3RN4A

Crystal structure of iron-substituted sod2 from saccharomyces cerevisiae
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn], mitochondrial
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 82
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3rn4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3rn4A02
1N0NA 3AK3A 1I0HA 4X9QA 3EVKA 1GN2A 5A9GA 1IXBA 3DC5A 3OT7A 1Y67A 1BSMA 1XUQA 1MNGA 1LUVA 2CE4A 3MDSA 1KKCA 1AR5A 3LSUA 1IDSA 1ZUQA 1AR4A 1AP6A 1BT8A 1P7GA 3AK1A 1MMMA 1MSDA 2CDYA 5AG2A 4JZGA 1VARA 2RCVA 3IC9A 1I08A 1EN6A 1BS3A 3C3SA 3TJTA 2QKAA 4FFKA 4BR6A 1EN4A 4GUNA 4F6EA 3AK2A 3CEIA 1GN3A 1EN5A 1ZLZA 4JZ2A 4YIPA 1PL4A 1VEWA 2ADQB 4YIOA 1QNMA 1MA1A 1ZSPA 1WB7A 1SZXA 1XILA 4C7UA 1B06A 1ZTEA 1LUWA 3RN4A 2P4KA 1N0JA 3DC6A 3K9SA 1JR9A 1GN6A 3BFRA 3QVNA 3C3TA 1IX9A 3KKYA 1AP5A 1D5NA 1GN4A 1JA8A 4JYYA 2ADPA 1XREA 2GDSA 2QKCA 1XDCA 1AVMA 1WB8A 1EM1A 1PM9A 2AW9A 4E4EA
chains in the Genus database with same CATH superfamily
1FPOA 2Y48A 1P7BA 4AHCA 4WF9V 2KKWA 4JI4B 1FFXA 3Q4HA 5F2VO 5LBQA 4YHHB 2Q9LA 4JF3A 2VWJA 5BR8B 3LSQA 1KKCA 4X62O 1BQ0A 2YIBD 1VF5B 2HVKC 2FYUH 1MSDA 4GYCB 1QU7A 3E22A 4DV4O 2GV9A 3J81N 1E1QG 3G71V 4WFAV 1F23A 1JOYA 5KAFZ 5GONB 3N2KA 3QTCA 2MW2B 1QR9A 4GX0A 2F93B 2R9IA 3UO2A 3AG2B 1GTOA 1XMQB 2PTMA 2RN9A 1SKVA 4UCSA 3JSLA 5IWAB 1KBHA 1P4RA 2GHYA 2BE3A 3CRQA 2YSUB 4LFCB 3GVMA 4PHZA 3E2EA 5LYJB 1SZTA 1S5JA 4TT3G 4ZOLA 4I0XA 3KCXA 4WBNB 4X1KA 4K35A 4LH6A 5JH7A 3FB8C 4J9ZB 3CCMV 1VP7A 1B04A 2UXBB 1VQ9V 1HWYA 2RNBA 2A7WA 4DR1O 4TV8B 4R7CA 1J5EB 4B3TO 2ZM6O 2YI8A 3A0HZ 3CRMA 5JQGA 2YEVB 3N2GA 1FXKA 1H2MA 2WSSG 4RO2A 2JGDA 2HP8A 1DF5A 4LR3A 4IHJB 1PKXA 3CX5F 1TVKA 4NKGB 1OCOB 1CP9A 4CBCA 1RP3B 1N0NA 4QGPA 4JI5B 1GM7A 4NVPA 3RYFA 5B3SB 3WB2A 3L72H 1NH2B 1CXZB 5KAIZ 1VQPV 3SYOA 3K04A 3BEHA 3QO8A 3H1JH 4MVRA 5GW7A 4DR7B 2VWKA 4J41A 4B3SO 4QJFB 1IBKO 3ABKC 4GKJO 1HNXO 1RM1C 1BT8A 4O2BB 1BHAA 2Q8VA 3E8BA 4GX5A 1FKAO 1JNBA 2C2AA 3GWOA 1GK9A 2EZOA 3T4DA 3EHBB 2DWDC 4EB6B 1L8DA 4UCRA 3K57A 4IGGA 3SPHA 3FYEB 5B66Z 4J10A 3ABLB 4H13B 4DYLA 2QGNA 3LDCA 4UFZA 1HNWB 4B3MO 4RAIA 2WLLA 2OIEA 3JD4A 3RT3C 1NBMG 2QWRB 4I4TA 5J2TA 4OX9O 2JS3A 3OEEG 4X66B 2D3OW 3CCUV 1B06A 3P32A 2Y0PA 2F4VB 1N34O 4UUJC 3ASOC 3BFRA 1TGOA 4DR2B 2CUGA 1GO3F 1NI8A 4O4HA 1XREA 3SPCA 1AJQA 3R66A 3JCZA 1MG1A 1FXHA 3UKMA 1RPRA 2PZSA 3ZS8C 3G80A 4RWUA 1SQQH 1Y4MA 4H0LB 2ODMA 4LF5O 4GKKO 4EFEA 4DV0B 2EIJC 1FD9A 1Q8IA 5B1BB 1CPYA 4FLTA 3SYAA 3B8MA 1LNQA 3ASNC 1KECA 1M56B 4O4LA 1AR5A 3TGUH 3JYCA 2XTAA 1AP6A 4JI8O 2QM7A 3VBBA 4I9QA 3JARB 4LF7B 2M6YA 3U11A 2OIGA 1JFFA 4OPAA 4BW5A 2K1EA 1SA0B 4KUMA 5IDJA 2LGQA 2ZR2A 3LDDA 1I08A 2ZE5A 3H1LH 1WP7A 3CB2A 5J2UB 1W59A 4FFKA 1K4CC 4FM1A 2A0LA 4WFEA 4LH7A 1K97A 3A0BZ 3LNNA 2JK5C 2BTQB 4WFHA 2OCCB 1Q5OA 3SGIA 3CMAV 1AI7A 5H9CA 4DUYB 3K5NA 4LC1A 1PL4A 1ZAUA 4LF4O 2ADQB 1TAEA 1Q6IA 5E1AC 1M4UA 4JI6O 3STZC 1R73A 5ITZA 1SQBH 2X6BA 2GUZA 3WB1A 4I9WA 2UXXA 4F6RA 4TWKA 2EIMB 1URFA 4KP4A 4UVBA 4DR4O 1YI2V 4TUYA 4JPRA 1AROP 4DV1B 4O4IB 1WPXA 2NNUA 5KLVH 3K58A 3CXCU 2DYSC 1AI4A 3AG1B 4AQYO 3H1HH 1D2DA 2IJJA 1S0VA 1SQFA 2HHHB 2QDOA 2CE4A 1HNZB 1E1RG 3CC4V 3OEHG 1KC8W 4P9OA 4LNUB 2VQFB 2ZDIC 2EJRA 1OCRC 3WB0A 1MMMA 1H8EG 5AG2A 3IFXA 1XNRB 1Y74B 1H2KA 3I55V 2CTPA 2X6AA 2R70A 2BOBC 3OR7C 1B6QA 1BS3A 2LFRA 3L71H 3JSNA 3WG7B 1WA8A 1ROPA 3LNMB 1XL6A 4FLVA 2ZE8A 1U97A 1TUBB 1SS3A 3E22B 4ZI7A 1V55C 3F7YC 3JAKA 5EIBD 4A5UB 2Q0AA 2VQEB 1YJNV 2DQ0A 3NXSA 2Q73A 2DW4A 2LQTA 1MA1A 3UT5B 3FAVA 1WB7A 3KZIZ 4IT5A 2PGGA 3N2KB 3HKCA 3G4SV 1JJ2U 5L3EA 2QM8A 5KMGB 1N0JA 3K9SA 1ZWIC 4JGSA 2HEPA 2K9PA 3HKEA 4DV2B 3K5MA 2DYSB 4PA9A 4JASA 1XMOO 2QM4A 1OCCC 2P6JA 5B1OA 3CRAA 3JAWA 3U10A 2XUMA 4LWSB 2BCCH 3RYCA 3ZEDA 4J7JA 1W0JG 4LFAB 2FTKA 4ZKIA 5CMUA 4H37A 4E4EA 2DE0X 1BHBA 2Q6AA 4Q20A 4LFBO 1NU1H 4BAYA 2UXCB 1PP9H 5EBMC 3CCQV 2P06A 2P5OA 1BSMA 4MVQA 5JQGB 5L3DA 3SYQA 5LMUB 3SPJA 2JGDB 2YUAA 4LF8B 1M57C 2YICA 2YS8A 4GX1A 2XAGA 1TVKB 4JI2O 4TSFG 1WN7A 2QWQB 3JD0A 2ZINA 1PPJH 2Y4UA 3JATA 2RCVA 4U3JA 5KUMA 2Q0OC 2JEXA 3ZMSA 4NTXA 3CC2V 4X64O 