3RN4A

Crystal structure of iron-substituted sod2 from saccharomyces cerevisiae
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
205
structure length
205
Chain Sequence
KVTLPDLKWDFGALEPYISGQINELHYTKHHQTYVNGFNTAVDQFQELSDLLAKEPSPANARKMIAIQQNIKFHGGGFTNHCLFWENLAPESQGGGEPPTGALAKAIDEQFGSLDELIKLTNTKLAGVQGSGWAFIVKNLSNGGKLDVVQTYNQDTVTGPLVPLVAIDAWEHAYYLQYQNKKADYFKAIWNVVNWKEASRRFDAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of native and Fe-substituted SOD2 from Saccharomyces cerevisiae
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn], mitochondrial
total genus 82
structure length 205
sequence length 205
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3rn4A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3rn4A02
1BT8A 1JA8A 2RCVA 1AVMA 1GN6A 1SZXA 1KKCA 1VARA 1WB7A 1VEWA 2QKCA 4JZGA 1EM1A 2GDSA 1D5NA 1AR5A 2QKAA 1LUVA 1BSMA 1N0NA 1XREA 4GUNA 1LUWA 1EN6A 3EVKA 1PM9A 1IXBA 3RN4A 1WB8A 3DC6A 1GN2A 1XDCA 1I0HA 4FFKA 3TJTA 1Y67A 1MA1A 1I08A 1AR4A 3OT7A 4F6EA 3LSUA 1BS3A 1EN5A 2ADPA 4JYYA 1P7GA 3MDSA 1GN4A 4YIPA 1AP5A 5A9GA 1JR9A 3KKYA 1ZUQA 3CEIA 1MSDA 1PL4A 3AK1A 1B06A 1ZTEA 3C3SA 4E4EA 3AK2A 1XUQA 1MMMA 2CDYA 1IX9A 1ZLZA 4C7UA 2ADQB 1ZSPA 4YIOA 1XILA 1EN4A 3C3TA 2AW9A 4JZ2A 4BR6A 4X9QA 3IC9A 2CE4A 3K9SA 1IDSA 1N0JA 1QNMA 3BFRA 2P4KA 1GN3A 1AP6A 3QVNA 1MNGA 3AK3A 5AG2A 3DC5A
chains in the Genus database with same CATH superfamily
3BCCH 4Q20A 4I50B 2KB1A 2CTRA 4K35A 3JALA 3LDCA 1SZXA 5CA1A 3OTOB 1HR0B 2PTMA 2Q0OC 2GHYA 1KKDA 1S3JA 4O2BB 1OCRB 4LF5O 1V54B 2FL4A 3E8BA 2GDSA 3CRQA 1YCIA 2DOSA 4OPHA 1P84F 4DV1O 4DV5B 1QLNA 1N32B 4CC6A 2K1EA 1Y76B 4QE7A 4TV8A 4X89A 4TUYA 1ZX3A 3FAVB 5BXZA 3CCMV 3CPWU 5LYJA 4X1KA 2D3OW 1F51A 1KECA 4GCZA 1SA0B 4YJ3B 2IJIA 1XMOO 4JI8O 4YJ2B 2VRZA 4GT1A 2BCCH 1EBOA 2QWNB 3S3XA 4F6EA 2XAGA 4MTFA 1AI7A 3IGAC 3VQVA 3H1LH 1DF4A 3ETDA 3E86A 3KG2A 4X1IB 1Q6IA 3ABKC 1RFYA 4FK5C 5B5EZ 1U96A 4DR7O 3QO7A 1N34B 2FB5A 4LF6B 3ZMUA 4DR5B 3K5OA 1SS3A 5KAIZ 1FD9A 2LGQA 2W0XA 2WAMA 3MD0A 1VQ8V 1N0JA 4FVMA 3K5NA 5LBQA 2LO1A 3FX7A 3W7WA 2YICA 2MK3A 4B3MO 3FD9A 5AG2A 3SR2C 4QPKA 1JNBA 3M99B 3RYFB 3F7YC 5LXTA 1J5EO 3JATA 4J7KA 1BCCH 4DV1B 1HDJA 4RAIA 3MHHC 3ZHQA 2R9AA 1K4DC 3UCSC 1NTZH 1O9HA 1OCZB 3N2GB 2PYLA 5J9PC 1HP8A 3HKDB 3UT5A 5CB4A 1VQNV 4MTOA 3RYFA 1FJGB 3L72H 1NVPD 1Y6XA 1IBLB 1LUVA 4UXNA 2QM4A 2RDCA 4UVBA 3A0RA 2Q6AA 1MG1A 1VQ4V 1K8AW 3UT5B 5CB4B 3ABMB 4I5SA 3AG1B 3I55V 1Q8IA 4MW3A 3JYCA 2ZR2A 5K1PA 4TWKA 3FFQA 2B1GA 4B3RO 4J7JA 1GO3F 4B3SB 4DR5O 3BVOA 1AP5A 1JR9A 4NKGB 3CHXA 3ZHTA 1B06A 1WPXA 3E2EA 1Q43A 3K57A 3K9AA 3SJAC 2E3CA 4LNUA 3B40A 4B3MB 1ZLZA 3ZJZA 2F1MA 3C3TA 4BR6A 3ETEA 5CA1B 4CH5A 2ZE7A 4JTDB 1MOFA 5IE9A 2CE4A 4GX2A 3KCXA 4O2BA 4JGSA 5FL7G 3QVNA 1AB3A 4KP4A 1VQPV 4XDJA 4K3AA 1SF9A 4JASA 1WAZA 3CB2A 2QR4A 2DJVA 1NKDA 3CE2A 1NT2B 1TVKB 1BGYH 3UM7A 3L74H 1IBLO 4HNAA 5F2VO 3CCQV 1FYJA 3ZEDA 1GRJA 4XDKA 3FB6C 4NXMB 1ZAUA 1IZ3A 3UO3A 2GSMB 2JJ1G 5EBLC 2QWOB 3D3QA 3OR6C 4YJ3A 1N0NA 1UFIA 4UCTA 3AG2B 3N2KA 3ASNC 4LF9O 4P30A 1FPOA 3AG1C 3W7XA 1Z5VA 1PM9A 4PHZA 2A79B 2KQXA 3DC6A 1YTFB 2RQ6A 1QR9A 5EBMC 1OV9A 1M9NA 2VQEO 3U11A 1KP3A 4EFBA 5B3SC 5JJNB 2QEXV 4J42A 2PUSA 4DR1B 2BE3A 3CMAV 3MDSA 3G6EV 4IYHA 1YITV 3OGIB 2QWRB 1R6KA 1AI5A 1L1FA 1MSDA 1VF5B 5JJEB 2ITCC 1OHHG 3AK1A 2ZCEA 3E22A 4DRXB 5L3BA 1NR1A 1THZA 2HEPA 4NTXA 4HBNA 2N74A 2R70A 1Q7YW 3W7SA 1HNWO 1Q81W 