PA 2W6IG 1XMQB 4N21A 1AROP 3FYIB 3R65A 2EJ7A 4DRXB 4DV6O 3CC4V 2RDCA 1FXKB 4JF3A 2LFRA 4K35A 2D2CB 4I4TA 1Q7YW 1OCCB 3L72H 4PDVA 1UJWB 2QKCA 5B66Z 1YI2V 5L3DA 1H2NA 3UT5A 4BIUA 1E1QG 4DUYO 1VIBA 3R66A 2GTSA 3G4SV 4L8JA 5BMVA 3ZS8C 4ZOLB 2HJFC 5GONB 1RM1C 4LCUC 1SRYA 2EIMC 4TQDA 3QO5A 1QR8A 2NLJC 3SYPA 2OCCC 1MA1A 3FX7A 3HKEB 3ABMB 4MVMA 1PKXA 1DLBA 3M8AA 5B1BC 1QLNA 1SQVH 3CXHF 4U7OA 2UXBB 1AR4A 1HDJA 3B8MA 2Q0AA 2Q67A 4MW8A 4AI8A 2F4VO 4JZ2A 5FNVA 3E22A 2MW2B 1VQPV 1N36O 1J5EB 1HNZB 1FXHA 2EIJC 1XL4A 1G6UA 3CCMV 1AI5A 1MSDA 5KAFZ 4I4TB 4K8XA 1JNBA 2WLJA 3HPLC 3CC7V 4BIZA 2YS8A 3OMNB 2JEXA 2LGQA 3UT5B 5IYZA 4O4JA 5JWPA 3KG2A 3JAKB 1N4CA 4NR1A 1Q43A 5BZBA 4RUFA 5BMVB 4AHCA 4DV2O 1NZ6A 5LGUA 2CE4A 2R9RB 2IJKA 3K3WA 1VQ4V 4ABMA 4EKWA 2DMXA 3UM7A 3ASNC 2XNDG 2P4VA 2E5LO 1YDXA 3ZX6A 4E2LA 4BIOA 3AG3B 2VWKA 1FS0G 1SA0A 2IJJA 4DO2A 4LFAB 2HVKC 2Y48A 2YXYA 4MS2A 1I94B 4X1KA 1YHQV 2WLHA 2XAJA 5BY1A 1SQQH 2CTQA 4IYIA 1R3KC 3ZRSA 1KP2A 1JJOA 2WA3A 2IM9A 4DK1A 4B7KA 3HR0A 4IIJA 3ZMTA 3KCYA 4CC5A 3L73H 1QNMA 2ILMA 4MTOA 4I50A 5EYPA 1AJNA 4FZ0A 2ADQB 4QIWF 4DV7B 5FNVB 2V7QG 1SKVA 2FMLA 3E22B 3C90A 3L70H 1RP3B 4Z1MG 1GM8A 4N23A 1S76D 1JFFA 2OIGA 4JI0B 3CRCA 4YHHB 3MD0A 2ZNJA 2EINC 2ZE7A 1AJQA 4GUNA 4MTXA 2AZ0A 1XEQA 4CC6A 1NTMH 3KCXA 2A9HA 3LSQA 3ETQA 5IYZB 3L75H 4O4JB 5B3SB 1H2LA 4QGPA 2ZDIC 4FLZA 4PHZA 4LFCO 5J9PC 4OX9B 1S5HC 4B3MO 3D8CA 2MK3A 3OTFA 4I5SA 1AVMA 4GZRB 5HFLA 1BE3H 4JI8B 1BHAA 4WCEV 3ZCCA 4WFAV 4UVBA 4D7TA 1QVGU 4PJ0Z 1K4DC 4JI5B 1FD9A 2LP7A 3L71H 5LXTA 4DV1B 1SA0B 5CB4A 2RJZA 1N33B 4DR6B 3UCSC 4BW5A 2FB5A 4X1KB 3CMAV 1B6QA 2QWNB 3T1HB 3DC5A 2JGDA 4HAMA 4IIJB 4LF6B 1M56B 1LUVA 5EYPB 2DWEC 1N32B 2ZE8A 2JDIG 4YXWG 2UXDB 1R3LC 3OEEG 3SYAA 3SPIA 1JFFB 1FKAO 1K34A 3AG2C 4J41A 2XHBA 1M9NA 1YIJV 4LF9O 4J10A 2UXCB 3BHPA 3TXSA 4C7UA 1GRJA 1IBKB 3ABLC 2LGWA 2F43G 2C2AA 1VQ7V 5B1AB 1XREA 1ZX3A 2YEVA 1VQKV 3VQXA 2JS3A 3RBZA 2EILC 4JYYA 4BW9A 5L3FA 4DR7O 4LC1A 1N8RW 4NTXA 1Y6XA 4PA4A 2DW4A 3ETGA 5DECA 3ZMZA 4HBNA 2YIAA 5LXTB 3ZHTA 1BHBA 3SPGA 1OJHA 2GDSA 2QKAA 3ETDA 3E83A 2QWRB 1PL4A 1K33A 1P84F 5IJ0A 3H1LH 1Z2GA 3W7UA 4X1YA 4JAUA 3IC7A 1SQPH 4F6EA 5FPOA 2OTLV 4UFZA 1OZ0A 4JI7B 2EX3A 2ADPA 4X65O 3D36C 4F6RB 5KA6A 2DN9A 2Q68A 3AG1C 5J2UA 3N2KA 3OW2U 1Q86W 4UXNA 4MT8A 2V4DA 3E2EA 4P9OA 4I55A 1W59A 2Y69B 2UUAO 2M6YA 1AR5A 5EK0A 2YEVB 1KU9A 3JCZA 3QF7A 1NU1H 1L0NH 2YICA 4K0KO 3OT7A 3A0BZ 5E79Z 3CRQA 2KQXA 4X20A 1Q3EA 2QJ1A 1K97A 4IYHA 1R6TA 2G38A 2XASA 1HNXO 4GX0A 2Q5ZA 3BAAA 3APQA 2P4KA 4BR6A 3E8GA 4CH6A 1OHHG 4OXSA 3ZEDA 4R7CA 3P3NA 3G6EV 1Y67A 2VS0A 4X1YB 5ITZA 4DV5O 2OYQA 2HKOA 3EVKA 4DV4O 1IBLB 1HNWB 5IE9A 3B77A 1IJGA 1KMIZ 2PYJA 1VQ9V 4NXNO 3KZIZ 5B1NA 3T4ZA 2QA4V 1AILA 2E76B 3LNNA 3CX5F 4YJ3A 3OFNG 1Q6IA 4TSFG 3JAWA 1ZWIC 4JI3O 1VF7A 5LP6B 2DYSC 3F5WC 4JI1B 5J2UB 1NTKH 4PA9A 3JATA 1LNQA 2BSKA 2R72A 1R1BA 4DV3O 1FJGO 3H1HH 4J7JA 3VQVA 2PZSA 2Q73A 3BCCH 1YJWV 1GAXA 1EN4A 4DR2O 4I55B 4NTYA 3FB8C 1IZ3A 3VQYA 1M5IA 3FYEB 4O4LA 4LF8B 1JR9A 2F66C 2NR5A 4LBEC 4TUYA 3KDRA 4UCRA 5LHHA 4IT5A 3RYFA 5CBFA 1NKDA 1GO3F 3O9OA 3STLC 2NNUA 1EM1A 1V54B 4UV8A 3T1CA 2KB1A 4YIPA 3WB0A 3JCUZ 4DUZB 5IT9N 1LUWA 1OCRB 4PA3A 2HG5C 4NXMB 1S77D 3K03A 4U3FH 2E3CA 4JYCA 3W7XA 4JI4B 2EZOA 5ITZB 3AG4C 1WB7A 3RYCB 4GKKB 4ZKIA 4DRXA 1VP7A 5H6QA 3S3XA 2OWOA 4YJ3B 5H6RA 3JAWB 3JD2A 2W0XA 5BR8B 4H37A 4H44B 2X6CA 2IU0A 4JI6O 1OCZC 4JAAA 3UQ8A 4K3AA 3J7AU 2PYLA 3JATB 2BSKB 4O2AA 4J42A 4FFKA 4YIOA 2JIZG 4UVCA 2OCCB 2QKSA 1Q5OA 2LO1A 5B1BB 1JX9A 3K9AA 3NXSA 2PI5A 1AP6A 3CHXA 1AI7A 1EN6A 5L3CA 1DF4A 3JSNA 1AJPA 1GN4A 1GTOA 1XMQO 4O4LB 2PTMA 4O4HB 1H38A 2HFEC 