1WPBA 2XNDG 2N04A 3CMEV 2OYQA 3OD4A 1RPOA 2OT5A 2HVJC 3G6BA 4FLWA 1NTZH 3APOA 2UXNA 4HAMA 4FMTA 2EIKB 2Y69B 2QE7G 4ASUG 5JVDA 4PI2A 1AB3A 3DXRB 2BSKA 2BTOA 3CXHF 3T1HB 1D5AA 3RVZA 4KHPB 1O9GA 2F95B 1SZXA 4JTCB 4HZ3A 3RFRA 4RQEA 1LUWA 1YJ9V 1R6NA 1YTFD 5LHGA 1GN6A 5CA3A 4GT1A 2WLLB 4NXMB 3HPLC 3BA9A 1BE3H 3ZRWB 3T4ZA 2KG7A 3THOA 3OGIB 2YXYA 4I4TB 3AG2C 2LGWA 2LW1A 3CE2A 1IJGA 2UUBO 1Q82W 1JJOA 1PM9A 2W6JG 4L87A 2CTRA 2G38A 2ZXWB 3FKSG 5K1PA 3AK3A 3CWBH 4YY3O 4GZRB 1F51A 4O4HB 1Q6UA 1AILA 2WLIA 1NZ6A 3TETA 2YXLA 2IW5A 3I56V 3S3WA 2DOSA 2DJVA 1OHHG 1VMGA 4L8JA 4DUZO 2LO1A 1K3EA 2E76B 2WLNA 1IBMB 3UQ8A 4X62B 1V9PA 4J11A 3D36A 3D3QA 3TXQA 3RVYA 2PY5A 1Z2GA 4R6ZA 1OCOC 3FB5C 4O4LB 2QKAA 1IBLO 1UFIA 4BR6A 3JALA 1VF7A 2QR4A 3CD6V 3CCVV 4JYAB 1YF2A 5B3SC 2EBOA 2Q69A 4X1YA 1YHQV 3H9VA 4PJ0Z 2D2CB 1MOFA 4MTOA 1JFFB 1EFRG 2XT9A 5BMVA 2UUAO 2XOKG 4Z2WA 1ZSPA 3K59A 3BY6A 5IJ0B 4X65O 3E8HA 1QLEC 5IYCO 1G1XB 3DC6A 1SQXH 1N33B 2L35A 1Q7YW 1K7DA 3DTUB 5BR8O 5KA5A 2WLHA 3QF7A 4N21A 3I5DA 3CCEV 5D5PA 3E8GA 1XEQA 5FL7G 1Y6XA 3ABLC 1KU9A 4DR1B 5CA0B 2H94A 4B3TB 2B9ZA 1KUQA 1ORQC 4JAVA 5ITZB 1EM1A 4J42A 1L1FA 1FYJA 4GX2A 3BHPA 2ZNIA 2YXHA 4P2ZA 3D3IA 3L73H 1W2BU 4LF6B 4WFBV 2WA3A 1QQCA 3K0GA 2P90A 4K8ZA 4LF9O 5DECA 4YJ3B 5HFLA 4YJ2A 3AG4B 3A8TA 4TOIA 2XASA 2AHYA 3LSUA 1VIBA 1I5YA 3RYIA 4FFBA 1GKFA 2KSDA 3C90A 3JAMN 2UXBO 3MHSC 1WNSA 1X4TA 4X20A 3W7SA 3G67A 4X1IA 1Q43A 4B3SB 2W6IG 3ETQA 4FIPC 4TQDA 1HNXB 4JV5O 4J80A 1J5EO 3P3NA 1VF6C 4K8XA 2MK3A 4HYOA 3T1CA 3HKBB 3IC7A 4JI3O 1YEWA 5B1BC 4PD4F 1JCHA 1QLEB 1R3KC 1IVSA 1ZL8A 5B5EZ 1SQPH 4BIUA 4DO2A 1M56C 1VQ6V 3K5LA 4P30A 1KP2A 4CS3A 2IJIA 4YIOA 4PELA 1WP8A 3B09A 2XHBA 3ABMB 2XAFA 3LUTB 2P4KA 3E8FA 4QPKA 4DV5O 3QO5A 3S3XA 3C3TA 4X89A 1D5NA 2YIBA 4QE9A 1GN4A 1NVPB 5CBHA 5IY5B 2Z3YA 1N34B 1H2GA 4UCOA 3VQWA 5LL6Y 4AILC 3CPWU 3ZMUA 5LMNB 1UPGA 1XDCA 2YI9A 2N74A 2OCCC 1NS1A 4KL1A 3SJQC 3E35A 3E89A 3RYHA 5JCOC 5LXTA 3W7XA 2GSMB 3FB7C 1HNWO 2PI4A 1NTKH 1QLNA 5H6RA 4FZ0A 4MVOA 5H6QA 4QIWF 1S5LZ 4LF5B 1RFYA 5C8YA 1GM8A 4GKKB 3X2QB 2R9RB 2R9AA 2EIMC 1FJGB 2PYLA 1XNQO 4PDRA 1K34A 3F5WC 3VQYA 4ZHQA 5LP6A 4NXNB 2EILB 4JI1O 1P49A 4NR1A 1AR1B 4DR2O 2CTWA 2AZ2A 1KMIZ 1XL4A 4JI8B 1IXMA 3AG1C 5D5QA 1BZKA 4U3FH 4LBEC 5CB4A 4JI0O 3BABA 3AK2A 4OXSA 4DR6O 1RSOA 4PV1B 5EZYB 5DN6G 4O4JA 3CSXA 4CH3A 1DLBA 4YIPA 3PN1A 2Q7EA 3JCUZ 3ETDA 1TA8A 2W0XA 1OJHA 1M1KW 4MTFA 3SPIA 1PV0A 1FFTB 3B40A 2N05A 1S76D 4HNAB 4I55B 3KKYA 4JI6B 1VQMV 3RWRD 1K92A 1K4DC 5GONA 3WG7C 3ZX6A 3SPGA 1R3JC 1BMFG 4B3RO 2PI5A 2QJ1A 5CBFA 3TK1A 4XDKA 3KG2A 4DR4B 2QSAA 3CCSV 4BW9A 2AGAA 3ZMZA 1DGSA 1COWG 5KHGA 5L3BA 3EVKA 3L70H 2DYRB 4MVUA 2ETNA 2KG7B 2XAJA 5CN0A 4AQYB 1MABG 5JJEB 4I50B 5GTIZ 1PNMA 3OTOO 1S5HC 5L3FA 5IYZB 3CCLV 1H38A 1ZUQA 4WFGA 1OCZB 1EBOA 3O65A 3H01A 2UUCO 4JI7O 3DGEA 4B08A 1VARA 1M5IA 4G27B 3AEIA 3MAQA 2ZCEA 3IJ4A 2YEVA 2QEXV 5FPOA 4JTDB 2WLIB 2E5LB 2LFSA 5IJ9B 4IHJA 1QBZA 4DRXB 4DK1A 1ZX3A 1DTOA 4CH6A 2JIZG 3M7MX 4F4LA 3L9DA 2P7TC 3B8NA 4UCUA 1BL8A 5EK0A 1FFXB 4QNHB 1KB9F 3OTFA 3Q4HB 4FLZA 3OAAG 1QNMA 4X88A 1G8MA 1N32B 3EXAA 1K5QA 1F4NA 3ZMTA 3JALB 1HR0B 4FLUA 1JR9A 4O2BA 2OCHA 1HNZO 2W0FC 3ML0A 4X1YB 3L75H 4DV3O 1IZ3A 4UV8A 1JA8A 4EB6A 2Q68A 1THZA 3H1IH 4HBNA 3TCUA 2A06H 3M8AA 3T2MA 2FL4A 2GDSA 3CJHA 3HKDA 1XMOB 3ZRXA 3VOUA 1AVMA 4GLXA 1AI6A 2ATKC 1LR1A 2EIKC 2Y69C 5KX5A 1I5XA 4XBFA 2ITCC 2IU0A 1GN2A 3RBZA 4JTAB 2IJKA 2A3QA 4ZOLB 2F23A 4I0XB 2HJFC 4X1KB 2JVDA 2JEUA 3CRRA 4J9YB 4LFBB 5JH7B 3GWKC 1GMGA 4DR3O 1XHXA 5IYBO 3QG5A 2VQEO 4K3AA 1X59A 2UU9B 1DF4A 3BPZA 3TXSA 4MVSA 4D6TH 1F7YA 1JVMA 4JZGA 3SYCA 3STLC 2H3OA 1PL0A 3K06A 4DV2O 1IURA 3C3SA 4G28B 4JI2B 3SJBC 5B1AB 4YJ2B 3FYIB 3N2GB 3CRCA 1FXKB 1YVWA 1M90W 1S3JA 3F5TA 2ZXWC 3KDRA 1KYOF 4U7NA 2CH7A 4H44B 4TQFA 4JAAA 3RYIB 4FFBB 4X64B 4WFFA 4X20B 3RYFB 2ZT9B 1SC5B 3OE7G 1Z5VA 2IM9A 3CS5A 4OPHA 1ZTEA 2UXCO 3ZCCA 2F66C 4B7EA 4W4LA 2X7RB 2QKSA 5EBLC 3T1YO 1OV9A 1R6KA 3CYOA 3JARA 5LMUO 1IX9A 4TV9A 4DV6O 4MS2A 1ZL8B 4UCTA 1BQZA 1Q3EA 3VQXA 3A2FA 2P67A 2Q4PA 1E79G 4PDVA 4YXWG 4MVZA 3B77A 2EINB 