2PI5A 1S5LZ 4TV9B 3D36C 2WLLB 3QNEA 2HJDA 1QBZA 3K9SA 2YXLA 1K73W 1TUBB 3JAMN 2ETNA 2KSDA 4IHJA 2GBOA 5J2UB 4O4HB 2EINC 4NB5A 3VQWA 4NXMO 4L8JA 2LP7A 1GKFA 2Y0IA 3DGEA 2E5LB 2Q0AA 3WB1A 3F7VC 3G6BA 2JS3A 1BZKA 2UUAO 3OMAB 4X20A 2CUGA 2CTWA 4TT3G 1Z5WA 3FAVA 1JQ0A 4DR2O 4FFBA 2F4VO 3B09A 4GX0A 3HKBA 2QKAA 3HKCB 3R65A 3T4ZA 1URFA 2QKSA 1KMIZ 1WJZA 2XOKG 2M6YA 2JGUA 5J2TA 4JI6B 3G80A 1H5WA 3LSSA 2ZDIC 3SDLA 4X20B 3EVKA 4CC5A 2PGGA 3CRCA 4FFBB 3ASOB 2EIMB 1I0HA 3TJTA 4UV9A 1GMGA 4WBNA 2YS8A 2QWQB 2LW1A 1HNXB 4PI0A 4ZHQA 5KAFZ 4UCVA 1WN7A 2ADPA 2ZDIA 2IH3C 4LF7B 3T1YB 2WLKA 2XT9A 2CH7A 1SRYA 1WP7A 4JYBA 2UUCO 3THOA 2Y0PA 3WB0A 3GB7C 5IYZA 1M5IA 3KKYA 1VQOV 4D6TH 1KP2A 2L6LA 3BHPA 4BW5A 2AHZA 1SA0A 2BTQA 3ZRSA 1Q86W 3Q4HA 3QTCA 1JOYA 4X66O 4E4EA 2IU3A 4H0LB 4LWSA 2VQFO 4DV3O 5KUMA 1MMMA 2Q7HA 1G6UA 4JI3O 2M7WA 2UXCB 1OCOC 1K9MW 5IYZB 4J9YB 3B8MA 3CS5A 4X1IA 4J80A 1SQXH 3Q4HB 5LOVB 2HHHB 1SC5B 4O4IA 2UXBO 4ZI7A 1VP7A 2ZE6A 1XMQO 1PNMA 1JMKC 1QNMA 3BFRA 4LH7A 2RJZA 2VWJA 4PD4F 3CCJV 1XNQB 1U97A 3ZMSA 3AK3A 4YHHB 2QTSA 3UKMA 3H1JH 2E75B 3DC5A 5JCOC 2ZNIA 4R7CA 4ZI7B 5KA5A 2ZNJA 4GX5A 1QCEA 4PI2A 3VOUA 3J80N 3L70H 2RMKB 2VS0A 2H8PC 2JEXA 4NTWA 4P2ZA 3BRCA 3QO8A 2BSKB 4DR4O 2JGDB 2XAJA 3CC7V 3ASOC 3AEIA 2P06A 3RW0A 1QQCA 3N2GA 3H01A 4K0KO 2X7RB 2GUZB 4DUYO 5KHJA 5LMUO 3H9VA 2K9PA 1IJGA 2EIJC 2BOBC 2HFEC 2KG7A 1MZEA 4GZRB 1H2LA 1BQZA 1N33B 5LGTA 2YIAA 3ZBHA 5HFMA 1XNRB 4CS4A 5KHIA 1TAEA 4FLXA 1SQBH 3CCEV 2X6BA 4Z2WA 3K03A 1PL4A 2AXTZ 5C8YB 1WA8A 4K8XA 5KLVH 5IY5B 2GTSA 4O4JB 4OXSA 1JJ2U 2QE7G 4OX9B 2OYQA 3STLC 4YIOA 1KU9A 3JAWA 4BIOA 3DXRB 2V7QG 3OUFA 4I9QA 1JFFA 1H2GA 1YXBA 2EJ7A 5E79Z 1KB9F 4B08A 3HKBB 1SESA 5IJ0B 1R3JC 3DXRA 3SYQA 1N36O 2YI8A 1OCCC 4K8ZA 2CGNA 1A32A 2XNDG 4DUZB 2ZR3A 3JCUZ 1VQKV 3H1IH 3U0ZA 1RSOA 4WFBV 3OTOO 1HR0O 3OMIB 3AG4B 3RYIB 3X2QC 3K5LA 3FB5C 1XREA 4GUNA 4NVPA 4DK1A 2Y4UA 2IJKA 3FB7C 5GONB 1IBKB 3ZRWA 4PA6A 5FNVA 2IBZH 1M90W 1N4CA 3ETQA 4U3JA 4DV7O 4JI5O 1I5YA 5LA6A 4DV2O 5ITZB 1AR4A 5KX5A 1Y76A 2DQ0A 1F4NA 1R6NA 1NS1A 5IWAO 2VWKA 1PD3A 2UU9B 3RYCA 3ZX6A 3CC4V 4TSFG 2NNUA 3L71H 4CS2A 2XAHA 4YJ2A 2EBOA 1VF6A 4XBFA 2E76B 1XUQA 2Q68A 4J11A 3HPLC 4IHJB 1BMFG 3RYHA 1R3IC 1IX9A 4PA4A 2YIDA 1S72V 2YC0A 5LP6A 4O4LA 1RPRA 4UB8Z 1SZTA 2EULA 2YDEA 1N34O 3JD1A 2QGNA 4QE9A 1YSCA 4U3FH 3E8FA 1M1KW 3RYHB 4GX1A 2ZE8A 1DGSA 4MSWC 2ZQMA 2IM9A 1PPJH 4O4LB 1YJNV 5A2QN 1ROPA 4F6RA 3JARB 2Q8VA 2ZXWC 5J2UA 1IBKO 4X64B 3CWBH 3JD3A 1K34A 1JJOA 4B7EA 4CH6A 4IYIA 1GTOA 1J5EB 2Z0AA 1TUEB 4QNHB 1M57B 2DE0X 3TCUA 1QVGU 5DEDA 3LNMB 4B7KA 3CC2V 1Y4MA 2NLJC 2EIMC 3K58A 3RBZA 3IFXA 1GAXA 2P6JA 1NTMH 2HKOA 1AI4A 3E8HA 4LF9B 3FYEB 4GKKO 1FJGO 2UXXA 1XMOB 1PNKA 5IJ9A 1YZBA 1OCZC 2Z5UA 4PELA 2OTJV 1NVPB 1DTOA 3LSUA 4MVUA 4P9PA 2IJHA 1YF2A 4PJ0Z 4FLVA 4J10A 1LR1A 4DR1O 3JAWB 4WBNB 3UQ8A 2YEVA 1ZTEA 3I5DA 2D2CB 2E74B 1VF6C 4X8AA 1QHTA 2QM7A 1XOUA 3WFVA 5IJ0A 2Q73A 4X9QA 1CXZB 3ZHSA 1XI1A 5FPOA 3K04A 4FZ1A 2OIGA 3JAKB 5KHKA 2QWPB 5IY5C 4UVAA 5IYDO 1B04A 3L75H 1AJPA 3IAYA 2CK3G 4LP8A 2H3OA 2JIZG 4JI4O 3SYPA 3SPGA 1WPBA 3JD0A 1ZWIC 3K79A 3JD2A 2JS5A 3J81N 1AILA 4ASUG 4BIZA 2QTOA 1OZ0A 4FM2A 4IIJA 5JCOA 4GKKB 1E1RG 1E79G 5DECA 5LL6Y 5E1AC 5B66Z 2DYRB 3OM3B 3APQA 3K5MA 4RO2A 4X88A 5CN0A 3LDDA 3HKDA 1NTKH 3OGCC 2F66C 5L3DA 5CA0A 4IIJB 1GN2A 2BSKA 1NH2B 3BAAA 2WLJA 1FFXB 3SPJA 2EIKC 3ZS8C 4FJCC 3ZMVA 5LMNB 4I9WA 3WB2A 