2AXTZ 2ODMA 4PV1B 4QE9A 3T1YB 4UV9A 4TUYB 1JVMA 1PNLA 4DR1B 1YJNV 3RYFB 1TVKA 1HR0B 4NKGB 2YXHA 3E89A 3WFVA 1NVPB 2IJHA 1WLEA 4ZIBA 3OM3B 2WSSG 2DE0X 2AW9A 1Y76A 5LOVB 4LF5B 3AK3A 4I7ZB 2KKWA 1AR1B 1L1FA 1V55C 1HWYA 2JEUA 4PA6A 1SC5B 2QR4A 2ZDIA 3CCSV 2QDOA 1KP3A 1QHTA 4JI2B 2BTQA 2EJRA 4IGGA 1DTOA 3E8FA 1HP8A 3LSUA 2Q9LA 1G8MA 3W7WA 4AQYB 3ZHVA 4KL1A 1YEWA 4PDMA 1H2KA 2X6BA 4O2AB 2UXBO 3JAKA 3ASNB 1P49A 3CCVV 5GTIZ 2Z3YA 3U0ZA 4LNUA 3CCLV 5H2FZ 4QNHB 3OR7C 4X62B 3K79A 4RAIA 1TUBA 1K5SA 3RN4A 3A0RA 3DGEA 1J5EO 2Q8VA 1HNZO 5K1XA 3BA8A 1PPJH 4P30A 2VWJA 1BL8A 2HEPA 1VQOV 1OCOB 2YIBD 1TVKB 4FM1A 1KYOF 2WA4A 4UUJC 2R70A 3JYCA 1VQMV 1R3IC 2GBOA 1QR9A 3OR6C 1TA8A 2EINB 1BT8A 2IJIA 4WFEA 1KBHA 2XTAA 1Y76B 1WJZA 4BAYA 1GN3A 1ZUQA 2ZT9B 4QPJA 2HHHB 3TGUH 2JVDA 1JA8A 2Z0AA 1PL0A 5L3EA 5IY5C 2JGUA 1NR7A 5IYBO 4IHJA 1NVPD 1XHXA 4MVOA 2KSDA 5KMGA 2Q4PA 1YF2A 2ZXWC 4RWUA 3WU2Z 1IBMB 1M4UA 3CCEV 2BTQB 4LFAO 3JD3A 3K5LA 2UXNA 1I94O 3KKYA 3K57A 1DK1A 3OGIB 5JVDA 4PD4F 4CH3A 5LHIA 4LNUB 3NR7A 1WPBA 2WLKA 1PM9A 2Q0OC 4R50A 1SERA 4HZ3A 4DV7O 3OGCC 1TUBB 3K06A 4FLVA 3BA9A 5FL7G 2QEXV 2B9ZA 4JI0O 4PI0A 1NR1A 3SYQA 4YHHO 4O4IA 3VQWA 4MVUA 1MNGA 5AG2A 3W7TA 5LBQA 4GKJB 1XBLA 3DC6A 4FVMA 4BWAA 1K3EA 1NTZH 3OAAG 1EZVH 1D2DA 2A79B 2QWOB 1Q6UA 2H8PC 3ZRVA 1CXZB 1PD3A 4OX9O 2M7WA 1UFIA 4LF4B 5CA0B 3FB7C 4JI8O 5LA6A 3ABLB 2Q6AA 3A0HZ 4Q20A 4IHJB 4MVRA 4GYCB 3FAVA 5KMGB 1EN5A 3ABMC 4JI5O 5FPRA 5TISZ 4DV1O 1VQ6V 1S5LZ 1COWG 3GB7C 2WLIA 4B7EA 4DR6O 1ZSPA 2EILB 1RFYA 2Z5UA 4HYOA 3ICXA 3I5DA 4PA7A 3T1HO 3FFQA 5JVDB 1T5EA 2B5UA 4LF6O 2DQ3A 1K92A 1YCIA 4KXRA 5IJ9A 1Q8IA 4XBFA 1SQGA 3M7MX 1N32O 4I9QA 2LW7A 1XQ8A 2UXDO 3F7YC 2RNBA 2Y4UA 4O4IB 3BVOA 4WBNB 3HKBA 5IYDO 3K9SA 3ZIAG 1F7YA 2UXCO 1XMOB 2PGGA 4QPKA 2Q7EA 4DW0A 5LMNB 1IBKO 3ZHUA 1IX9A 3P30A 4XDJA 5DEDA 2XAQA 4FMTA 1GH6A 1M57C 2DYRC 5CN0A 1VEWA 1NBMG 5LA6B 4FLTA 2CTPA 3FAVB 2PY5A 4PI2A 4F6RA 1LR1A 4DYLA 4NYKA 3AG3C 3CSXA 1VQ8V 1H2GA 4CH4A 2WLIB 3QNEA 2ZINA 3FKSG 2PI4A 2CGNA 4GCZA 3JARA 5KHKA 2L35A 5IJ9B 1WN7A 3HB3B 1HW7A 4OGQB 1KUQA 1YVWA 4RUEA 3ML0A 5IWAB 4FLYA 4JI7O 4P2ZA 1S3JA 3K59A 4LP8A 3ZRXA 3ASOC 3H1JH 3K5OA 4JZGA 3GWKC 3OEHG 3Q4HA 3FB5C 1O9HA 3E8BA 4TV8A 3HKBB 2OTJV 4B08A 5A2QN 3MHSC 1IVSA 4LFBB 3JD4A 5DN6G 5CA3A 4RQEA 3BY6A 1QBZA 3BEHA 2VQFB 4JPRA 1QCEA 2DYSB 1F51A 3K08A 2P22C 2ZCEA 1N34B 3E35A 4J9YB 1AI6A 5JH7A 1KD1W 1PP9H 3SJBC 2ITCC 2UUCB 1F4NA 3CS5A 4X9QA 4YY3B 2VQEB 3X2QC 5LP6A 1YJ9V 3RW0A 2H94A 1M1KW 4DK0A 2CH7A 3QTCA 1H8HG 4G27B 1A32A 1IDSA 4EFBA 3TJTA 1TUEB 5EBLC 3JARB 2F1MA 1VARA 1I7FA 1SF9A 4X66B 1K8AW 3CD6V 4TV9A 1ZL8A 1BGYH 1M56C 5LGNA 2AHZA 5EIBC 1IBLO 1QLEC 1HNWO 1N0NA 4LWSA 2OCHA 1X4TA 3M99B 4CS4A 1M93A 4JYBA 3Q4HB 1Y66A 4W4KA 1W0JG 4TV8B 3CPWU 3VBBA 1R3JC 4JI1O 4FJCC 1NQTA 3AG4B 3P32A 1MZEA 3H01A 3J80N 1JCHA 4ASUG 1FOUA 1Y74A 4PDLA 3G6BA 5B1AC 2O57A 4MSWC 4H13B 1XDCA 3IGAC 5KAIZ 5JH7B 3RYCA 1XNQB 1BMFG 4LF8O 5D5PA 1VF6C 4JTAB 1PNKA 4LF7B 1K7DA 1I5XA 2DOSA 4RO2A 4KHPB 2CH7B 3LNMB 1P4RA 4XDLA 4DR5B 4JV5B 4DUZO 1FYJA 2YI9A 4EEQA 2YIBA 5KX5A 4NXMO 2XAGA 2QSAA 4X64B 4GX2A 1MOFA 5GTHZ 4JI4O 4TV9B 1ZL8B 4X8AA 2ARHA 3P3PA 1XL6A 4GLXA 1XNRB 2WPDG 4LWSB 4GKKO 4O4HA 3VOUA 1G4YB 3K04A 4B3TB 1KKDA 2WWWA 3FD9A 5KA5A 3RVZA 5BR8O 2PF4E 3OTOB 3ZN0A 4X89A 1WB8A 1V55B 2F93B 2UU9B 3ZHRA 1RPRA 3QVNA 1W0KG 1Y74B 2CUGA 4I0XA 1R73A 3B2EE 1I08A 3S3WA 5LOVA 1CPYA 4U3JA 3WG7C 4FLUA 3RYIA 2X6AA 2Y69C 2IH3C 5KHHA 4D6TH 5EC2C 1XILA 5H5NA 1YTFB 4ZBMA 2JK5C 4D7SA 5LMUB 1VQLV 3T1YO 3E86A 3PJSK 2A3QA 2XAFA 4DR1O 4Z1VA 3F7VC 4JAVA 4UCOA 4P9PA 1JJ2U 1HR0O 1RPOA 3ABTA 1RM1B 4RQFA 1P7BA 1H2MA 1XI1A 