3A0RA 4R50A 5IE9A 4RQFA 3SYPA 2BTQA 2B5UA 2Q5ZA 3OFNG 3BCCH 2QTOA 5B1NA 5JCOA 4X9QA 1I94B 5BZBA 2UUBB 1QVGU 3APQA 3OT7A 1YCIA 3FFQA 5J2TB 2YIDA 1MNGA 3MDSA 1QCEA 3ZHVA 2AXTZ 1YJWV 3HB3B 4YY3B 1H8HG 1YITV 4NYKA 3CCJV 3NR7A 3T1HO 1AR4A 2OWOA 2YDEA 2CAZC 1EZVH 2P22C 4K0KO 3RYHB 5DEDA 5LXTB 1JX9A 4DR5O 1L0NH 2UXDO 1N36O 2WWWA 3ZIAG 1PNLA 2IH3C 5EYPA 3ZHQA 3OUSA 1GAXA 4GUNA 3OUFA 1QVFU 2RJZA 2M7WA 2KB1A 3AG4C 4DV7O 1NQTA 3FB6C 1YZBA 1US6A 3AG3B 5IYDO 1HW7A 1KQSU 4C7UA 5CA1A 1YSCA 4DV4B 3LDEA 3O9OA 3G6EV 4UB8Z 2Q7HA 4IYHA 2UUAB 3W7UA 1RSOB 3ZHRA 1Y74A 1WAZA 4BIZA 2JS5A 4X65B 2ZKOA 4O4JB 2JDIG 1R6TA 1IBMO 4FJCC 2R72A 4JAUA 1QHTA 4JI4O 3L74H 4O2AA 2AW9A 2IH1C 1P84F 4YHHO 1EZJA 1TUBA 1FOUA 1I0HA 1V54B 4JYAO 1IXBA 4UCVA 5EC1C 4BWAA 5LOVA 1S77D 3ABMC 3UT5A 1YIJV 1PNKA 2LW7A 2NR5A 2Z0AA 5KMGA 2WLJA 1VQKV 2ZM6B 3W7TA 4UB6Z 2GUZB 4KXRA 5IY5C 4LF9B 2HLDG 4F6RB 1VQOV 1U96A 3K3WA 2DMXA 2Z5UA 2NLJC 1VQLV 1XMQO 1N33O 2Q7GA 2JJ1G 4D7SA 4UVCA 4LWSA 1N4CA 3IC9A 5IWAO 3H1KH 3OGCC 2WA4A 4TUYB 1VQ5V 1FXVA 3OM3B 4LFCO 2BOCC 2NN4A 1WJZA 1FS0G 2GTAA 2WLMA 1EN4A 3J7AU 3IAYA 3ABUA 2FKXA 2ZDIA 1JPXA 4JV5B 4G2KA 1NR7A 2H8PC 3X2QC 1AJNA 1VEWA 1W0KG 2CK3G 4JI3B 1A32A 1IBKB 2ZE7A 4JYCA 4GKJB 2ILMA 4ZBMA 3ZN0A 1XILA 5FNVA 4Z1VA 4LF6O 1XHZA 1YDXA 1XBLA 5BY1A 1VQ8V 1VQ4V 3BAAA 2EILC 4UVAA 3K5OA 1K73W 1K5SA 4MSWC 1R3LC 5KHJA 2V7QG 5KHIA 4EEQA 2ADPA 5LGTA 3ZMVA 1K33A 3ZHSA 4DV5B 4B3MB 1G4YB 1Q6HA 4JI5O 2QWNB 3ETEA 2DWEC 2RMKB 1WA8B 4OX9B 4NTWA 1G6UA 1AJPA 2LP7A 2ZIMA 3ICXA 3DSQA 4DR7O 1R1BA 3DXRA 4J7KA 1HP8A 1VQ7V 3DC5A 4ZI7B 1XUQA 3JAKB 3K9AA 5LA6A 4CH5A 2QA4V 5HFMA 2L6LA 1LUVA 3JD1A 1SQGA 3M99B 1B3QA 1NT2B 3CJHB 3FAVB 3HKDB 4MW8A 3CC7V 4UXNA 3HKCB 4N23A 3ZHUA 5LGNA 4NTYA 1P7GA 4CS2A 3ZRWA 3MD0A 5KX5B 2CDYA 3MHHC 3HKEB 4AI8A 3JASA 4Q6GA 4RUFA 2XAQA 4BIOA 1EN6A 2QTSA 5BXZA 1XNQB 3JAWB 2OTJV 1CEZA 1O9HA 2B1IA 4IIJA 1N8RW 4MT8A 3SJAC 3RYCB 4QE7A 3K08A 4JI1B 2ZD9A 1NH2D 1TUEB 1M93A 2DYRC 4X66O 5LMNO 1GN3A 3K79A 1GRJA 4U7OA 2F4VO 2P4VA 5K1XA 5H2FZ 1Y76A 4JI0B 5EIBC 3VQVA 4EKWA 4DR6B 4JYBA 5FLXN 3B2EE 1OCZC 2WLKA 3K03A 5EBWC 2CH7B 2PYJA 2A79B 2E75B 2DQ3A 4MVMA 2X0LA 2E3CA 5KHHA 4KFMA 3F7VC 1FJGO 3P30A 3ABKB 1RM1B 2YC0A 4DXWA 1MZEA 1AI5A 1KD1W 3JATB 4U3JB 4NXNO 5LHHA 1M9NA 1Q86W 4DV0O 3OW2U 5H5NA 2QKCA 4PDMA 1NVPD 4PA3A 4PA6A 3R65A 2JJ2G 2EULA 4LF4B 3D36C 4B3RB 2ZNJA 3EFFK 4TV9B 3FD9A 4PI0A 4QPJA 1SQVH 2HFEC 5JVDB 5IJ0A 2V1DA 2BSKB 5JWPA 4LF7O 1SETA 3JD2A 4D7TA 2O57A 4H33A 1IDSA 2RQ6A 3WU2Z 3WFVA 2EJ7A 3ASOB 5LYJA 2IJHA 3OTOB 2VRZA 3HR0A 2Y4TA 4WBNA 2V4DA 4FVMA 5CA0A 4XDLA 4E2LA 1KP3A 3TJTA 4FK5C 5LGUA 2KQXA 2UUCB 4JI7B 2WPDG 1XQ8A 2JGUA 3BA8A 4DUYO 4F6EA 4NB5A 2HR3A 4TV8A 3U0ZA 3D8CA 5LHIA 1EN5A 1SF9A 1ZLZA 4JZ2A 2VS0A 2ZR3A 2QWOB 4YJ3A 2EIJB 3W7WA 1YXBA 4GCZA 1SERA 5EYPB 3ASNB 1BGYH 1Y66A 2DN9A 4DV1O 2ZIOA 1H2NA 2CTQA 3OMAB 3SDLA 3ZBHA 1UJWB 1BCCH 2IU3A 1KKDA 4CC6A 1NKDA 2ZE6A 4JYYA 5B1AC 3GB7C 1FXKC 1XI1A 2PUSA 3N27A 3B4SA 1K8AW 4DV3B 3CHXA 4LP8A 3BVOA 5CA1B 2YIAA 1WB8A 3HKBA 1H2LA 2HHHO 4LCUC 2GTSA 4I7ZB 1PD3A 2E5LO 3FX7A 3QNEA 3E86A 3LSSA 4PA7A 2VQFO 2EZPA 1QR8A 1NJIW 2FMLA 1Y67A 3SJCC 4J7ZA 2B1GA 5EC2C 2CGNA 5BMVB 1XNRO 3J80N 3BRCA 3ETGA 4O2AB 2AZ0A 1N32O 4MW3A 3AK1A 2QWPB 1NR1A 4ABMA 1HR0O 4DR3B 4ZIBA 2LJ2A 3IGAC 5LOVB 2EINC 4Z1MG 2HG5C 4IL6Z 1Q81W 1K9MW 1GH6A 2ARHA 5KHKA 5E79Z 2A9HA 3ZJZA 1J95A 1SRYA 3UM7A 1XOUA 3CEIA 2F1MA 3ZRSA 4CC5A 3UCSC 4RUEA 3ZN1A 4IYIA 3P3PA 2Q67A 5C93A 2CGOA 4DW1A 1YTFB 1H2SB 3PJSK 4PDLA 2IBZH 2X6CA 3RN4A 5FPRA 3E83A 3JD3A 1GM9A 1VF6A 4OGQB 1DK1A 4R8CA 5DM6V 4WCEV 1NTMH 4FM0A 1ENVA 4FPPA 2E74B 1AP5A 1OCRB 2ZQMA 4X8AA 1MZFA 4LFAO 4FLYA 3ABTA 4DK0A 4MTGA 2UU9O 3T1YB 4X1IB 1T5EA 4CS4A 4P9PA 5JJJB 1WLEA 4DV6B 5FNVB 2RDCA 5JJNB 4EFBA 5LP6C 5EZYA 3RGBA 4B7KA 5L3GA 2FB5A 1FAFA 5A2QN 1L0LH 5L3CA 5KUKA 3AG3C 1SA0A 5A9GA 4LF8O 2ITDC 5KA6A 1MSWD 1V55B 2EX3A 4UV9A 5J2UA 4XDJA 2HJDA 4HNAA 2PF4E 3ZRVA 3OR6C 4I55A 1SESA 5CBGA 2GBOA 2AHZA 1Q90D 2F43G 3KCYA 4DW0A 4FLXA 5LA6B 4FZ1A 4K0KB 1OCCB 5IT9N 3OMIB 3CP1A 4DR5B 1HDJA 2XAHA 1V54C 2UXDB 1OZ0A 1N36B 4MTXA 4KHPO 1VQNV 2WAMA 3JASB 1R3IC 3ZHTA 4O4IA 1Z5WA 4I5SA 3RW0A 4I50A 4W4KA 4DUZB 2OTLV 3CCRV 4NXMO 1I94O 5IYZA 4FM2A 4IIJB 2JRIA 1JQ0A 5C8YB 1S72V 1I7FA 1JMKC 4DV7B 3QO7A 3SR2C 4CZZA 2Y0IA 4CH4A 3QVNA 1F4MA 3AG7A 4ZHQB 1M57B 5J9PC 5LP6B 5TISZ 1IBLB 1H5WA 3K0DA 2HKOA 1Y76B 4ICGA 5GTHZ 5IJ9A 3OMNB 4DRXA 4LNUA 3UO3A 4PA4A 5CB4B