4WCEV 2B9ZA 3RVYA 2Y48A 5LHGA 3EHBB 3TK1A 3G71V 2CAZC 3TXQA 4FIPC 4MVSA 3P3NA 4TQDA 5LP6B 3FYIB 3ZMTA 5B3SB 2GV9A 4JPRA 3KZIZ 4TV9A 3LSQA 4JF3A 1VMGA 4QJFB 1NJIW 2HR3A 3STZC 1O9GA 1HW7A 2WLMA 5H2FZ 1NH2D 1PKXA 4G28B 2AHYA 2Y69B 1S0VA 5BR8O 4JYAO 3WG7B 2Q7EA 2VQFB 2FYUH 1ZSPA 3K08A 3EXAA 1P49A 5C93A 4EB6B 4QIWF 1OCRC 1GK9A 2DYSB 4FM0A 3CRRA 1SQVH 3BEHA 1V55C 2WLHA 3OR7C 3BABA 5CBGA 3HKCA 1UJWB 2C2AA 3TETA 4ZOLB 2P22C 3JCZA 2X0LA 1TUBA 4JAUA 1VEWA 3JASA 3BA8A 5JQGA 4E2LA 4X65B 3K59A 4I50A 2XHBA 1SQQH 2FMLA 4UCSA 4LF8B 2LJ2A 3KDRA 2CTQA 2A3QA 5LA6B 2UUAB 2FKXA 2DWEC 5B1BC 4DV4O 4D7TA 4FLTA 4DR4B 1LUWA 3CCUV 4ZHQB 1VF7A 3P32A 2JJ2G 1IXBA 2CH7B 1Q6HA 1WB8A 4FZ0A 4RUEA 4Z1MG 3W7UA 3AG3B 1QU7A 2EX3A 5LMUB 2WA4A 1MA1A 3RYIA 1I08A 4JI6O 1Y74A 4NR1A 1VIBA 4TV8B 2YEVB 4HZ3A 3B2EE 3ZRXA 3B4SA 3G4SV 1V9PA 3H1HH 5JVDB 2A0LA 3L73H 2P67A 4I55A 3RWRD 2YXYA 1IBMB 4UV8A 3M7MX 3RT3C 2V4DA 4DW1A 5EC2C 2NN4A 5BR8B 5KX5B 5LOVA 3B8NA 1H2SB 4JI2O 3GVMA 5L3CA 2W6IG 2Q5ZA 3CXCU 5B1NA 1Q6UA 5LHIA 4W4LA 2R72A 4OX9O 2WLNA 3DTUB 2W0FC 4JI1O 1G4YB 1XQ8A 1EZJA 2DN9A 2E5LO 1JCHA 1L0NH 2UXBB 2RCVA 5BY1A 3CJHA 5IYBO 1HNZO 2ZINA 4DR2B 4B3TB 5KA6A 5BZBA 4G2KA 5B1BB 1XHZA 2OT5A 5FPRA 1XBLA 5HFLA 4UUJC 2KG7B 4EFEA 4UFZA 2ZIOA 3T1CA 4RWUA 3BPZA 1K92A 3ZN1A 2XAFA 3ZN0A 1VQMV 5LHHA 4LFAO 4AQYB 5EZYB 4JTAB 2UUBB 1X59A 2Q69A 1HNXO 1JVMA 1K5QA 2Q4PA 4PA9A 1IURA 4EKWA 2DYSC 4YY3O 4DUYB 4DV2B 1W59A 1NQTA 4JI2B 1L0LH 1Q3EA 2PF4E 3T2MA 1VQ6V 5IWAB 3LDEA 2YUAA 4Q6GA 1SQPH 2BOCC 2R9RB 2ZE5A 1H2MA 1Q90D 3CEIA 2EZOA 1N33O 1SETA 4DV3B 1YIJV 4NYKA 4PA3A 1P7BA 4DV0O 4IGGA 2UXCO 1NBMG 5CBFA 1S5JA 4JI1B 2NR5A 2CGOA 4N23A 2UXNA 3SYOA 2HHHO 4PA7A 4C7UA 5IDJA 2F93B 1EN4A 3A0HZ 2RNBA 3ABMC 4FLYA 4LFCB 2LW7A 1RM1C 4AILC 1T5EA 2HJFC 5IYCO 3M8AA 4YHHO 1AJQA 4W4KA 1HNZB 1P4RA 1I94B 4DK0A 4WFEA 5DM6V 4H44B 4MVOA 5L3FA 4NXNO 3ZIAG 1BT8A 2N05A 1Y66A 3OEEG 4EEQA 4BIUA 4IT5A 4RUFA 2PYJA 4R50A 2A06H 1D2DA 4JI7B 1K4CC 4BAYA 1N36B 1WNSA 1SKVA 4X64O 3J7AU 4H37A 1FFXA 3SJQC 4K0KB 1Y74B 1HWYA 5CA3A 3CCLV 3DSQA 4DO2A 1DLBA 4DUZO 3T4DA 1FXVA 2LFSA 2EIKB 4YY3B 4FLZA 3SJBC 4I55B 1IVSA 3X2QB 3A8TA 3D36A 2OCCC 5JJJB 2WA3A 3WG7C 1B6QA 1BS3A 4JI8B 2MW2B 4DV0B 2DW4A 3E35A 5FNVB 2QM8A 2XUMA 2OWOA 3JSLA 4ZKIA 3OW2U 4YIPA 4N21A 3SGIA 2IW5A 5A9GA 1R73A 4TQFA 2HP8A 2Y69C 1H8HG 3SJCC 4KHPO 2YI9A 3CRMA 1S77D 5JH7B 1FS0G 4HAMA 2UU9O 4QPJA 1NI8A 1K7DA 4DR7B 2WLIB 2OCHA 2ADQB 4NXNB 1DF5A 3ZMZA 3ABUA 3A2FA 2XASA 4O2AA 1MABG 1SERA 1FXHA 4ZOLA 3JARA 3S3WA 4DRXA 2DMXA 3HKEA 1LNQA 4MTGA 1GN3A 1F4MA 5H6RA 3VQXA 2YIBD 3L9DA 3MAQA 2YSUB 3AG4C 1G8MA 3HR0A 4I4TA 1COWG 3H1KH 3LUTB 4KXRA 3CXHF 4ICGA 1AROP 2GTAA 3AG3C 3HKEB 3JD4A 3CCSV 1K97A 2P7TC 4GYCB 5L3GA 4HYOA 1KUQA 5KUKA 1PP9H 5LYJB 3FB8C 3T1HO 4JV5O 1AR5A 4X1KB 2JRIA 3JALB 4KUMA 3CP1A 3CD6V 4FLWA 4UVCA 1RP3B 3EFFK 3UO2A 3ABKB 1RPOA 4YXWG 1VQLV 4ABMA 1AJNA 4AI8A 3PN1A 4GLXA 1GH6A 2O57A 3K3WA 3O9OA 1MSWD 4LH6A 1D5AA 4UCOA 3MHSC 4JI0B 3ZRWB 5LMNO 4LWSB 5GTHZ 5JWPA 3NR7A 1M57C 1FKAO 3OTFA 3VBBA 4CS3A 1XHXA 2ATKC 4B3RB 1BL8A 1YJ9V 4DV6B 1OJHA 4DR3O 4B3SO 3RGBA 1VQ9V 1FXKA 3ZHUA 3LNNA 3GWOA 5H6QA 3RYCB 3OEHG 4RQEA 4G27B 3ZHVA 1R3KC 2UXDO 1XILA 5LXTB 4J7ZA 1FXKB 4JYAB 5BMVB 3AG2C 3CX5F 2ZIMA 3IC9A 2ZT9B 3KCYA 2P4KA 1DK1A 1AP6A 2DWDC 2QDOA 3TGUH 1ENVA 5EC1C 2EIJB 2WWWA 1J95A 5KMGA 2ZM6O 3E83A 2OCCB 1KKCA 4I0XB 1JX9A 2LQTA 4RQFA 4X62B 2WSSG 3N2KB 