2HJDA 2EIMB 3RGBA 1WA8A 1ROPA 4DR3B 1SQXH 2A0LA 4WFFA 3CRAA 1XUQA 5KX5B 1U97A 3ZBHA 2FTKA 3SYCA 3PN1A 4LF5O 2BOBC 1L0LH 2EZPA 3CJHA 2JS5A 3A8TA 5KLVH 2N05A 2N04A 1ORQC 2ZIOA 2ZNIA 2ZM6B 4DR4B 4DV0B 1S72V 5EZYA 3LSSA 1XOUA 4JI2O 3FB6C 5JCOC 4CBCA 1O9GA 3APOA 4B3SB 2ITDC 1R6KA 1XHZA 4AQYO 4MVSA 2ZKOA 4J11A 1B04A 4R6ZA 1VQNV 1KECA 5CBGA 4I0XB 2ZXWB 1VMGA 2EIJB 4U3JB 3RYIB 1YZBA 4X62O 2Q7GA 5JJNB 1EZJA 3JAMN 3IFXA 4JYAB 3CB2A 2P7TC 1US6A 1MMMA 3OMAB 3CYOA 5B5EZ 3MHHC 1SQBH 3JASA 1WA8B 2YI8A 4GX5A 1Q81W 1OCRC 1YTFD 3IC9A 2QM4A 1VQ5V 3C3SA 1BS3A 2QE7G 3CJHB 2HHHO 3RT3C 4JTCB 4UCSA 5CBHA 4KP4A 2Q7HA 5JQGA 1YXBA 2QGNA 2FKXA 4B3RB 2H3OA 2IU3A 5EZYB 1IBMO 4J7KA 4H33A 4UB6Z 2QM7A 4R8CA 2P5OA 2LJ2A 2UUBB 1AB3A 2QTSA 3TETA 1QVFU 3AG7A 4DV6B 1K5QA 1VF5B 3ABUA 3B09A 2ZD9A 5J2TA 4ZI7B 3CCQV 3QG5A 3LUTB 4CZZA 4CS3A 2EIKC 3SDLA 3SPJA 1WP7A 2FL4A 3ABKC 5CA0A 4G28B 3OE7G 4I9WA 3CMEV 1S0VA 2ZIMA 2GUZB 1K4CC 1SS3A 4DUYB 3CRMA 4H0LB 3L74H 4MVZA 2B1GA 3WB1A 1KKCA 4GKJO 3ZN1A 3CCRV 3AK1A 4MTFA 1CEZA 3C3TA 3H9VA 2CGOA 4J9ZB 3JASB 1MSWD 2DQ0A 5KHGA 3MDSA 2IW5A 3D3QA 3E8HA 1F23A 2AHYA 1FAFA 1GM9A 2GHYA 4QJFB 4LF4O 2R9AA 2LFSA 3CCUV 5JQGB 2ZE6A 1GKFA 2YDEA 1H5WA 1FXKC 2IBZH 4WBNA 1WAZA 2EULA 1CP9A 3ETEA 1OCCC 1Y4MA 2F4VB 5L3GA 1QQCA 5H9CA 2GSMB 1M57B 2DYRB 4O2BA 5EBMC 1N36B 3TXQA 3AG2B 3T4DA 1FFTB 5J2TB 3D36A 3OUFA 5A9GA 1R6NA 3BRCA 2QWQB 2YC0A 3L9DA 3TCUA 5CA1A 1SETA 1PNMA 1IXBA 1MABG 2LW1A 4DV2B 1OCOC 1K9MW 1GM7A 2PUSA 1YSCA 1XMOO 4GX1A 1N33O 4FZ1A 1L8DA 1ZAUA 2A06H 3CC2V 1S5JA 1GN2A 5LMNO 2E74B 3ASOB 4WFHA 4EB6A 2F95B 1K73W 2HP8A 2E5LB 3H1IH 4OPHA 4K8ZA 1FXVA 2HR3A 1ZTEA 3W7SA 3N2GA 1F4MA 3HKCA 4TWKA 3N27A 4FK5C 5JJJB 1G1XB 4TQFA 3SPHA 2LQTA 3ZMUA 1IXMA 4TT3G 1ZLZA
chains in the Genus database with same CATH topology
3QVNA 3CEIA 4JYYA 3RN4A 1N0NA 1I08A 1Y67A 1I0HA 4JZ2A 4FFKA 3EVKA 4YIOA 1XILA 3IC9A 1AP5A 3C3SA 1BS3A 4E4EA 1N0JA 1EN5A 1AP6A 1AVMA 1MSDA 2CDYA 2GDSA 2QKAA 1EN6A 1GN4A 1BT8A 1PL4A 1ZSPA 1GN3A 1ZUQA 4JZGA 5A9GA 2RCVA 3BFRA 4F6EA 1EN4A 1XDCA 1JA8A 1XUQA 1GN6A 2CE4A 2ADPA 3AK2A 1SZXA 1D5NA 1IXBA 3DC5A 2QKCA 2AW9A 1P7GA 1JR9A 3AK3A 1LUVA 3KDRA 3KKYA 4GUNA 1GN2A 3K9SA 1B06A 1EM1A 1PM9A 1AR5A 4YIPA 1LUWA 4X9QA 3OT7A 1ZTEA 1KKCA 3LSUA 3AK1A 4C7UA 1IX9A 3C3TA 1QNMA 1MA1A 2ADQB 1IDSA 1BSMA 1WB7A 3MDSA 3TJTA 1MNGA 5AG2A 1VEWA 1VARA 2P4KA 1XREA 4BR6A 1WB8A 3DC6A 1MMMA 1ZLZA 1AR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QVN A;  3CEI A;  4JYY A;  3RN4 A;  1N0N A;  1I08 A;  1Y67 A;  1I0H A;  4JZ2 A;  4FFK A;  3EVK A;  4YIO A;  1XIL A;  3IC9 A;  1AP5 A;  3C3S A;  1BS3 A;  4E4E A;  1N0J A;  1EN5 A;  1AP6 A;  1AVM A;  1MSD A;  2CDY A;  2GDS A;  2QKA A;  1EN6 A;  1GN4 A;  1BT8 A;  1PL4 A;  1ZSP A;  1GN3 A;  1ZUQ A;  4JZG A;  5A9G A;  2RCV A;  3BFR A;  4F6E A;  1EN4 A;  1XDC A;  1JA8 A;  1XUQ A;  1GN6 A;  2CE4 A;  2ADP A;  3AK2 A;  1SZX A;  1D5N A;  1IXB A;  3DC5 A;  2QKC A;  2AW9 A;  1P7G A;  1JR9 A;  3AK3 A;  1LUV A;  3KKY A;  4GUN A;  1GN2 A;  3K9S A;  1B06 A;  1EM1 A;  1PM9 A;  1AR5 A;  4YIP A;  1LUW A;  4X9Q A;  3OT7 A;  1ZTE A;  1KKC A;  3LSU A;  3AK1 A;  4C7U A;  1IX9 A;  3C3T A;  1QNM A;  1MA1 A;  2ADQ B;  1IDS A;  1BSM A;  1WB7 A;  3MDS A;  3TJT A;  1MNG A;  5AG2 A;  1VEW A;  1VAR A;  2P4K A;  1XRE A;  4BR6 A;  1WB8 A;  3DC6 A;  1MMM A;  1ZLZ A;  1AR4 A; 
#chains in the Genus database with same CATH topology