chains in the Genus database with same CATH topology
1N0NA 3AK3A 1I0HA 4X9QA 3EVKA 1GN2A 5A9GA 1IXBA 3DC5A 3OT7A 1Y67A 1BSMA 1XUQA 1MNGA 1LUVA 2CE4A 3MDSA 1KKCA 1AR5A 3LSUA 1IDSA 1ZUQA 1AR4A 1AP6A 1BT8A 1P7GA 3AK1A 1MMMA 1MSDA 2CDYA 5AG2A 4JZGA 1VARA 2RCVA 3IC9A 1I08A 1EN6A 1BS3A 3C3SA 3TJTA 2QKAA 4FFKA 4BR6A 3KDRA 1EN4A 4GUNA 4F6EA 3AK2A 3CEIA 1GN3A 1EN5A 1ZLZA 4JZ2A 4YIPA 1PL4A 1VEWA 2ADQB 4YIOA 1QNMA 1MA1A 1ZSPA 1WB7A 1SZXA 1XILA 4C7UA 1B06A 1ZTEA 1LUWA 3RN4A 2P4KA 1N0JA 3DC6A 3K9SA 1JR9A 1GN6A 3BFRA 3QVNA 3C3TA 1IX9A 3KKYA 1AP5A 1D5NA 1GN4A 1JA8A 4JYYA 2ADPA 1XREA 2GDSA 2QKCA 1XDCA 1AVMA 1WB8A 1EM1A 1PM9A 2AW9A 4E4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N0N A;  3AK3 A;  1I0H A;  4X9Q A;  3EVK A;  1GN2 A;  5A9G A;  1IXB A;  3DC5 A;  3OT7 A;  1Y67 A;  1BSM A;  1XUQ A;  1MNG A;  1LUV A;  2CE4 A;  3MDS A;  1KKC A;  1AR5 A;  3LSU A;  1IDS A;  1ZUQ A;  1AR4 A;  1AP6 A;  1BT8 A;  1P7G A;  3AK1 A;  1MMM A;  1MSD A;  2CDY A;  5AG2 A;  4JZG A;  1VAR A;  2RCV A;  3IC9 A;  1I08 A;  1EN6 A;  1BS3 A;  3C3S A;  3TJT A;  2QKA A;  4FFK A;  4BR6 A;  1EN4 A;  4GUN A;  4F6E A;  3AK2 A;  3CEI A;  1GN3 A;  1EN5 A;  1ZLZ A;  4JZ2 A;  4YIP A;  1PL4 A;  1VEW A;  2ADQ B;  4YIO A;  1QNM A;  1MA1 A;  1ZSP A;  1WB7 A;  1SZX A;  1XIL A;  4C7U A;  1B06 A;  1ZTE A;  1LUW A;  3RN4 A;  2P4K A;  1N0J A;  3DC6 A;  3K9S A;  1JR9 A;  1GN6 A;  3BFR A;  3QVN A;  3C3T A;  1IX9 A;  3KKY A;  1AP5 A;  1D5N A;  1GN4 A;  1JA8 A;  4JYY A;  2ADP A;  1XRE A;  2GDS A;  2QKC A;  1XDC A;  1AVM A;  1WB8 A;  1EM1 A;  1PM9 A;  2AW9 A;  4E4E A; 
#chains in the Genus database with same CATH topology
 1FPO A;  2Y48 A;  1P7B A;  4AHC A;  4WF9 V;  2KKW A;  4JI4 B;  1FFX A;  3Q4H A;  5F2V O;  5LBQ A;  4YHH B;  2Q9L A;  4JF3 A;  2VWJ A;  5BR8 B;  3LSQ A;  1KKC A;  4X62 O;  1BQ0 A;  2YIB D;  1VF5 B;  2HVK C;  2FYU H;  1MSD A;  4GYC B;  1QU7 A;  3E22 A;  4DV4 O;  2GV9 A;  3J81 N;  1E1Q G;  3G71 V;  4WFA V;  1F23 A;  1JOY A;  5KAF Z;  5GON B;  3N2K A;  3QTC A;  2MW2 B;  1QR9 A;  4GX0 A;  2F93 B;  2R9I A;  3UO2 A;  3AG2 B;  1GTO A;  1XMQ B;  2PTM A;  2RN9 A;  1SKV A;  4UCS A;  3JSL A;  5IWA B;  1KBH A;  1P4R A;  2GHY A;  2BE3 A;  3CRQ A;  2YSU B;  4LFC B;  3GVM A;  4PHZ A;  3E2E A;  5LYJ B;  1SZT A;  1S5J A;  4TT3 G;  4ZOL A;  4I0X A;  3KCX A;  4WBN B;  4X1K A;  4K35 A;  4LH6 A;  5JH7 A;  3FB8 C;  4J9Z B;  3CCM V;  1VP7 A;  1B04 A;  2UXB B;  1VQ9 V;  1HWY A;  2RNB A;  2A7W A;  4DR1 O;  4TV8 B;  4R7C A;  1J5E B;  4B3T O;  2ZM6 O;  2YI8 A;  3A0H Z;  3CRM A;  5JQG A;  2YEV B;  3N2G A;  1FXK A;  1H2M A;  2WSS G;  4RO2 A;  2JGD A;  2HP8 A;  1DF5 A;  4LR3 A;  4IHJ B;  1PKX A;  3CX5 F;  1TVK A;  4NKG B;  1OCO B;  1CP9 A;  4CBC A;  1RP3 B;  1N0N A;  4QGP A;  4JI5 B;  1GM7 A;  4NVP A;  3RYF A;  5B3S B;  3WB2 A;  3L72 H;  1NH2 B;  1CXZ B;  5KAI Z;  1VQP V;  3SYO A;  3K04 A;  3BEH A;  3QO8 A;  3H1J H;  4MVR A;  5GW7 A;  4DR7 B;  2VWK A;  4J41 A;  4B3S O;  4QJF B;  1IBK O;  3ABK C;  4GKJ O;  1HNX O;  1RM1 C;  1BT8 A;  4O2B B;  1BHA A;  2Q8V A;  3E8B A;  4GX5 A;  1FKA O;  1JNB A;  2C2A A;  3GWO A;  1GK9 A;  2EZO A;  3T4D A;  3EHB B;  2DWD C;  4EB6 B;  1L8D A;  4UCR A;  3K57 A;  4IGG A;  3SPH A;  3FYE B;  5B66 Z;  4J10 A;  3ABL B;  4H13 B;  4DYL A;  2QGN A;  3LDC A;  4UFZ A;  1HNW B;  4B3M O;  4RAI A;  2WLL A;  2OIE A;  3JD4 A;  3RT3 C;  1NBM G;  2QWR B;  4I4T A;  5J2T A;  4OX9 O;  2JS3 A;  3OEE G;  4X66 B;  2D3O W;  3CCU V;  1B06 A;  3P32 A;  2Y0P A;  2F4V B;  1N34 O;  4UUJ C;  3ASO C;  3BFR A;  1TGO A;  4DR2 B;  2CUG A;  1GO3 F;  1NI8 A;  4O4H A;  1XRE A;  3SPC A;  1AJQ A;  3R66 A;  3JCZ A;  1MG1 A;  1FXH A;  3UKM A;  1RPR A;  2PZS A;  3ZS8 C;  3G80 A;  4RWU A;  