1WB7A 3D3IA 4F4LA 5EZYA 2EZPA 4CH4A 4DV5O 2F23A 3OE7G 4JI4B 3OD4A 1N32O 2F43G 2OTLV 3QF7A 5B1OA 1S5HC 4F6RB 5B1AC 3ZCCA 4A5UB 4LF8O 4FPPA 1EN6A 4KFMA 2XTAA 3GWKC 1EFRG 1BHBA 4BW9A 1WP8A 4PDVA 1XDCA 1W0KG 2HVJC 2Q7GA 3F5TA 3OFNG 2B1IA 2PZSA 4DV6O 1QR8A 1CP9A 4TOIA 3OT7A 3E22B 1AR1B 4Z1VA 2HG5C 1I7FA 4LNUB 4JYYA 3O65A 5DN6G 4DXWA 3B77A 4CBCA 4JTCB 2WLLA 2CDYA 5KHGA 3BA9A 1TGOA 1Z2GA 2RN9A 3CCRV 3JSNA 2CTPA 3R66A 2ZKOA 1MZFA 4WF9V 2AW9A 2ZM6B 1M4UA 4D7SA 4HNAB 1IDSA 4DYLA 1N8RW 4O4JA 2JEUA 1H38A 3SYAA 4KL1A 4OGQB 4PDMA 1XL4A 4X62O 2P5OA 1M56B 3ASNB 1NZ6A 2ILMA 3C90A 4PDLA 2XAQA 3PJSK 4IL6Z 2ITDC 1K5SA 1V55B 4UCUA 4QGPA 5GTIZ 4GKJO 4LFBO 2HVKC 1F7YA 5EIBD 1PV0A 2QA4V 2AZ2A 4U3JB 1QLEB 4FMTA 5IT9N 4PDRA 1KC8W 1TVKA 5ITZA 2ZXWB 2V1DA 3K06A 2AZ0A 3IJ4A 1B3QA 3AG7A 1VQ5V 2R9IA 3FKSG 3RN4A 5LP6C 4FFKA 5CBHA 1Q82W 4DV4B 1EZVH 3ABLC 1H8EG 5GONA 5JH7A 1KBHA 4L87A 2JVDA 4LBEC 4MTXA 4WFAV 3T1YO 3N27A 1ZUQA 4OPAA 2UUCB 5EIBC 2DYRC 4MVMA 4NTYA 3OAAG 3K0GA 2EILC 2A7WA 3AK2A 1X4TA 1KD1W 4X66B 3HB3B 4O4HA 1R1BA 3ETGA 4JI3B 4UB6Z 3CJHB 3SPCA 3CYOA 4LCUC 4U7OA 3VQYA 4R8CA 3A0BZ 3ABTA 2EILB 2N04A 3ICXA 1NR7A 1ZL8A 4PV1B 4GKJB 4LFBB 1H2NA 4DR6O 3F5WC 1JA8A 1OCOB 2F4VB 1YVWA 4JAAA 2JGDA 4O2AB 1AVMA 1GN6A 4H13B 2LFRA 4EB6A 1TA8A 4X65O 5LGUA 1XEQA 4JZGA 1ZL8B 1ORQC 2IJJA 2B5UA 2G38A 1SQFA 4I4TB 3P30A 2H94A 3WU2Z 1BSMA 3QG5A 5GW7A 4B3TO 3ZRVA 1FFTB 1GM9A 1XL6A 2ARHA 5FLXN 2EINB 4LC1A 3P3PA 2EJRA 1PNLA 2YXHA 5EK0A 1KQSU 2ODMA 1BE3H 1KYOF 4LF7O 1M93A 4MVRA 2YIBA 3CRAA 1JPXA 2VQEB 4P9OA 1YTFD 1Y67A 2KKWA 2ZD9A 3I56V 5EYPB 5J2TB 1S76D 5TISZ 4JYCA 1YEWA 3QO5A 1IBMO 4TUYB 3K0DA 1K33A 1RM1B 1BHAA 1K3EA 1P7GA 5H9CA 4J9ZB 1GN4A 5K1XA 2F95B 4MW8A 5IJ9B 4FLUA 2WPDG 4H33A 4WFFA 3APOA 5EYPA 2X6CA 5BMVA 1OCCB 1IXMA 2IU0A 1PL0A 4CH3A 2P90A 1HNWB 3C3SA 3JAKA 1XMQB 4XDLA 2AGAA 3CCVV 1L8DA 5JVDA 4LF4B 4WFHA 1XNQO 3W7TA 3TXSA 4DR6B 2BTQB 4JZ2A 3CMEV 2PY5A 1NU1H 4MS2A 1YJWV 2FTKA 1US6A 1VQ7V 1YI2V 5B1AB 4WFGA 1WLEA 2W6JG 1RSOB 2Z3YA 4R6ZA 5D5PA 5CMUA 2A9HA 4UCRA 2L35A 4O4IB 4I7ZB 2Q67A 2LGWA 1VARA 4DW0A 3OMNB 1I94O 2QKCA 4U7NA 1EM1A 1BQ0A 1FXKC 1Q5OA 2QSAA 1D5NA 5CA0B 1F23A 5KMGB 1I5XA 2OIEA 3JATB 2JK5C 4MVZA 3OUSA 3T1HB 4I0XA 1GM8A 1V54C 4JV5B 4LF5B 4LFAB 4AQYO 2UUBO 4ZBMA 5LGNA 5D5QA 4JI7O 3E8GA 4J41A 3ML0A 4LR3A 1XNRO 1AI6A 3G67A 1QLEC 3ZHRA 4AHCA 2IH1C 4DV7B 1W2BU 1CPYA 5C8YA 3RVZA 2PI4A 4JI5B 3BY6A 1EN5A 3E89A 2GUZA 2Y4TA 2DQ3A 2WLIA 1W0JG 4X1YA 4JI0O 4LF4O 1CEZA 2X6AA 1QVFU 5L3EA 1H2KA 1YDXA 2HLDG 1E1QG 2BTOA 3NXSA 1YHQV 5EBWC 4FM1A 2P4VA 4MT8A 3ABLB 1JFFB 4CZZA 4DR3B 3IC7A 3U10A 2JDIG 4MVQA 2Q9LA 1GM7A 4X1YB 3CSXA 4LFCO 5H5NA 1M56C 3SPIA 4JAVA 2QJ1A 1SQGA 4BWAA 1G1XB 4KHPB 1UPGA 2UXDB 4ZIBA 1FOUA 3SYCA 1WA8B 3RFRA 4LF6O 1R3LC 5KHHA 3D8CA 3JASB 1MNGA 5JQGB 1FAFA 3SPHA 1R6TA
chains in the Genus database with same CATH topology
1BT8A 1JA8A 2RCVA 1AVMA 1GN6A 1SZXA 1KKCA 1VARA 1WB7A 1VEWA 2QKCA 4JZGA 1EM1A 2GDSA 1D5NA 1AR5A 2QKAA 3KDRA 1LUVA 1BSMA 1N0NA 1XREA 4GUNA 1LUWA 1EN6A 3EVKA 1PM9A 1IXBA 3RN4A 1WB8A 3DC6A 1GN2A 1XDCA 1I0HA 4FFKA 3TJTA 1Y67A 1MA1A 1I08A 1AR4A 3OT7A 4F6EA 3LSUA 1BS3A 1EN5A 2ADPA 4JYYA 1P7GA 3MDSA 1GN4A 4YIPA 1AP5A 5A9GA 1JR9A 3KKYA 1ZUQA 3CEIA 1MSDA 1PL4A 3AK1A 1B06A 1ZTEA 3C3SA 4E4EA 3AK2A 1XUQA 1MMMA 2CDYA 1IX9A 1ZLZA 4C7UA 2ADQB 1ZSPA 4YIOA 1XILA 1EN4A 3C3TA 2AW9A 4JZ2A 4BR6A 4X9QA 3IC9A 2CE4A 3K9SA 1IDSA 1N0JA 