 4IL6 Z;  4O2B B;  1VF6 A;  3SJC C;  4FM0 A;  2XT9 A;  5FLX N;  2B1I A;  3X2Q B;  3GVM A;  1ENV A;  2P67 A;  5LHG A;  4FPP A;  3AG1 B;  1WNS A;  2RQ6 A;  1QU7 A;  2ZR2 A;  5IWA O;  2UXX A;  3UKM A;  5CA1 B;  4E4E A;  4G2K A;  4FM2 A;  2BOC C;  2KG7 A;  1TGO A;  1WPX A;  3RVY A;  5L3B A;  5E1A C;  3HKD A;  3EFF K;  1FPO A;  4I50 B;  4LFC B;  1QLE B;  4LFB O;  5LGT A;  2ZE5 A;  3DTU B;  5KUK A;  4B3M B;  4AIL C;  2JJ2 G;  1URF A;  5CMU A;  4EB6 B;  2VQF O;  5JJE B;  2BCC H;  3RWR D;  5C93 A;  2BE3 A;  2P6J A;  4OPA A;  2P90 A;  4QE7 A;  4W4L A;  1N34 O;  2A7W A;  2W0F C;  3N2G B;  2HVJ C;  1Q90 D;  3DSQ A;  1SES A;  4LH7 A;  3JD1 A;  3LDD A;  3HKC B;  2UUC O;  4PEL A;  3OUS A;  3JAL A;  5KUM A;  4YY3 O;  2VQE O;  5LL6 Y;  2P06 A;  2BTO A;  4UCV A;  1E79 G;  3AEI A;  3EXA A;  4CH5 A;  3ZHQ A;  5B3S C;  3EHB B;  1NH2 B;  4XDK A;  5IDJ A;  2WAM A;  4X66 O;  3UO3 A;  3UO2 A;  1D5A A;  3ZRW A;  4Z2W A;  4LF9 B;  2YUA A;  5CB4 B;  3THO A;  2OIE A;  5K1P A;  3O65 A;  3K0G A;  2RN9 A;  1JMK C;  3I56 V;  1Z5V A;  3IJ4 A;  2KG7 B;  2JGD B;  3K0D A;  4Q6G A;  2Y0P A;  4F4L A;  3BAB A;  5F2V O;  5B1O A;  3HKD B;  3ZHS A;  2ZQM A;  3ZJZ A;  4L87 A;  2HLD G;  2QM8 A;  4WFG A;  2XAH A;  4DR7 B;  4JGS A;  2K1E A;  3CXC U;  5JCO A;  3U10 A;  1M90 W;  1NT2 B;  2CDY A;  4KFM A;  1XNQ O;  1JQ0 A;  3B40 A;  3LDE A;  2JJ1 G;  4YJ2 A;  4DXW A;  5EIB D;  3I55 V;  4PDR A;  3JAL B;  3T2M A;  1KC8 W;  2X7R B;  3WG7 B;  4LF7 O;  4X88 A;  1GN6 A;  2X0L A;  1OV9 A;  3CCJ V;  1SQF A;  4ZHQ A;  2Y0I A;  4KHP O;  3AK2 A;  1D5N A;  1EBO A;  4JV5 O;  4DR5 O;  2CTR A;  1JPX A;  5KHI A;  2GV9 A;  2QTO A;  4CS2 A;  1KB9 F;  3G80 A;  5LYJ A;  4X64 O;  1BQZ A;  4UVA A;  2Y4T A;  4X65 B;  2YXL A;  2RMK B;  3ZRW B;  3MAQ A;  1OCZ B;  1DGS A;  4MTG A;  1XNR O;  1B06 A;  4FFB A;  4JTD B;  4HNA A;  4MVQ A;  1V9P A;  4B3T O;  3CWB H;  2CAZ C;  4NB5 A;  3OTO O;  2WLN A;  3SPC A;  1NH2 D;  2UUA B;  1H2S B;  5IJ0 B;  2DJV A;  1Q82 W;  1UPG A;  1J95 A;  1X59 A;  4UB8 Z;  3G71 V;  2UU9 O;  4K0K B;  3ZMV A;  1BSM A;  2D3O W;  2E75 B;  2AGA A;  2YSU B;  3K58 A;  2OT5 A;  4FLW A;  1YIT V;  3CP1 A;  1JOY A;  1BQ0 A;  1HNX B;  3CEI A;  1FFX A;  1TAE A;  4UCU A;  4NTW A;  5LMU O;  1I0H A;  3N2K B;  4YJ2 B;  2L6L A;  3RFR A;  3U11 A;  3JD0 A;  3A2F A;  4NVP A;  3SYO A;  4X1I A;  3OMI B;  1BCC H;  1AP5 A;  2ZR3 A;  4ZHQ B;  1N0J A;  4DV5 B;  3QO8 A;  4DV4 B;  2JRI A;  3D3I A;  3WB2 A;  4DR3 O;  5C8Y A;  2WLL A;  4NXN B;  2N74 A;  1U96 A;  4DW1 A;  4X20 B;  5LYJ B;  3DXR A;  3STZ C;  4JI3 B;  2RCV A;  1RSO A;  3BPZ A;  3OD4 A;  1MG1 A;  5IYC O;  3SGI A;  4J80 A;  4FFB B;  4ICG A;  3IAY A;  5EBW C;  4HNA B;  1E1R G;  4DV3 B;  1FJG B;  1SZX A;  4DR4 O;  2ZM6 O;  4DV0 O;  2Q69 A;  3K5N A;  3RYH A;  2V1D A;  3SR2 C;  4DR2 B;  5BXZ A;  2QWP B;  4UCT A;  2WLM A;  4B3S O;  3CRR A;  1THZ A;  1P7G A;  1NJI W;  1B3Q A;  4LH6 A;  3K5M A;  4MW3 A;  4WF9 V;  1FXK A;  1H8E G;  4KUM A;  3H1K H;  3GWO A;  3ZMS A;  1EFR G;  3CE2 A;  2FYU H;  4A5U B;  2IH1 C;  4LR3 A;  5GW7 A;  2CTW A;  5DM6 V;  1FFX B;  3G67 A;  1WP8 A;  1GMG A;  3B4S A;  4EFE A;  2XOK G;  5HFM A;  3B8N A;  1W2B U;  4JYA O;  1BZK A;  3J81 N;  2CK3 G;  1MZF A;  2ETN A;  3SJQ C;  4X1I B;  2EIK B;  1GK9 A;  4ZOL A;  5LP6 C;  2EBO A;  5GON A;  3ABK B;  2W6J G;  5D5Q A;  1Q6H A;  2F23 A;  1NI8 A;  2R9I A;  5IY5 B;  5C8Y B;  2WLL B;  3LDC A;  3SJA C;  2YID A;  4JAS A;  3DXR B;  4ZI7 A;  3TK1 A;  3HKE A;  4FLX A;  4FIP C;  1SZT A;  4JI6 B;  1RSO B;  2ATK C;  1AI4 A;  2XUM A;  2DWD C;  4GT1 A;  2VRZ A;  1I5Y A;  1PV0 A;  2GUZ A;  1Z5W A;  4B3R O;  3JSL A;  2NN4 A;  5EC1 C;  3RYH B;  4TOI A;  4U7N A;  4J7Z A;  2GTA A;  3QO7 A;  2AZ2 A;  5KHJ A;  3F5T A;  2UUB O;  4WFB V;  1KQS U;  3BFR A;  1V54 C;  1IUR A;  1DF5 A;  1NS1 A;  2K9P A;  