1SQQ H;  1Y4M A;  4H0L B;  2ODM A;  4LF5 O;  4GKK O;  4EFE A;  4DV0 B;  2EIJ C;  1FD9 A;  1Q8I A;  5B1B B;  1CPY A;  4FLT A;  3SYA A;  3B8M A;  1LNQ A;  3ASN C;  1KEC A;  1M56 B;  4O4L A;  1AR5 A;  3TGU H;  3JYC A;  2XTA A;  1AP6 A;  4JI8 O;  2QM7 A;  3VBB A;  4I9Q A;  3JAR B;  4LF7 B;  2M6Y A;  3U11 A;  2OIG A;  1JFF A;  4OPA A;  4BW5 A;  2K1E A;  1SA0 B;  4KUM A;  5IDJ A;  2LGQ A;  2ZR2 A;  3LDD A;  1I08 A;  2ZE5 A;  3H1L H;  1WP7 A;  3CB2 A;  5J2U B;  1W59 A;  4FFK A;  1K4C C;  4FM1 A;  2A0L A;  4WFE A;  4LH7 A;  1K97 A;  3A0B Z;  3LNN A;  2JK5 C;  2BTQ B;  4WFH A;  2OCC B;  1Q5O A;  3SGI A;  3CMA V;  1AI7 A;  5H9C A;  4DUY B;  3K5N A;  4LC1 A;  1PL4 A;  1ZAU A;  4LF4 O;  2ADQ B;  1TAE A;  1Q6I A;  5E1A C;  1M4U A;  4JI6 O;  3STZ C;  1R73 A;  5ITZ A;  1SQB H;  2X6B A;  2GUZ A;  3WB1 A;  4I9W A;  2UXX A;  4F6R A;  4TWK A;  2EIM B;  1URF A;  4KP4 A;  4UVB A;  4DR4 O;  1YI2 V;  4TUY A;  4JPR A;  1ARO P;  4DV1 B;  4O4I B;  1WPX A;  2NNU A;  5KLV H;  3K58 A;  3CXC U;  2DYS C;  1AI4 A;  3AG1 B;  4AQY O;  3H1H H;  1D2D A;  2IJJ A;  1S0V A;  1SQF A;  2HHH B;  2QDO A;  2CE4 A;  1HNZ B;  1E1R G;  3CC4 V;  3OEH G;  1KC8 W;  4P9O A;  4LNU B;  2VQF B;  2ZDI C;  2EJR A;  1OCR C;  3WB0 A;  1MMM A;  1H8E G;  5AG2 A;  3IFX A;  1XNR B;  1Y74 B;  1H2K A;  3I55 V;  2CTP A;  2X6A A;  2R70 A;  2BOB C;  3OR7 C;  1B6Q A;  1BS3 A;  2LFR A;  3L71 H;  3JSN A;  3WG7 B;  1WA8 A;  1ROP A;  3LNM B;  1XL6 A;  4FLV A;  2ZE8 A;  1U97 A;  1TUB B;  1SS3 A;  3E22 B;  4ZI7 A;  1V55 C;  3F7Y C;  3JAK A;  5EIB D;  4A5U B;  2Q0A A;  2VQE B;  1YJN V;  2DQ0 A;  3NXS A;  2Q73 A;  2DW4 A;  2LQT A;  1MA1 A;  3UT5 B;  3FAV A;  1WB7 A;  3KZI Z;  4IT5 A;  2PGG A;  3N2K B;  3HKC A;  3G4S V;  1JJ2 U;  5L3E A;  2QM8 A;  5KMG B;  1N0J A;  3K9S A;  1ZWI C;  4JGS A;  2HEP A;  2K9P A;  3HKE A;  4DV2 B;  3K5M A;  2DYS B;  4PA9 A;  4JAS A;  1XMO O;  2QM4 A;  1OCC C;  2P6J A;  5B1O A;  3CRA A;  3JAW A;  3U10 A;  2XUM A;  4LWS B;  2BCC H;  3RYC A;  3ZED A;  4J7J A;  1W0J G;  4LFA B;  2FTK A;  4ZKI A;  5CMU A;  4H37 A;  4E4E A;  2DE0 X;  1BHB A;  2Q6A A;  4Q20 A;  4LFB O;  1NU1 H;  4BAY A;  2UXC B;  1PP9 H;  5EBM C;  3CCQ V;  2P06 A;  2P5O A;  1BSM A;  4MVQ A;  5JQG B;  5L3D A;  3SYQ A;  5LMU B;  3SPJ A;  2JGD B;  2YUA A;  4LF8 B;  1M57 C;  2YIC A;  2YS8 A;  4GX1 A;  2XAG A;  1TVK B;  4JI2 O;  4TSF G;  1WN7 A;  2QWQ B;  3JD0 A;  2ZIN A;  1PPJ H;  2Y4U A;  3JAT A;  2RCV A;  4U3J A;  5KUM A;  2Q0O C;  2JEX A;  3ZMS A;  4NTX A;  3CC2 V;  4X64 O;  1WPB A;  2XND G;  2N04 A;  3CME V;  2OYQ A;  3OD4 A;  1RPO A;  2OT5 A;  2HVJ C;  3G6B A;  4FLW A;  1NTZ H;  3APO A;  2UXN A;  4HAM A;  4FMT A;  2EIK B;  2Y69 B;  2QE7 G;  4ASU G;  5JVD A;  4PI2 A;  1AB3 A;  3DXR B;  2BSK A;  2BTO A;  3CXH F;  3T1H B;  1D5A A;  3RVZ A;  4KHP B;  1O9G A;  2F95 B;  1SZX A;  4JTC B;  4HZ3 A;  3RFR A;  4RQE A;  1LUW A;  1YJ9 V;  1R6N A;  1YTF D;  5LHG A;  1GN6 A;  5CA3 A;  4GT1 A;  2WLL B;  4NXM B;  3HPL C;  3BA9 A;  1BE3 H;  3ZRW B;  3T4Z A;  2KG7 A;  3THO A;  3OGI B;  2YXY A;  4I4T B;  3AG2 C;  2LGW A;  2LW1 A;  3CE2 A;  1IJG A;  2UUB O;  1Q82 W;  1JJO A;  1PM9 A;  2W6J G;  4L87 A;  2CTR A;  2G38 A;  2ZXW B;  3FKS G;  5K1P A;  3AK3 A;  3CWB H;  4YY3 O;  4GZR B;  1F51 A;  4O4H B;  1Q6U A;  1AIL A;  2WLI A;  1NZ6 A;  3TET A;  2YXL A;  2IW5 A;  3I56 V;  3S3W A;  2DOS A;  2DJV A;  1OHH G;  1VMG A;  4L8J A;  4DUZ O;  2LO1 A;  1K3E A;  2E76 B;  2WLN A;  1IBM B;  3UQ8 A;  4X62 B;  1V9P A;  4J11 A;  3D36 A;  3D3Q A;  3TXQ A;  3RVY A;  2PY5 A;  1Z2G A;  4R6Z A;  1OCO C;  3FB5 C;  4O4L B;  2QKA A;  1IBL O;  1UFI A;  4BR6 A;  3JAL A;  1VF7 A;  2QR4 A;  3CD6 V;  3CCV V;  4JYA B;  1YF2 A;  5B3S C;  2EBO A;  2Q69 A;  4X1Y A;  1YHQ V;  3H9V A;  4PJ0 Z;  2D2C B;  1MOF A;  4MTO A;  1JFF B;  1EFR G;  2XT9 A;  5BMV A;  2UUA O;  2XOK G;  4Z2W A;  1ZSP A;  3K59 A;  3BY6 A;  5IJ0 B;  4X65 O;  3E8H A;  1QLE C;  5IYC O;  1G1X B;  3DC6 A;  1SQX H;  1N33 B;  2L35 A;  1Q7Y W;  1K7D A;  3DTU B;  5BR8 O;  5KA5 A;  2WLH A;  3QF7 A;  4N21 