1QNMA 3BFRA 2P4KA 1GN3A 1AP6A 3QVNA 1MNGA 3AK3A 5AG2A 3DC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT8 A;  1JA8 A;  2RCV A;  1AVM A;  1GN6 A;  1SZX A;  1KKC A;  1VAR A;  1WB7 A;  1VEW A;  2QKC A;  4JZG A;  1EM1 A;  2GDS A;  1D5N A;  1AR5 A;  2QKA A;  1LUV A;  1BSM A;  1N0N A;  1XRE A;  4GUN A;  1LUW A;  1EN6 A;  3EVK A;  1PM9 A;  1IXB A;  3RN4 A;  1WB8 A;  3DC6 A;  1GN2 A;  1XDC A;  1I0H A;  4FFK A;  3TJT A;  1Y67 A;  1MA1 A;  1I08 A;  1AR4 A;  3OT7 A;  4F6E A;  3LSU A;  1BS3 A;  1EN5 A;  2ADP A;  4JYY A;  1P7G A;  3MDS A;  1GN4 A;  4YIP A;  1AP5 A;  5A9G A;  1JR9 A;  3KKY A;  1ZUQ A;  3CEI A;  1MSD A;  1PL4 A;  3AK1 A;  1B06 A;  1ZTE A;  3C3S A;  4E4E A;  3AK2 A;  1XUQ A;  1MMM A;  2CDY A;  1IX9 A;  1ZLZ A;  4C7U A;  2ADQ B;  1ZSP A;  4YIO A;  1XIL A;  1EN4 A;  3C3T A;  2AW9 A;  4JZ2 A;  4BR6 A;  4X9Q A;  3IC9 A;  2CE4 A;  3K9S A;  1IDS A;  1N0J A;  1QNM A;  3BFR A;  2P4K A;  1GN3 A;  1AP6 A;  3QVN A;  1MNG A;  3AK3 A;  5AG2 A;  3DC5 A; 
#chains in the Genus database with same CATH topology
 3BCC H;  4Q20 A;  4I50 B;  2KB1 A;  2CTR A;  4K35 A;  3JAL A;  3LDC A;  1SZX A;  5CA1 A;  3OTO B;  1HR0 B;  2PTM A;  2Q0O C;  2GHY A;  1KKD A;  1S3J A;  4O2B B;  1OCR B;  4LF5 O;  1V54 B;  2FL4 A;  3E8B A;  2GDS A;  3CRQ A;  1YCI A;  2DOS A;  4OPH A;  1P84 F;  4DV1 O;  4DV5 B;  1QLN A;  1N32 B;  4CC6 A;  2K1E A;  1Y76 B;  4QE7 A;  4TV8 A;  4X89 A;  4TUY A;  1ZX3 A;  3FAV B;  5BXZ A;  3CCM V;  3CPW U;  5LYJ A;  4X1K A;  2D3O W;  1F51 A;  1KEC A;  4GCZ A;  1SA0 B;  4YJ3 B;  2IJI A;  1XMO O;  4JI8 O;  4YJ2 B;  2VRZ A;  4GT1 A;  2BCC H;  1EBO A;  2QWN B;  3S3X A;  4F6E A;  2XAG A;  4MTF A;  1AI7 A;  3IGA C;  3VQV A;  3H1L H;  1DF4 A;  3ETD A;  3E86 A;  3KG2 A;  4X1I B;  1Q6I A;  3ABK C;  1RFY A;  4FK5 C;  5B5E Z;  1U96 A;  4DR7 O;  3QO7 A;  1N34 B;  2FB5 A;  4LF6 B;  3ZMU A;  4DR5 B;  3K5O A;  1SS3 A;  5KAI Z;  1FD9 A;  2LGQ A;  2W0X A;  2WAM A;  3MD0 A;  1VQ8 V;  1N0J A;  4FVM A;  3K5N A;  5LBQ A;  2LO1 A;  3FX7 A;  3W7W A;  2YIC A;  2MK3 A;  4B3M O;  3FD9 A;  5AG2 A;  3SR2 C;  4QPK A;  1JNB A;  3M99 B;  3RYF B;  3F7Y C;  5LXT A;  1J5E O;  3JAT A;  4J7K A;  1BCC H;  4DV1 B;  1HDJ A;  4RAI A;  3MHH C;  3ZHQ A;  2R9A A;  1K4D C;  3UCS C;  1NTZ H;  1O9H A;  1OCZ B;  3N2G B;  2PYL A;  5J9P C;  1HP8 A;  3HKD B;  3UT5 A;  5CB4 A;  1VQN V;  4MTO A;  3RYF A;  1FJG B;  3L72 H;  1NVP D;  1Y6X A;  1IBL B;  1LUV A;  4UXN A;  2QM4 A;  2RDC A;  4UVB A;  3A0R A;  2Q6A A;  1MG1 A;  1VQ4 V;  1K8A W;  3UT5 B;  5CB4 B;  3ABM B;  4I5S A;  3AG1 B;  3I55 V;  1Q8I A;  4MW3 A;  3JYC A;  2ZR2 A;  5K1P A;  4TWK A;  3FFQ A;  2B1G A;  4B3R O;  4J7J A;  1GO3 F;  4B3S B;  4DR5 O;  3BVO A;  1AP5 A;  1JR9 A;  4NKG B;  3CHX A;  3ZHT A;  1B06 A;  1WPX A;  3E2E A;  1Q43 A;  3K57 A;  3K9A A;  3SJA C;  2E3C A;  4LNU A;  3B40 A;  4B3M B;  1ZLZ A;  3ZJZ A;  2F1M A;  3C3T A;  4BR6 A;  3ETE A;  5CA1 B;  4CH5 A;  2ZE7 A;  4JTD B;  1MOF A;  5IE9 A;  2CE4 A;  4GX2 A;  3KCX A;  4O2B A;  4JGS A;  5FL7 G;  3QVN A;  1AB3 A;  4KP4 A;  1VQP V;  4XDJ A;  4K3A A;  1SF9 A;  4JAS A;  1WAZ A;  3CB2 A;  2QR4 A;  2DJV A;  1NKD A;  3CE2 A;  1NT2 B;  1TVK B;  1BGY H;  3UM7 A;  3L74 H;  1IBL O;  4HNA A;  5F2V O;  3CCQ V;  1FYJ A;  3ZED A;  1GRJ A;  4XDK A;  3FB6 C;  4NXM B;  1ZAU A;  1IZ3 A;  3UO3 A;  2GSM B;  2JJ1 G;  5EBL C;  2QWO B;  3D3Q A;  3OR6 C;  