2W6I G;  1XMQ B;  4N21 A;  1ARO P;  3FYI B;  3R65 A;  2EJ7 A;  4DRX B;  4DV6 O;  3CC4 V;  2RDC A;  1FXK B;  4JF3 A;  2LFR A;  4K35 A;  2D2C B;  4I4T A;  1Q7Y W;  1OCC B;  3L72 H;  4PDV A;  1UJW B;  2QKC A;  5B66 Z;  1YI2 V;  5L3D A;  1H2N A;  3UT5 A;  4BIU A;  1E1Q G;  4DUY O;  1VIB A;  3R66 A;  2GTS A;  3G4S V;  4L8J A;  5BMV A;  3ZS8 C;  4ZOL B;  2HJF C;  5GON B;  1RM1 C;  4LCU C;  1SRY A;  2EIM C;  4TQD A;  3QO5 A;  1QR8 A;  2NLJ C;  3SYP A;  2OCC C;  1MA1 A;  3FX7 A;  3HKE B;  3ABM B;  4MVM A;  1PKX A;  1DLB A;  3M8A A;  5B1B C;  1QLN A;  1SQV H;  3CXH F;  4U7O A;  2UXB B;  1AR4 A;  1HDJ A;  3B8M A;  2Q0A A;  2Q67 A;  4MW8 A;  4AI8 A;  2F4V O;  4JZ2 A;  5FNV A;  3E22 A;  2MW2 B;  1VQP V;  1N36 O;  1J5E B;  1HNZ B;  1FXH A;  2EIJ C;  1XL4 A;  1G6U A;  3CCM V;  1AI5 A;  1MSD A;  5KAF Z;  4I4T B;  4K8X A;  1JNB A;  2WLJ A;  3HPL C;  3CC7 V;  4BIZ A;  2YS8 A;  3OMN B;  2JEX A;  2LGQ A;  3UT5 B;  5IYZ A;  4O4J A;  5JWP A;  3KG2 A;  3JAK B;  1N4C A;  4NR1 A;  1Q43 A;  5BZB A;  4RUF A;  5BMV B;  4AHC A;  4DV2 O;  1NZ6 A;  5LGU A;  2CE4 A;  2R9R B;  2IJK A;  3K3W A;  1VQ4 V;  4ABM A;  4EKW A;  2DMX A;  3UM7 A;  3ASN C;  2XND G;  2P4V A;  2E5L O;  1YDX A;  3ZX6 A;  4E2L A;  4BIO A;  3AG3 B;  2VWK A;  1FS0 G;  1SA0 A;  2IJJ A;  4DO2 A;  4LFA B;  2HVK C;  2Y48 A;  2YXY A;  4MS2 A;  1I94 B;  4X1K A;  1YHQ V;  2WLH A;  2XAJ A;  5BY1 A;  1SQQ H;  2CTQ A;  4IYI A;  1R3K C;  3ZRS A;  1KP2 A;  1JJO A;  2WA3 A;  2IM9 A;  4DK1 A;  4B7K A;  3HR0 A;  4IIJ A;  3ZMT A;  3KCY A;  4CC5 A;  3L73 H;  1QNM A;  2ILM A;  4MTO A;  4I50 A;  5EYP A;  1AJN A;  4FZ0 A;  2ADQ B;  4QIW F;  4DV7 B;  5FNV B;  2V7Q G;  1SKV A;  2FML A;  3E22 B;  3C90 A;  3L70 H;  1RP3 B;  4Z1M G;  1GM8 A;  4N23 A;  1S76 D;  1JFF A;  2OIG A;  4JI0 B;  3CRC A;  4YHH B;  3MD0 A;  2ZNJ A;  2EIN C;  2ZE7 A;  1AJQ A;  4GUN A;  4MTX A;  2AZ0 A;  1XEQ A;  4CC6 A;  1NTM H;  3KCX A;  2A9H A;  3LSQ A;  3ETQ A;  5IYZ B;  3L75 H;  4O4J B;  5B3S B;  1H2L A;  4QGP A;  2ZDI C;  4FLZ A;  4PHZ A;  4LFC O;  5J9P C;  4OX9 B;  1S5H C;  4B3M O;  3D8C A;  2MK3 A;  3OTF A;  4I5S A;  1AVM A;  4GZR B;  5HFL A;  1BE3 H;  4JI8 B;  1BHA A;  4WCE V;  3ZCC A;  4WFA V;  4UVB A;  4D7T A;  1QVG U;  4PJ0 Z;  1K4D C;  4JI5 B;  1FD9 A;  2LP7 A;  3L71 H;  5LXT A;  4DV1 B;  1SA0 B;  5CB4 A;  2RJZ A;  1N33 B;  4DR6 B;  3UCS C;  4BW5 A;  2FB5 A;  4X1K B;  3CMA V;  1B6Q A;  2QWN B;  3T1H B;  3DC5 A;  2JGD A;  4HAM A;  4IIJ B;  4LF6 B;  1M56 B;  1LUV A;  5EYP B;  2DWE C;  1N32 B;  2ZE8 A;  2JDI G;  4YXW G;  2UXD B;  1R3L C;  3OEE G;  3SYA A;  3SPI A;  1JFF B;  1FKA O;  1K34 A;  3AG2 C;  4J41 A;  2XHB A;  1M9N A;  1YIJ V;  4LF9 O;  4J10 A;  2UXC B;  3BHP A;  3TXS A;  4C7U A;  1GRJ A;  1IBK B;  3ABL C;  2LGW A;  2F43 G;  2C2A A;  1VQ7 V;  5B1A B;  1XRE A;  1ZX3 A;  2YEV A;  1VQK V;  3VQX A;  2JS3 A;  3RBZ A;  2EIL C;  4JYY A;  4BW9 A;  5L3F A;  4DR7 O;  4LC1 A;  1N8R W;  4NTX A;  1Y6X A;  4PA4 A;  2DW4 A;  3ETG A;  5DEC A;  3ZMZ A;  4HBN A;  2YIA A;  5LXT B;  3ZHT A;  1BHB A;  3SPG A;  1OJH A;  2GDS A;  2QKA A;  3ETD A;  3E83 A;  2QWR B;  1PL4 A;  1K33 A;  1P84 F;  5IJ0 A;  3H1L H;  1Z2G A;  3W7U A;  4X1Y A;  4JAU A;  3IC7 A;  1SQP H;  4F6E A;  5FPO A;  2OTL V;  4UFZ A;  1OZ0 A;  4JI7 B;  2EX3 A;  2ADP A;  4X65 O;  3D36 C;  4F6R B;  5KA6 A;  2DN9 A;  2Q68 A;  3AG1 C;  5J2U A;  3N2K A;  3OW2 U;  1Q86 W;  4UXN A;  4MT8 A;  2V4D A;  3E2E A;  4P9O A;  4I55 A;  1W59 A;  2Y69 B;  2UUA O;  2M6Y A;  1AR5 A;  5EK0 A;  2YEV B;  1KU9 A;  3JCZ A;  3QF7 A;  1NU1 H;  1L0N H;  2YIC A;  4K0K O;  3OT7 A;  3A0B Z;  5E79 