A;  3I5D A;  3CCE V;  5D5P A;  3E8G A;  1XEQ A;  5FL7 G;  1Y6X A;  3ABL C;  1KU9 A;  4DR1 B;  5CA0 B;  2H94 A;  4B3T B;  2B9Z A;  1KUQ A;  1ORQ C;  4JAV A;  5ITZ B;  1EM1 A;  4J42 A;  1L1F A;  1FYJ A;  4GX2 A;  3BHP A;  2ZNI A;  2YXH A;  4P2Z A;  3D3I A;  3L73 H;  1W2B U;  4LF6 B;  4WFB V;  2WA3 A;  1QQC A;  3K0G A;  2P90 A;  4K8Z A;  4LF9 O;  5DEC A;  4YJ3 B;  5HFL A;  4YJ2 A;  3AG4 B;  3A8T A;  4TOI A;  2XAS A;  2AHY A;  3LSU A;  1VIB A;  1I5Y A;  3RYI A;  4FFB A;  1GKF A;  2KSD A;  3C90 A;  3JAM N;  2UXB O;  3MHS C;  1WNS A;  1X4T A;  4X20 A;  3W7S A;  3G67 A;  4X1I A;  1Q43 A;  4B3S B;  2W6I G;  3ETQ A;  4FIP C;  4TQD A;  1HNX B;  4JV5 O;  4J80 A;  1J5E O;  3P3N A;  1VF6 C;  4K8X A;  2MK3 A;  4HYO A;  3T1C A;  3HKB B;  3IC7 A;  4JI3 O;  1YEW A;  5B1B C;  4PD4 F;  1JCH A;  1QLE B;  1R3K C;  1IVS A;  1ZL8 A;  5B5E Z;  1SQP H;  4BIU A;  4DO2 A;  1M56 C;  1VQ6 V;  3K5L A;  4P30 A;  1KP2 A;  4CS3 A;  2IJI A;  4YIO A;  4PEL A;  1WP8 A;  3B09 A;  2XHB A;  3ABM B;  2XAF A;  3LUT B;  2P4K A;  3E8F A;  4QPK A;  4DV5 O;  3QO5 A;  3S3X A;  3C3T A;  4X89 A;  1D5N A;  2YIB A;  4QE9 A;  1GN4 A;  1NVP B;  5CBH A;  5IY5 B;  2Z3Y A;  1N34 B;  1H2G A;  4UCO A;  3VQW A;  5LL6 Y;  4AIL C;  3CPW U;  3ZMU A;  5LMN B;  1UPG A;  1XDC A;  2YI9 A;  2N74 A;  2OCC C;  1NS1 A;  4KL1 A;  3SJQ C;  3E35 A;  3E89 A;  3RYH A;  5JCO C;  5LXT A;  3W7X A;  2GSM B;  3FB7 C;  1HNW O;  2PI4 A;  1NTK H;  1QLN A;  5H6R A;  4FZ0 A;  4MVO A;  5H6Q A;  4QIW F;  1S5L Z;  4LF5 B;  1RFY A;  5C8Y A;  1GM8 A;  4GKK B;  3X2Q B;  2R9R B;  2R9A A;  2EIM C;  1FJG B;  2PYL A;  1XNQ O;  4PDR A;  1K34 A;  3F5W C;  3VQY A;  4ZHQ A;  5LP6 A;  4NXN B;  2EIL B;  4JI1 O;  1P49 A;  4NR1 A;  1AR1 B;  4DR2 O;  2CTW A;  2AZ2 A;  1KMI Z;  1XL4 A;  4JI8 B;  1IXM A;  3AG1 C;  5D5Q A;  1BZK A;  4U3F H;  4LBE C;  5CB4 A;  4JI0 O;  3BAB A;  3AK2 A;  4OXS A;  4DR6 O;  1RSO A;  4PV1 B;  5EZY B;  5DN6 G;  4O4J A;  3CSX A;  4CH3 A;  1DLB A;  4YIP A;  3PN1 A;  2Q7E A;  3JCU Z;  3ETD A;  1TA8 A;  2W0X A;  1OJH A;  1M1K W;  4MTF A;  3SPI A;  1PV0 A;  1FFT B;  3B40 A;  2N05 A;  1S76 D;  4HNA B;  4I55 B;  3KKY A;  4JI6 B;  1VQM V;  3RWR D;  1K92 A;  1K4D C;  5GON A;  3WG7 C;  3ZX6 A;  3SPG A;  1R3J C;  1BMF G;  4B3R O;  2PI5 A;  2QJ1 A;  5CBF A;  3TK1 A;  4XDK A;  3KG2 A;  4DR4 B;  2QSA A;  3CCS V;  4BW9 A;  2AGA A;  3ZMZ A;  1DGS A;  1COW G;  5KHG A;  5L3B A;  3EVK A;  3L70 H;  2DYR B;  4MVU A;  2ETN A;  2KG7 B;  2XAJ A;  5CN0 A;  4AQY B;  1MAB G;  5JJE B;  4I50 B;  5GTI Z;  1PNM A;  3OTO O;  1S5H C;  5L3F A;  5IYZ B;  3CCL V;  1H38 A;  1ZUQ A;  4WFG A;  1OCZ B;  1EBO A;  3O65 A;  3H01 A;  2UUC O;  4JI7 O;  3DGE A;  4B08 A;  1VAR A;  1M5I A;  4G27 B;  3AEI A;  3MAQ A;  2ZCE A;  3IJ4 A;  2YEV A;  2QEX V;  5FPO A;  4JTD B;  2WLI B;  2E5L B;  2LFS A;  5IJ9 B;  4IHJ A;  1QBZ A;  4DRX B;  4DK1 A;  1ZX3 A;  1DTO A;  4CH6 A;  2JIZ G;  3M7M X;  4F4L A;  3L9D A;  2P7T C;  3B8N A;  4UCU A;  1BL8 A;  5EK0 A;  1FFX B;  4QNH B;  1KB9 F;  3OTF A;  3Q4H B;  4FLZ A;  3OAA G;  1QNM A;  4X88 A;  1G8M A;  1N32 B;  3EXA A;  1K5Q A;  1F4N A;  3ZMT A;  3JAL B;  1HR0 B;  4FLU A;  1JR9 A;  4O2B A;  2OCH A;  1HNZ O;  2W0F C;  3ML0 A;  4X1Y B;  3L75 H;  4DV3 O;  1IZ3 A;  4UV8 A;  1JA8 A;  4EB6 A;  2Q68 A;  1THZ A;  3H1I H;  4HBN A;  3TCU A;  2A06 H;  3M8A A;  3T2M A;  2FL4 A;  2GDS A;  3CJH A;  3HKD A;  1XMO B;  3ZRX A;  3VOU A;  1AVM A;  4GLX A;  1AI6 A;  2ATK C;  1LR1 A;  2EIK C;  2Y69 C;  5KX5 A;  1I5X A;  4XBF A;  2ITC C;  2IU0 A;  1GN2 A;  3RBZ A;  4JTA B;  2IJK A;  2A3Q A;  4ZOL B;  2F23 A;  4I0X B;  2HJF C;  4X1K B;  2JVD A;  2JEU A;  3CRR A;  4J9Y B;  4LFB B;  5JH7 B;  3GWK C;  1GMG A;  4DR3 O;  1XHX A;  5IYB O;  3QG5 A;  2VQE O;  4K3A A;  1X59 A;  2UU9 B;  1DF4 A;  3BPZ A;  3TXS A;  4MVS A;  4D6T H;  1F7Y A;  1JVM A;  4JZG A;  3SYC A;  3STL C;  2H3O A;  1PL0 A;  3K06 A;  4DV2 O;  1IUR A;  3C3S A;  4G28 B;  4JI2 B;  3SJB C;  5B1A B;  4YJ2 B;  3FYI B;  3N2G B;  3CRC A;  1FXK B;  1YVW A;  1M90 W;  1S3J A;  3F5T A;  