4YJ3 A;  1N0N A;  1UFI A;  4UCT A;  3AG2 B;  3N2K A;  3ASN C;  4LF9 O;  4P30 A;  1FPO A;  3AG1 C;  3W7X A;  1Z5V A;  1PM9 A;  4PHZ A;  2A79 B;  2KQX A;  3DC6 A;  1YTF B;  2RQ6 A;  1QR9 A;  5EBM C;  1OV9 A;  1M9N A;  2VQE O;  3U11 A;  1KP3 A;  4EFB A;  5B3S C;  5JJN B;  2QEX V;  4J42 A;  2PUS A;  4DR1 B;  2BE3 A;  3CMA V;  3MDS A;  3G6E V;  4IYH A;  1YIT V;  3OGI B;  2QWR B;  1R6K A;  1AI5 A;  1L1F A;  1MSD A;  1VF5 B;  5JJE B;  2ITC C;  1OHH G;  3AK1 A;  2ZCE A;  3E22 A;  4DRX B;  5L3B A;  1NR1 A;  1THZ A;  2HEP A;  4NTX A;  4HBN A;  2N74 A;  2R70 A;  1Q7Y W;  3W7S A;  1HNW O;  1Q81 W;  2PI5 A;  1S5L Z;  4TV9 B;  3D36 C;  2WLL B;  3QNE A;  2HJD A;  1QBZ A;  3K9S A;  2YXL A;  1K73 W;  1TUB B;  3JAM N;  2ETN A;  2KSD A;  4IHJ A;  2GBO A;  5J2U B;  4O4H B;  2EIN C;  4NB5 A;  3VQW A;  4NXM O;  4L8J A;  2LP7 A;  1GKF A;  2Y0I A;  3DGE A;  2E5L B;  2Q0A A;  3WB1 A;  3F7V C;  3G6B A;  2JS3 A;  1BZK A;  2UUA O;  3OMA B;  4X20 A;  2CUG A;  2CTW A;  4TT3 G;  1Z5W A;  3FAV A;  1JQ0 A;  4DR2 O;  4FFB A;  2F4V O;  3B09 A;  4GX0 A;  3HKB A;  2QKA A;  3HKC B;  3R65 A;  3T4Z A;  1URF A;  2QKS A;  1KMI Z;  1WJZ A;  2XOK G;  2M6Y A;  2JGU A;  5J2T A;  4JI6 B;  3G80 A;  1H5W A;  3LSS A;  2ZDI C;  3SDL A;  4X20 B;  3EVK A;  4CC5 A;  2PGG A;  3CRC A;  4FFB B;  3ASO B;  2EIM B;  1I0H A;  3TJT A;  4UV9 A;  1GMG A;  4WBN A;  2YS8 A;  2QWQ B;  2LW1 A;  1HNX B;  4PI0 A;  4ZHQ A;  5KAF Z;  4UCV A;  1WN7 A;  2ADP A;  2ZDI A;  2IH3 C;  4LF7 B;  3T1Y B;  2WLK A;  2XT9 A;  2CH7 A;  1SRY A;  1WP7 A;  4JYB A;  2UUC O;  3THO A;  2Y0P A;  3WB0 A;  3GB7 C;  5IYZ A;  1M5I A;  3KKY A;  1VQO V;  4D6T H;  1KP2 A;  2L6L A;  3BHP A;  4BW5 A;  2AHZ A;  1SA0 A;  2BTQ A;  3ZRS A;  1Q86 W;  3Q4H A;  3QTC A;  1JOY A;  4X66 O;  4E4E A;  2IU3 A;  4H0L B;  4LWS A;  2VQF O;  4DV3 O;  5KUM A;  1MMM A;  2Q7H A;  1G6U A;  4JI3 O;  2M7W A;  2UXC B;  1OCO C;  1K9M W;  5IYZ B;  4J9Y B;  3B8M A;  3CS5 A;  4X1I A;  4J80 A;  1SQX H;  3Q4H B;  5LOV B;  2HHH B;  1SC5 B;  4O4I A;  2UXB O;  4ZI7 A;  1VP7 A;  2ZE6 A;  1XMQ O;  1PNM A;  1JMK C;  1QNM A;  3BFR A;  4LH7 A;  2RJZ A;  2VWJ A;  4PD4 F;  3CCJ V;  1XNQ B;  1U97 A;  3ZMS A;  3AK3 A;  4YHH B;  2QTS A;  3UKM A;  3H1J H;  2E75 B;  3DC5 A;  5JCO C;  2ZNI A;  4R7C A;  4ZI7 B;  5KA5 A;  2ZNJ A;  4GX5 A;  1QCE A;  4PI2 A;  3VOU A;  3J80 N;  3L70 H;  2RMK B;  2VS0 A;  2H8P C;  2JEX A;  4NTW A;  4P2Z A;  3BRC A;  3QO8 A;  2BSK B;  4DR4 O;  2JGD B;  2XAJ A;  3CC7 V;  3ASO C;  3AEI A;  2P06 A;  3RW0 A;  1QQC A;  3N2G A;  3H01 A;  4K0K O;  2X7R B;  2GUZ B;  4DUY O;  5KHJ A;  5LMU O;  3H9V A;  2K9P A;  1IJG A;  2EIJ C;  2BOB C;  2HFE C;  2KG7 A;  1MZE A;  4GZR B;  1H2L A;  1BQZ A;  1N33 B;  5LGT A;  2YIA A;  3ZBH A;  5HFM A;  1XNR B;  4CS4 A;  5KHI A;  1TAE A;  4FLX A;  1SQB H;  3CCE V;  2X6B A;  4Z2W A;  3K03 A;  1PL4 A;  2AXT Z;  5C8Y B;  1WA8 A;  4K8X A;  5KLV H;  5IY5 B;  2GTS A;  4O4J B;  4OXS A;  1JJ2 U;  2QE7 G;  4OX9 B;  2OYQ A;  3STL C;  4YIO A;  1KU9 A;  3JAW A;  4BIO A;  3DXR B;  2V7Q G;  3OUF A;  4I9Q A;  1JFF A;  1H2G A;  1YXB A;  2EJ7 A;  5E79 Z;  1KB9 F;  4B08 A;  3HKB B;  1SES A;  5IJ0 B;  1R3J C;  3DXR A;  3SYQ A;  1N36 O;  2YI8 A;  1OCC C;  4K8Z A;  2CGN A;  1A32 A;  2XND G;  4DUZ B;  2ZR3 A;  3JCU Z;  1VQK V;  3H1I H;  3U0Z A;  1RSO A;  4WFB V;  3OTO O;  1HR0 O;  3OMI B;  3AG4 B;  3RYI B;  