Z;  3CRQ A;  2KQX A;  4X20 A;  1Q3E A;  2QJ1 A;  1K97 A;  4IYH A;  1R6T A;  2G38 A;  2XAS A;  1HNX O;  4GX0 A;  2Q5Z A;  3BAA A;  3APQ A;  2P4K A;  4BR6 A;  3E8G A;  4CH6 A;  1OHH G;  4OXS A;  3ZED A;  4R7C A;  3P3N A;  3G6E V;  1Y67 A;  2VS0 A;  4X1Y B;  5ITZ A;  4DV5 O;  2OYQ A;  2HKO A;  3EVK A;  4DV4 O;  1IBL B;  1HNW B;  5IE9 A;  3B77 A;  1IJG A;  1KMI Z;  2PYJ A;  1VQ9 V;  4NXN O;  3KZI Z;  5B1N A;  3T4Z A;  2QA4 V;  1AIL A;  2E76 B;  3LNN A;  3CX5 F;  4YJ3 A;  3OFN G;  1Q6I A;  4TSF G;  3JAW A;  1ZWI C;  4JI3 O;  1VF7 A;  5LP6 B;  2DYS C;  3F5W C;  4JI1 B;  5J2U B;  1NTK H;  4PA9 A;  3JAT A;  1LNQ A;  2BSK A;  2R72 A;  1R1B A;  4DV3 O;  1FJG O;  3H1H H;  4J7J A;  3VQV A;  2PZS A;  2Q73 A;  3BCC H;  1YJW V;  1GAX A;  1EN4 A;  4DR2 O;  4I55 B;  4NTY A;  3FB8 C;  1IZ3 A;  3VQY A;  1M5I A;  3FYE B;  4O4L A;  4LF8 B;  1JR9 A;  2F66 C;  2NR5 A;  4LBE C;  4TUY A;  3KDR A;  4UCR A;  5LHH A;  4IT5 A;  3RYF A;  5CBF A;  1NKD A;  1GO3 F;  3O9O A;  3STL C;  2NNU A;  1EM1 A;  1V54 B;  4UV8 A;  3T1C A;  2KB1 A;  4YIP A;  3WB0 A;  3JCU Z;  4DUZ B;  5IT9 N;  1LUW A;  1OCR B;  4PA3 A;  2HG5 C;  4NXM B;  1S77 D;  3K03 A;  4U3F H;  2E3C A;  4JYC A;  3W7X A;  4JI4 B;  2EZO A;  5ITZ B;  3AG4 C;  1WB7 A;  3RYC B;  4GKK B;  4ZKI A;  4DRX A;  1VP7 A;  5H6Q A;  3S3X A;  2OWO A;  4YJ3 B;  5H6R A;  3JAW B;  3JD2 A;  2W0X A;  5BR8 B;  4H37 A;  4H44 B;  2X6C A;  2IU0 A;  4JI6 O;  1OCZ C;  4JAA A;  3UQ8 A;  4K3A A;  3J7A U;  2PYL A;  3JAT B;  2BSK B;  4O2A A;  4J42 A;  4FFK A;  4YIO A;  2JIZ G;  4UVC A;  2OCC B;  2QKS A;  1Q5O A;  2LO1 A;  5B1B B;  1JX9 A;  3K9A A;  3NXS A;  2PI5 A;  1AP6 A;  3CHX A;  1AI7 A;  1EN6 A;  5L3C A;  1DF4 A;  3JSN A;  1AJP A;  1GN4 A;  1GTO A;  1XMQ O;  4O4L B;  2PTM A;  4O4H B;  1H38 A;  2HFE C;  2AXT Z;  2ODM A;  4PV1 B;  4QE9 A;  3T1Y B;  4UV9 A;  4TUY B;  1JVM A;  1PNL A;  4DR1 B;  1YJN V;  3RYF B;  1TVK A;  1HR0 B;  4NKG B;  2YXH A;  3E89 A;  3WFV A;  1NVP B;  2IJH A;  1WLE A;  4ZIB A;  3OM3 B;  2WSS G;  2DE0 X;  2AW9 A;  1Y76 A;  5LOV B;  4LF5 B;  3AK3 A;  4I7Z B;  2KKW A;  1AR1 B;  1L1F A;  1V55 C;  1HWY A;  2JEU A;  4PA6 A;  1SC5 B;  2QR4 A;  2ZDI A;  3CCS V;  2QDO A;  1KP3 A;  1QHT A;  4JI2 B;  2BTQ A;  2EJR A;  4IGG A;  1DTO A;  3E8F A;  1HP8 A;  3LSU A;  2Q9L A;  1G8M A;  3W7W A;  4AQY B;  3ZHV A;  4KL1 A;  1YEW A;  4PDM A;  1H2K A;  2X6B A;  4O2A B;  2UXB O;  3JAK A;  3ASN B;  1P49 A;  3CCV V;  5GTI Z;  2Z3Y A;  3U0Z A;  4LNU A;  3CCL V;  5H2F Z;  4QNH B;  3OR7 C;  4X62 B;  3K79 A;  4RAI A;  1TUB A;  1K5S A;  3RN4 A;  3A0R A;  3DGE A;  1J5E O;  2Q8V A;  1HNZ O;  5K1X A;  3BA8 A;  1PPJ H;  4P30 A;  2VWJ A;  1BL8 A;  2HEP A;  1VQO V;  1OCO B;  2YIB D;  1TVK B;  4FM1 A;  1KYO F;  2WA4 A;  4UUJ C;  2R70 A;  3JYC A;  1VQM V;  1R3I C;  2GBO A;  1QR9 A;  3OR6 C;  1TA8 A;  2EIN B;  1BT8 A;  2IJI A;  4WFE A;  1KBH A;  2XTA A;  1Y76 B;  1WJZ A;  4BAY A;  1GN3 A;  1ZUQ A;  2ZT9 B;  4QPJ A;  2HHH B;  3TGU H;  2JVD A;  1JA8 A;  2Z0A A;  1PL0 A;  5L3E A;  5IY5 C;  2JGU A;  1NR7 A;  5IYB O;  4IHJ A;  1NVP D;  1XHX A;  4MVO A;  2KSD A;  5KMG A;  2Q4P A;  1YF2 A;  2ZXW C;  4RWU A;  3WU2 Z;  1IBM B;  1M4U A;  3CCE V;  2BTQ B;  4LFA O;  3JD3 A;  3K5L A;  2UXN A;  1I94 O;  3KKY A;  3K57 A;  1DK1 A;  3OGI B;  5JVD A;  4PD4 F;  4CH3 A;  5LHI A;  4LNU B;  3NR7 A;  1WPB A;  2WLK A;  1PM9 A;  2Q0O C;  4R50 A;  1SER A;  4HZ3 A;  4DV7 O;  3OGC C;  1TUB B;  3K06 A;  4FLV A;  3BA9 A;  5FL7 G;  2QEX V;  2B9Z A;  4JI0 O;  4PI0 A;  1NR1 A;  3SYQ A;  4YHH O;  4O4I A;  3VQW A;  4MVU A;  1MNG A;  5AG2 A;  3W7T A;  5LBQ A;  