2ZXW C;  3KDR A;  1KYO F;  4U7N A;  2CH7 A;  4H44 B;  4TQF A;  4JAA A;  3RYI B;  4FFB B;  4X64 B;  4WFF A;  4X20 B;  3RYF B;  2ZT9 B;  1SC5 B;  3OE7 G;  1Z5V A;  2IM9 A;  3CS5 A;  4OPH A;  1ZTE A;  2UXC O;  3ZCC A;  2F66 C;  4B7E A;  4W4L A;  2X7R B;  2QKS A;  5EBL C;  3T1Y O;  1OV9 A;  1R6K A;  3CYO A;  3JAR A;  5LMU O;  1IX9 A;  4TV9 A;  4DV6 O;  4MS2 A;  1ZL8 B;  4UCT A;  1BQZ A;  1Q3E A;  3VQX A;  3A2F A;  2P67 A;  2Q4P A;  1E79 G;  4PDV A;  4YXW G;  4MVZ A;  3B77 A;  2EIN B;  3A0R A;  4R50 A;  5IE9 A;  4RQF A;  3SYP A;  2BTQ A;  2B5U A;  2Q5Z A;  3OFN G;  3BCC H;  2QTO A;  5B1N A;  5JCO A;  4X9Q A;  1I94 B;  5BZB A;  2UUB B;  1QVG U;  3APQ A;  3OT7 A;  1YCI A;  3FFQ A;  5J2T B;  2YID A;  1MNG A;  3MDS A;  1QCE A;  3ZHV A;  2AXT Z;  1YJW V;  3HB3 B;  4YY3 B;  1H8H G;  1YIT V;  4NYK A;  3CCJ V;  3NR7 A;  3T1H O;  1AR4 A;  2OWO A;  2YDE A;  2CAZ C;  1EZV H;  2P22 C;  4K0K O;  3RYH B;  5DED A;  5LXT B;  1JX9 A;  4DR5 O;  1L0N H;  2UXD O;  1N36 O;  2WWW A;  3ZIA G;  1PNL A;  2IH3 C;  5EYP A;  3ZHQ A;  3OUS A;  1GAX A;  4GUN A;  3OUF A;  1QVF U;  2RJZ A;  2M7W A;  2KB1 A;  3AG4 C;  4DV7 O;  1NQT A;  3FB6 C;  1YZB A;  1US6 A;  3AG3 B;  5IYD O;  1HW7 A;  1KQS U;  4C7U A;  5CA1 A;  1YSC A;  4DV4 B;  3LDE A;  3O9O A;  3G6E V;  4UB8 Z;  2Q7H A;  4IYH A;  2UUA B;  3W7U A;  1RSO B;  3ZHR A;  1Y74 A;  1WAZ A;  4BIZ A;  2JS5 A;  4X65 B;  2ZKO A;  4O4J B;  2JDI G;  1R6T A;  1IBM O;  4FJC C;  2R72 A;  4JAU A;  1QHT A;  4JI4 O;  3L74 H;  4O2A A;  2AW9 A;  2IH1 C;  1P84 F;  4YHH O;  1EZJ A;  1TUB A;  1FOU A;  1I0H A;  1V54 B;  4JYA O;  1IXB A;  4UCV A;  5EC1 C;  4BWA A;  5LOV A;  1S77 D;  3ABM C;  3UT5 A;  1YIJ V;  1PNK A;  2LW7 A;  2NR5 A;  2Z0A A;  5KMG A;  2WLJ A;  1VQK V;  2ZM6 B;  3W7T A;  4UB6 Z;  2GUZ B;  4KXR A;  5IY5 C;  4LF9 B;  2HLD G;  4F6R B;  1VQO V;  1U96 A;  3K3W A;  2DMX A;  2Z5U A;  2NLJ C;  1VQL V;  1XMQ O;  1N33 O;  2Q7G A;  2JJ1 G;  4D7S A;  4UVC A;  4LWS A;  1N4C A;  3IC9 A;  5IWA O;  3H1K H;  3OGC C;  2WA4 A;  4TUY B;  1VQ5 V;  1FXV A;  3OM3 B;  4LFC O;  2BOC C;  2NN4 A;  1WJZ A;  1FS0 G;  2GTA A;  2WLM A;  1EN4 A;  3J7A U;  3IAY A;  3ABU A;  2FKX A;  2ZDI A;  1JPX A;  4JV5 B;  4G2K A;  1NR7 A;  2H8P C;  3X2Q C;  1AJN A;  1VEW A;  1W0K G;  2CK3 G;  4JI3 B;  1A32 A;  1IBK B;  2ZE7 A;  4JYC A;  4GKJ B;  2ILM A;  4ZBM A;  3ZN0 A;  1XIL A;  5FNV A;  4Z1V A;  4LF6 O;  1XHZ A;  1YDX A;  1XBL A;  5BY1 A;  1VQ8 V;  1VQ4 V;  3BAA A;  2EIL C;  4UVA A;  3K5O A;  1K73 W;  1K5S A;  4MSW C;  1R3L C;  5KHJ A;  2V7Q G;  5KHI A;  4EEQ A;  2ADP A;  5LGT A;  3ZMV A;  1K33 A;  3ZHS A;  4DV5 B;  4B3M B;  1G4Y B;  1Q6H A;  4JI5 O;  2QWN B;  3ETE A;  2DWE C;  2RMK B;  1WA8 B;  4OX9 B;  4NTW A;  1G6U A;  1AJP A;  2LP7 A;  2ZIM A;  3ICX A;  3DSQ A;  4DR7 O;  1R1B A;  3DXR A;  4J7K A;  1HP8 A;  1VQ7 V;  3DC5 A;  4ZI7 B;  1XUQ A;  3JAK B;  3K9A A;  5LA6 A;  4CH5 A;  2QA4 V;  5HFM A;  2L6L A;  1LUV A;  3JD1 A;  1SQG A;  3M99 B;  1B3Q A;  1NT2 B;  3CJH B;  3FAV B;  3HKD B;  4MW8 A;  3CC7 V;  4UXN A;  3HKC B;  4N23 A;  3ZHU A;  5LGN A;  4NTY A;  1P7G A;  4CS2 A;  3ZRW A;  3MD0 A;  5KX5 B;  2CDY A;  3MHH C;  3HKE B;  4AI8 A;  3JAS A;  4Q6G A;  4RUF A;  2XAQ A;  4BIO A;  1EN6 A;  2QTS A;  5BXZ A;  1XNQ B;  3JAW B;  2OTJ V;  1CEZ A;  1O9H A;  2B1I A;  4IIJ A;  1N8R W;  4MT8 A;  3SJA C;  3RYC B;  4QE7 A;  3K08 A;  4JI1 B;  2ZD9 A;  1NH2 D;  1TUE B;  1M93 A;  2DYR C;  4X66 O;  5LMN O;  1GN3 A;  3K79 A;  1GRJ A;  4U7O A;  2F4V O;  2P4V A;  5K1X A;  5H2F Z;  1Y76 A;  4JI0 B;  5EIB C;  3VQV A;  4EKW A;  4DR6 B;  4JYB A;  5FLX N;  3B2E E;  1OCZ C;  2WLK A;  3K03 A;  5EBW C;  2CH7 B;  2PYJ A;  2A79 B;  2E75 B;  2DQ3 A;  4MVM A;  2X0L A;  2E3C A;  5KHH A;  4KFM A;  3F7V C;  1FJG O;  3P30 A;  3ABK B;  1RM1 B;  2YC0 A;  4DXW A;  1MZE A;  1AI5 A;  1KD1 W;  3JAT B;  4U3J B;  4NXN O;  5LHH A;  1M9N A;  1Q86 W;  4DV0 O;  3OW2 U;  5H5N A;  2QKC A;  4PDM A;  1NVP D;  4PA3 A;  4PA6 A;  3R65 A;  2JJ2 G;  2EUL A;  4LF4 B;  3D36 C;  4B3R B;  2ZNJ A;  3EFF K;  4TV9 B;  