3X2Q C;  3K5L A;  3FB5 C;  1XRE A;  4GUN A;  4NVP A;  4DK1 A;  2Y4U A;  2IJK A;  3FB7 C;  5GON B;  1IBK B;  3ZRW A;  4PA6 A;  5FNV A;  2IBZ H;  1M90 W;  1N4C A;  3ETQ A;  4U3J A;  4DV7 O;  4JI5 O;  1I5Y A;  5LA6 A;  4DV2 O;  5ITZ B;  1AR4 A;  5KX5 A;  1Y76 A;  2DQ0 A;  1F4N A;  1R6N A;  1NS1 A;  5IWA O;  2VWK A;  1PD3 A;  2UU9 B;  3RYC A;  3ZX6 A;  3CC4 V;  4TSF G;  2NNU A;  3L71 H;  4CS2 A;  2XAH A;  4YJ2 A;  2EBO A;  1VF6 A;  4XBF A;  2E76 B;  1XUQ A;  2Q68 A;  4J11 A;  3HPL C;  4IHJ B;  1BMF G;  3RYH A;  1R3I C;  1IX9 A;  4PA4 A;  2YID A;  1S72 V;  2YC0 A;  5LP6 A;  4O4L A;  1RPR A;  4UB8 Z;  1SZT A;  2EUL A;  2YDE A;  1N34 O;  3JD1 A;  2QGN A;  4QE9 A;  1YSC A;  4U3F H;  3E8F A;  1M1K W;  3RYH B;  4GX1 A;  2ZE8 A;  1DGS A;  4MSW C;  2ZQM A;  2IM9 A;  1PPJ H;  4O4L B;  1YJN V;  5A2Q N;  1ROP A;  4F6R A;  3JAR B;  2Q8V A;  2ZXW C;  5J2U A;  1IBK O;  4X64 B;  3CWB H;  3JD3 A;  1K34 A;  1JJO A;  4B7E A;  4CH6 A;  4IYI A;  1GTO A;  1J5E B;  2Z0A A;  1TUE B;  4QNH B;  1M57 B;  2DE0 X;  3TCU A;  1QVG U;  5DED A;  3LNM B;  4B7K A;  3CC2 V;  1Y4M A;  2NLJ C;  2EIM C;  3K58 A;  3RBZ A;  3IFX A;  1GAX A;  2P6J A;  1NTM H;  2HKO A;  1AI4 A;  3E8H A;  4LF9 B;  3FYE B;  4GKK O;  1FJG O;  2UXX A;  1XMO B;  1PNK A;  5IJ9 A;  1YZB A;  1OCZ C;  2Z5U A;  4PEL A;  2OTJ V;  1NVP B;  1DTO A;  3LSU A;  4MVU A;  4P9P A;  2IJH A;  1YF2 A;  4PJ0 Z;  4FLV A;  4J10 A;  1LR1 A;  4DR1 O;  3JAW B;  4WBN B;  3UQ8 A;  2YEV A;  1ZTE A;  3I5D A;  2D2C B;  2E74 B;  1VF6 C;  4X8A A;  1QHT A;  2QM7 A;  1XOU A;  3WFV A;  5IJ0 A;  2Q73 A;  4X9Q A;  1CXZ B;  3ZHS A;  1XI1 A;  5FPO A;  3K04 A;  4FZ1 A;  2OIG A;  3JAK B;  5KHK A;  2QWP B;  5IY5 C;  4UVA A;  5IYD O;  1B04 A;  3L75 H;  1AJP A;  3IAY A;  2CK3 G;  4LP8 A;  2H3O A;  2JIZ G;  4JI4 O;  3SYP A;  3SPG A;  1WPB A;  3JD0 A;  1ZWI C;  3K79 A;  3JD2 A;  2JS5 A;  3J81 N;  1AIL A;  4ASU G;  4BIZ A;  2QTO A;  1OZ0 A;  4FM2 A;  4IIJ A;  5JCO A;  4GKK B;  1E1R G;  1E79 G;  5DEC A;  5LL6 Y;  5E1A C;  5B66 Z;  2DYR B;  3OM3 B;  3APQ A;  3K5M A;  4RO2 A;  4X88 A;  5CN0 A;  3LDD A;  3HKD A;  1NTK H;  3OGC C;  2F66 C;  5L3D A;  5CA0 A;  4IIJ B;  1GN2 A;  2BSK A;  1NH2 B;  3BAA A;  2WLJ A;  1FFX B;  3SPJ A;  2EIK C;  3ZS8 C;  4FJC C;  3ZMV A;  5LMN B;  4I9W A;  3WB2 A;  4WCE V;  2B9Z A;  3RVY A;  2Y48 A;  5LHG A;  3EHB B;  3TK1 A;  3G71 V;  2CAZ C;  3TXQ A;  4FIP C;  4MVS A;  3P3N A;  4TQD A;  5LP6 B;  3FYI B;  3ZMT A;  5B3S B;  2GV9 A;  4JPR A;  3KZI Z;  4TV9 A;  3LSQ A;  4JF3 A;  1VMG A;  4QJF B;  1NJI W;  2HR3 A;  3STZ C;  1O9G A;  1HW7 A;  2WLM A;  5H2F Z;  1NH2 D;  1PKX A;  4G28 B;  2AHY A;  2Y69 B;  1S0V A;  5BR8 O;  4JYA O;  3WG7 B;  2Q7E A;  2VQF B;  2FYU H;  1ZSP A;  3K08 A;  3EXA A;  1P49 A;  5C93 A;  4EB6 B;  4QIW F;  1OCR C;  1GK9 A;  2DYS B;  4FM0 A;  3CRR A;  1SQV H;  3BEH A;  1V55 C;  2WLH A;  3OR7 C;  3BAB A;  5CBG A;  3HKC A;  1UJW B;  2C2A A;  3TET A;  4ZOL B;  2P22 C;  3JCZ A;  2X0L A;  1TUB A;  4JAU A;  1VEW A;  3JAS A;  3BA8 A;  5JQG A;  4E2L A;  4X65 B;  3K59 A;  4I50 A;  2XHB A;  1SQQ H;  2FML A;  4UCS A;  4LF8 B;  2LJ2 A;  3KDR A;  2CTQ A;  2A3Q A;  5LA6 B;  2UUA B;  2FKX A;  2DWE C;  5B1B C;  4DV4 O;  4D7T A;  4FLT A;  4DR4 B;  1LUW A;  3CCU V;  4ZHQ B;  1VF7 A;  3P32 A;  2JJ2 G;  1IXB A;  2CH7 B;  1Q6H A;  1WB8 A;  4FZ0 A;  4RUE A;  4Z1M G;  3W7U A;  3AG3 B;  