4GKJ B;  1XBL A;  3DC6 A;  4FVM A;  4BWA A;  1K3E A;  1NTZ H;  3OAA G;  1EZV H;  1D2D A;  2A79 B;  2QWO B;  1Q6U A;  2H8P C;  3ZRV A;  1CXZ B;  1PD3 A;  4OX9 O;  2M7W A;  1UFI A;  4LF4 B;  5CA0 B;  3FB7 C;  4JI8 O;  5LA6 A;  3ABL B;  2Q6A A;  3A0H Z;  4Q20 A;  4IHJ B;  4MVR A;  4GYC B;  3FAV A;  5KMG B;  1EN5 A;  3ABM C;  4JI5 O;  5FPR A;  5TIS Z;  4DV1 O;  1VQ6 V;  1S5L Z;  1COW G;  3GB7 C;  2WLI A;  4B7E A;  4DR6 O;  1ZSP A;  2EIL B;  1RFY A;  2Z5U A;  4HYO A;  3ICX A;  3I5D A;  4PA7 A;  3T1H O;  3FFQ A;  5JVD B;  1T5E A;  2B5U A;  4LF6 O;  2DQ3 A;  1K92 A;  1YCI A;  4KXR A;  5IJ9 A;  1Q8I A;  4XBF A;  1SQG A;  3M7M X;  1N32 O;  4I9Q A;  2LW7 A;  1XQ8 A;  2UXD O;  3F7Y C;  2RNB A;  2Y4U A;  4O4I B;  3BVO A;  4WBN B;  3HKB A;  5IYD O;  3K9S A;  3ZIA G;  1F7Y A;  2UXC O;  1XMO B;  2PGG A;  4QPK A;  2Q7E A;  4DW0 A;  5LMN B;  1IBK O;  3ZHU A;  1IX9 A;  3P30 A;  4XDJ A;  5DED A;  2XAQ A;  4FMT A;  1GH6 A;  1M57 C;  2DYR C;  5CN0 A;  1VEW A;  1NBM G;  5LA6 B;  4FLT A;  2CTP A;  3FAV B;  2PY5 A;  4PI2 A;  4F6R A;  1LR1 A;  4DYL A;  4NYK A;  3AG3 C;  3CSX A;  1VQ8 V;  1H2G A;  4CH4 A;  2WLI B;  3QNE A;  2ZIN A;  3FKS G;  2PI4 A;  2CGN A;  4GCZ A;  3JAR A;  5KHK A;  2L35 A;  5IJ9 B;  1WN7 A;  3HB3 B;  1HW7 A;  4OGQ B;  1KUQ A;  1YVW A;  4RUE A;  3ML0 A;  5IWA B;  4FLY A;  4JI7 O;  4P2Z A;  1S3J A;  3K59 A;  4LP8 A;  3ZRX A;  3ASO C;  3H1J H;  3K5O A;  4JZG A;  3GWK C;  3OEH G;  3Q4H A;  3FB5 C;  1O9H A;  3E8B A;  4TV8 A;  3HKB B;  2OTJ V;  4B08 A;  5A2Q N;  3MHS C;  1IVS A;  4LFB B;  3JD4 A;  5DN6 G;  5CA3 A;  4RQE A;  3BY6 A;  1QBZ A;  3BEH A;  2VQF B;  4JPR A;  1QCE A;  2DYS B;  1F51 A;  3K08 A;  2P22 C;  2ZCE A;  1N34 B;  3E35 A;  4J9Y B;  1AI6 A;  5JH7 A;  1KD1 W;  1PP9 H;  3SJB C;  2ITC C;  2UUC B;  1F4N A;  3CS5 A;  4X9Q A;  4YY3 B;  2VQE B;  3X2Q C;  5LP6 A;  1YJ9 V;  3RW0 A;  2H94 A;  1M1K W;  4DK0 A;  2CH7 A;  3QTC A;  1H8H G;  4G27 B;  1A32 A;  1IDS A;  4EFB A;  3TJT A;  1TUE B;  5EBL C;  3JAR B;  2F1M A;  1VAR A;  1I7F A;  1SF9 A;  4X66 B;  1K8A W;  3CD6 V;  4TV9 A;  1ZL8 A;  1BGY H;  1M56 C;  5LGN A;  2AHZ A;  5EIB C;  1IBL O;  1QLE C;  1HNW O;  1N0N A;  4LWS A;  2OCH A;  1X4T A;  3M99 B;  4CS4 A;  1M93 A;  4JYB A;  3Q4H B;  1Y66 A;  4W4K A;  1W0J G;  4TV8 B;  3CPW U;  3VBB A;  1R3J C;  4JI1 O;  4FJC C;  1NQT A;  3AG4 B;  3P32 A;  1MZE A;  3H01 A;  3J80 N;  1JCH A;  4ASU G;  1FOU A;  1Y74 A;  4PDL A;  3G6B A;  5B1A C;  2O57 A;  4MSW C;  4H13 B;  1XDC A;  3IGA C;  5KAI Z;  5JH7 B;  3RYC A;  1XNQ B;  1BMF G;  4LF8 O;  5D5P A;  1VF6 C;  4JTA B;  1PNK A;  4LF7 B;  1K7D A;  1I5X A;  2DOS A;  4RO2 A;  4KHP B;  2CH7 B;  3LNM B;  1P4R A;  4XDL A;  4DR5 B;  4JV5 B;  4DUZ O;  1FYJ A;  2YI9 A;  4EEQ A;  2YIB A;  5KX5 A;  4NXM O;  2XAG A;  2QSA A;  4X64 B;  4GX2 A;  1MOF A;  5GTH Z;  4JI4 O;  4TV9 B;  1ZL8 B;  4X8A A;  2ARH A;  3P3P A;  1XL6 A;  4GLX A;  1XNR B;  2WPD G;  4LWS B;  4GKK O;  4O4H A;  3VOU A;  1G4Y B;  3K04 A;  4B3T B;  1KKD A;  2WWW A;  3FD9 A;  5KA5 A;  3RVZ A;  5BR8 O;  2PF4 E;  3OTO B;  3ZN0 A;  4X89 A;  1WB8 A;  1V55 B;  2F93 B;  2UU9 B;  3ZHR A;  1RPR A;  3QVN A;  1W0K G;  1Y74 B;  2CUG A;  4I0X A;  1R73 A;  3B2E E;  1I08 A;  3S3W A;  5LOV A;  1CPY A;  4U3J A;  3WG7 C;  4FLU A;  3RYI A;  2X6A A;  2Y69 C;  2IH3 C;  5KHH A;  4D6T H;  5EC2 C;  1XIL A;  5H5N A;  1YTF B;  4ZBM A;  2JK5 C;  4D7S A;  5LMU B;  1VQL V;  3T1Y O;  3E86 A;  3PJS K;  2A3Q A;  2XAF A;  4DR1 O;  4Z1V A;  3F7V C;  4JAV A;  4UCO A;  4P9P A;  1JJ2 U;  1HR0 O;  1RPO A;  3ABT A;  1RM1 B;  4RQF A;  1P7B A;  1H2M A;  1XI1 A;  