3FD9 A;  4PI0 A;  4QPJ A;  1SQV H;  2HFE C;  5JVD B;  5IJ0 A;  2V1D A;  2BSK B;  5JWP A;  4LF7 O;  1SET A;  3JD2 A;  4D7T A;  2O57 A;  4H33 A;  1IDS A;  2RQ6 A;  3WU2 Z;  3WFV A;  2EJ7 A;  3ASO B;  5LYJ A;  2IJH A;  3OTO B;  2VRZ A;  3HR0 A;  2Y4T A;  4WBN A;  2V4D A;  4FVM A;  5CA0 A;  4XDL A;  4E2L A;  1KP3 A;  3TJT A;  4FK5 C;  5LGU A;  2KQX A;  2UUC B;  4JI7 B;  2WPD G;  1XQ8 A;  2JGU A;  3BA8 A;  4DUY O;  4F6E A;  4NB5 A;  2HR3 A;  4TV8 A;  3U0Z A;  3D8C A;  5LHI A;  1EN5 A;  1SF9 A;  1ZLZ A;  4JZ2 A;  2VS0 A;  2ZR3 A;  2QWO B;  4YJ3 A;  2EIJ B;  3W7W A;  1YXB A;  4GCZ A;  1SER A;  5EYP B;  3ASN B;  1BGY H;  1Y66 A;  2DN9 A;  4DV1 O;  2ZIO A;  1H2N A;  2CTQ A;  3OMA B;  3SDL A;  3ZBH A;  1UJW B;  1BCC H;  2IU3 A;  1KKD A;  4CC6 A;  1NKD A;  2ZE6 A;  4JYY A;  5B1A C;  3GB7 C;  1FXK C;  1XI1 A;  2PUS A;  3N27 A;  3B4S A;  1K8A W;  4DV3 B;  3CHX A;  4LP8 A;  3BVO A;  5CA1 B;  2YIA A;  1WB8 A;  3HKB A;  1H2L A;  2HHH O;  4LCU C;  2GTS A;  4I7Z B;  1PD3 A;  2E5L O;  3FX7 A;  3QNE A;  3E86 A;  3LSS A;  4PA7 A;  2VQF O;  2EZP A;  1QR8 A;  1NJI W;  2FML A;  1Y67 A;  3SJC C;  4J7Z A;  2B1G A;  5EC2 C;  2CGN A;  5BMV B;  1XNR O;  3J80 N;  3BRC A;  3ETG A;  4O2A B;  2AZ0 A;  1N32 O;  4MW3 A;  3AK1 A;  2QWP B;  1NR1 A;  4ABM A;  1HR0 O;  4DR3 B;  4ZIB A;  2LJ2 A;  3IGA C;  5LOV B;  2EIN C;  4Z1M G;  2HG5 C;  4IL6 Z;  1Q81 W;  1K9M W;  1GH6 A;  2ARH A;  5KHK A;  5E79 Z;  2A9H A;  3ZJZ A;  1J95 A;  1SRY A;  3UM7 A;  1XOU A;  3CEI A;  2F1M A;  3ZRS A;  4CC5 A;  3UCS C;  4RUE A;  3ZN1 A;  4IYI A;  3P3P A;  2Q67 A;  5C93 A;  2CGO A;  4DW1 A;  1YTF B;  1H2S B;  3PJS K;  4PDL A;  2IBZ H;  2X6C A;  3RN4 A;  5FPR A;  3E83 A;  3JD3 A;  1GM9 A;  1VF6 A;  4OGQ B;  1DK1 A;  4R8C A;  5DM6 V;  4WCE V;  1NTM H;  4FM0 A;  1ENV A;  4FPP A;  2E74 B;  1AP5 A;  1OCR B;  2ZQM A;  4X8A A;  1MZF A;  4LFA O;  4FLY A;  3ABT A;  4DK0 A;  4MTG A;  2UU9 O;  3T1Y B;  4X1I B;  1T5E A;  4CS4 A;  4P9P A;  5JJJ B;  1WLE A;  4DV6 B;  5FNV B;  2RDC A;  5JJN B;  4EFB A;  5LP6 C;  5EZY A;  3RGB A;  4B7K A;  5L3G A;  2FB5 A;  1FAF A;  5A2Q N;  1L0L H;  5L3C A;  5KUK A;  3AG3 C;  1SA0 A;  5A9G A;  4LF8 O;  2ITD C;  5KA6 A;  1MSW D;  1V55 B;  2EX3 A;  4UV9 A;  5J2U A;  4XDJ A;  2HJD A;  4HNA A;  2PF4 E;  3ZRV A;  3OR6 C;  4I55 A;  1SES A;  5CBG A;  2GBO A;  2AHZ A;  1Q90 D;  2F43 G;  3KCY A;  4DW0 A;  4FLX A;  5LA6 B;  4FZ1 A;  4K0K B;  1OCC B;  5IT9 N;  3OMI B;  3CP1 A;  4DR5 B;  1HDJ A;  2XAH A;  1V54 C;  2UXD B;  1OZ0 A;  1N36 B;  4MTX A;  4KHP O;  1VQN V;  2WAM A;  3JAS B;  1R3I C;  3ZHT A;  4O4I A;  1Z5W A;  4I5S A;  3RW0 A;  4I50 A;  4W4K A;  4DUZ B;  2OTL V;  3CCR V;  4NXM O;  1I94 O;  5IYZ A;  4FM2 A;  4IIJ B;  2JRI A;  1JQ0 A;  5C8Y B;  1S72 V;  1I7F A;  1JMK C;  4DV7 B;  3QO7 A;  3SR2 C;  4CZZ A;  2Y0I A;  4CH4 A;  3QVN A;  1F4M A;  3AG7 A;  4ZHQ B;  1M57 B;  5J9P C;  5LP6 B;  5TIS Z;  1IBL B;  1H5W A;  3K0D A;  2HKO A;  1Y76 B;  4ICG A;  5GTH Z;  5IJ9 A;  3OMN B;  4DRX A;  4LNU A;  3UO3 A;  4PA4 A;  5CB4 B; 
#chains in the Genus database with same CATH homology
 1N0N A;  3AK3 A;  1I0H A;  4X9Q A;  3EVK A;  1GN2 A;  5A9G A;  1IXB A;  3DC5 A;  3OT7 A;  1Y67 A;  1BSM A;  1XUQ A;  1MNG A;  1LUV A;  2CE4 A;  3MDS A;  1KKC A;  1AR5 A;  3LSU A;  1IDS A;  1ZUQ A;  1AR4 A;  1AP6 A;  1BT8 A;  1P7G A;  3AK1 A;  1MMM A;  1MSD A;  2CDY A;  5AG2 A;  4JZG A;  1VAR A;  2RCV A;  3IC9 A;  1I08 A;  1EN6 A;  1BS3 A;  3C3S A;  3TJT A;  2QKA A;  4FFK A;  4BR6 A;  3KDR A;  1EN4 A;  4GUN A;  4F6E A;  3AK2 A;  3CEI A;  1GN3 A;  1EN5 A;  1ZLZ A;  4JZ2 A;  4YIP A;  1PL4 A;  1VEW A;  2ADQ B;  4YIO A;  1QNM A;  1MA1 A;  1ZSP A;  1WB7 A;  1SZX A;  1XIL A;  4C7U A;  1B06 A;  1ZTE A;  1LUW A;  3RN4 A;  2P4K A;  1N0J A;  3DC6 A;  3K9S A;  1JR9 A;  1GN6 A;  3BFR A;  3QVN A;  3C3T A;  1IX9 A;  3KKY A;  1AP5 A;  1D5N A;  1GN4 A;  1JA8 A;  4JYY A;  2ADP A;  1XRE A;  2GDS A;  2QKC A;  1XDC A;  1AVM A;  1WB8 A;  1EM1 A;  1PM9 A;  2AW9 A;  4E4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...