2HJD A;  2EIM B;  3RGB A;  1WA8 A;  1ROP A;  4DR3 B;  1SQX H;  2A0L A;  4WFF A;  3CRA A;  1XUQ A;  5KX5 B;  1U97 A;  3ZBH A;  2FTK A;  3SYC A;  3PN1 A;  4LF5 O;  2BOB C;  1L0L H;  2EZP A;  3CJH A;  2JS5 A;  3A8T A;  5KLV H;  2N05 A;  2N04 A;  1ORQ C;  2ZIO A;  2ZNI A;  2ZM6 B;  4DR4 B;  4DV0 B;  1S72 V;  5EZY A;  3LSS A;  1XOU A;  4JI2 O;  3FB6 C;  5JCO C;  4CBC A;  1O9G A;  3APO A;  4B3S B;  2ITD C;  1R6K A;  1XHZ A;  4AQY O;  4MVS A;  2ZKO A;  4J11 A;  1B04 A;  4R6Z A;  1VQN V;  1KEC A;  5CBG A;  4I0X B;  2ZXW B;  1VMG A;  2EIJ B;  4U3J B;  3RYI B;  1YZB A;  4X62 O;  2Q7G A;  5JJN B;  1EZJ A;  3JAM N;  3IFX A;  4JYA B;  3CB2 A;  2P7T C;  1US6 A;  1MMM A;  3OMA B;  3CYO A;  5B5E Z;  3MHH C;  1SQB H;  3JAS A;  1WA8 B;  2YI8 A;  4GX5 A;  1Q81 W;  1OCR C;  1YTF D;  3IC9 A;  2QM4 A;  1VQ5 V;  3C3S A;  1BS3 A;  2QE7 G;  3CJH B;  2HHH O;  3RT3 C;  4JTC B;  4UCS A;  5CBH A;  4KP4 A;  2Q7H A;  5JQG A;  1YXB A;  2QGN A;  2FKX A;  4B3R B;  2H3O A;  2IU3 A;  5EZY B;  1IBM O;  4J7K A;  4H33 A;  4UB6 Z;  2QM7 A;  4R8C A;  2P5O A;  2LJ2 A;  2UUB B;  1AB3 A;  2QTS A;  3TET A;  1QVF U;  3AG7 A;  4DV6 B;  1K5Q A;  1VF5 B;  3ABU A;  3B09 A;  2ZD9 A;  5J2T A;  4ZI7 B;  3CCQ V;  3QG5 A;  3LUT B;  4CZZ A;  4CS3 A;  2EIK C;  3SDL A;  3SPJ A;  1WP7 A;  2FL4 A;  3ABK C;  5CA0 A;  4G28 B;  3OE7 G;  4I9W A;  3CME V;  1S0V A;  2ZIM A;  2GUZ B;  1K4C C;  1SS3 A;  4DUY B;  3CRM A;  4H0L B;  3L74 H;  4MVZ A;  2B1G A;  3WB1 A;  1KKC A;  4GKJ O;  3ZN1 A;  3CCR V;  3AK1 A;  4MTF A;  1CEZ A;  3C3T A;  3H9V A;  2CGO A;  4J9Z B;  3JAS B;  1MSW D;  2DQ0 A;  5KHG A;  3MDS A;  2IW5 A;  3D3Q A;  3E8H A;  1F23 A;  2AHY A;  1FAF A;  1GM9 A;  2GHY A;  4QJF B;  4LF4 O;  2R9A A;  2LFS A;  3CCU V;  5JQG B;  2ZE6 A;  1GKF A;  2YDE A;  1H5W A;  1FXK C;  2IBZ H;  4WBN A;  1WAZ A;  2EUL A;  1CP9 A;  3ETE A;  1OCC C;  1Y4M A;  2F4V B;  5L3G A;  1QQC A;  5H9C A;  2GSM B;  1M57 B;  2DYR B;  4O2B A;  5EBM C;  1N36 B;  3TXQ A;  3AG2 B;  3T4D A;  1FFT B;  5J2T B;  3D36 A;  3OUF A;  5A9G A;  1R6N A;  3BRC A;  2QWQ B;  2YC0 A;  3L9D A;  3TCU A;  5CA1 A;  1SET A;  1PNM A;  1IXB A;  1MAB G;  2LW1 A;  4DV2 B;  1OCO C;  1K9M W;  1GM7 A;  2PUS A;  1YSC A;  1XMO O;  4GX1 A;  1N33 O;  4FZ1 A;  1L8D A;  1ZAU A;  2A06 H;  3CC2 V;  1S5J A;  1GN2 A;  5LMN O;  2E74 B;  3ASO B;  4WFH A;  4EB6 A;  2F95 B;  1K73 W;  2HP8 A;  2E5L B;  3H1I H;  4OPH A;  4K8Z A;  1FXV A;  2HR3 A;  1ZTE A;  3W7S A;  3N2G A;  1F4M A;  3HKC A;  4TWK A;  3N27 A;  4FK5 C;  5JJJ B;  1G1X B;  4TQF A;  3SPH A;  2LQT A;  3ZMU A;  1IXM A;  4TT3 G;  1ZLZ A; 
#chains in the Genus database with same CATH homology
 3QVN A;  3CEI A;  4JYY A;  3RN4 A;  1N0N A;  1I08 A;  1Y67 A;  1I0H A;  4JZ2 A;  4FFK A;  3EVK A;  4YIO A;  1XIL A;  3IC9 A;  1AP5 A;  3C3S A;  1BS3 A;  4E4E A;  1N0J A;  1EN5 A;  1AP6 A;  1AVM A;  1MSD A;  2CDY A;  2GDS A;  2QKA A;  1EN6 A;  1GN4 A;  1BT8 A;  1PL4 A;  1ZSP A;  1GN3 A;  1ZUQ A;  4JZG A;  5A9G A;  2RCV A;  3BFR A;  4F6E A;  1EN4 A;  1XDC A;  1JA8 A;  1XUQ A;  1GN6 A;  2CE4 A;  2ADP A;  3AK2 A;  1SZX A;  1D5N A;  1IXB A;  3DC5 A;  2QKC A;  2AW9 A;  1P7G A;  1JR9 A;  3AK3 A;  1LUV A;  3KDR A;  3KKY A;  4GUN A;  1GN2 A;  3K9S A;  1B06 A;  1EM1 A;  1PM9 A;  1AR5 A;  4YIP A;  1LUW A;  4X9Q A;  3OT7 A;  1ZTE A;  1KKC A;  3LSU A;  3AK1 A;  4C7U A;  1IX9 A;  3C3T A;  1QNM A;  1MA1 A;  2ADQ B;  1IDS A;  1BSM A;  1WB7 A;  3MDS A;  3TJT A;  1MNG A;  5AG2 A;  1VEW A;  1VAR A;  2P4K A;  1XRE A;  4BR6 A;  1WB8 A;  3DC6 A;  1MMM A;  1ZLZ A;  1AR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...