1QU7 A;  2EX3 A;  5LMU B;  2WA4 A;  1MA1 A;  3RYI A;  1I08 A;  4JI6 O;  1Y74 A;  4NR1 A;  1VIB A;  4TV8 B;  2YEV B;  4HZ3 A;  3B2E E;  3ZRX A;  3B4S A;  3G4S V;  1V9P A;  3H1H H;  5JVD B;  2A0L A;  3L73 H;  2P67 A;  4I55 A;  3RWR D;  2YXY A;  1IBM B;  4UV8 A;  3M7M X;  3RT3 C;  2V4D A;  4DW1 A;  5EC2 C;  2NN4 A;  5BR8 B;  5KX5 B;  5LOV A;  3B8N A;  1H2S B;  4JI2 O;  3GVM A;  5L3C A;  2W6I G;  2Q5Z A;  3CXC U;  5B1N A;  1Q6U A;  5LHI A;  4W4L A;  2R72 A;  4OX9 O;  2WLN A;  3DTU B;  2W0F C;  4JI1 O;  1G4Y B;  1XQ8 A;  1EZJ A;  2DN9 A;  2E5L O;  1JCH A;  1L0N H;  2UXB B;  2RCV A;  5BY1 A;  3CJH A;  5IYB O;  1HNZ O;  2ZIN A;  4DR2 B;  4B3T B;  5KA6 A;  5BZB A;  4G2K A;  5B1B B;  1XHZ A;  2OT5 A;  5FPR A;  1XBL A;  5HFL A;  4UUJ C;  2KG7 B;  4EFE A;  4UFZ A;  2ZIO A;  3T1C A;  4RWU A;  3BPZ A;  1K92 A;  3ZN1 A;  2XAF A;  3ZN0 A;  1VQM V;  5LHH A;  4LFA O;  4AQY B;  5EZY B;  4JTA B;  2UUB B;  1X59 A;  2Q69 A;  1HNX O;  1JVM A;  1K5Q A;  2Q4P A;  4PA9 A;  1IUR A;  4EKW A;  2DYS C;  4YY3 O;  4DUY B;  4DV2 B;  1W59 A;  1NQT A;  4JI2 B;  1L0L H;  1Q3E A;  2PF4 E;  3T2M A;  1VQ6 V;  5IWA B;  3LDE A;  2YUA A;  4Q6G A;  1SQP H;  2BOC C;  2R9R B;  2ZE5 A;  1H2M A;  1Q90 D;  3CEI A;  2EZO A;  1N33 O;  1SET A;  4DV3 B;  1YIJ V;  4NYK A;  4PA3 A;  1P7B A;  4DV0 O;  4IGG A;  2UXC O;  1NBM G;  5CBF A;  1S5J A;  4JI1 B;  2NR5 A;  2CGO A;  4N23 A;  2UXN A;  3SYO A;  2HHH O;  4PA7 A;  4C7U A;  5IDJ A;  2F93 B;  1EN4 A;  3A0H Z;  2RNB A;  3ABM C;  4FLY A;  4LFC B;  2LW7 A;  1RM1 C;  4AIL C;  1T5E A;  2HJF C;  5IYC O;  3M8A A;  4YHH O;  1AJQ A;  4W4K A;  1HNZ B;  1P4R A;  1I94 B;  4DK0 A;  4WFE A;  5DM6 V;  4H44 B;  4MVO A;  5L3F A;  4NXN O;  3ZIA G;  1BT8 A;  2N05 A;  1Y66 A;  3OEE G;  4EEQ A;  4BIU A;  4IT5 A;  4RUF A;  2PYJ A;  4R50 A;  2A06 H;  1D2D A;  4JI7 B;  1K4C C;  4BAY A;  1N36 B;  1WNS A;  1SKV A;  4X64 O;  3J7A U;  4H37 A;  1FFX A;  3SJQ C;  4K0K B;  1Y74 B;  1HWY A;  5CA3 A;  3CCL V;  3DSQ A;  4DO2 A;  1DLB A;  4DUZ O;  3T4D A;  1FXV A;  2LFS A;  2EIK B;  4YY3 B;  4FLZ A;  3SJB C;  4I55 B;  1IVS A;  3X2Q B;  3A8T A;  3D36 A;  2OCC C;  5JJJ B;  2WA3 A;  3WG7 C;  1B6Q A;  1BS3 A;  4JI8 B;  2MW2 B;  4DV0 B;  2DW4 A;  3E35 A;  5FNV B;  2QM8 A;  2XUM A;  2OWO A;  3JSL A;  4ZKI A;  3OW2 U;  4YIP A;  4N21 A;  3SGI A;  2IW5 A;  5A9G A;  1R73 A;  4TQF A;  2HP8 A;  2Y69 C;  1H8H G;  3SJC C;  4KHP O;  2YI9 A;  3CRM A;  1S77 D;  5JH7 B;  1FS0 G;  4HAM A;  2UU9 O;  4QPJ A;  1NI8 A;  1K7D A;  4DR7 B;  2WLI B;  2OCH A;  2ADQ B;  4NXN B;  1DF5 A;  3ZMZ A;  3ABU A;  3A2F A;  2XAS A;  4O2A A;  1MAB G;  1SER A;  1FXH A;  4ZOL A;  3JAR A;  3S3W A;  4DRX A;  2DMX A;  3HKE A;  1LNQ A;  4MTG A;  1GN3 A;  1F4M A;  5H6R A;  3VQX A;  2YIB D;  3L9D A;  3MAQ A;  2YSU B;  3AG4 C;  1G8M A;  3HR0 A;  4I4T A;  1COW G;  3H1K H;  3LUT B;  4KXR A;  3CXH F;  4ICG A;  1ARO P;  2GTA A;  3AG3 C;  3HKE B;  3JD4 A;  3CCS V;  1K97 A;  2P7T C;  4GYC B;  5L3G A;  4HYO A;  1KUQ A;  5KUK A;  1PP9 H;  5LYJ B;  3FB8 C;  3T1H O;  4JV5 O;  1AR5 A;  4X1K B;  2JRI A;  3JAL B;  4KUM A;  3CP1 A;  3CD6 V;  4FLW A;  4UVC A;  1RP3 B;  3EFF K;  3UO2 A;  3ABK B;  1RPO A;  4YXW G;  1VQL V;  4ABM A;  1AJN A;  4AI8 A;  3PN1 A;  4GLX A;  1GH6 A;  2O57 A;  3K3W A;  3O9O A;  1MSW D;  4LH6 A;  1D5A A;  4UCO A;  3MHS C;  4JI0 B;  3ZRW B;  5LMN O;  4LWS B;  5GTH Z;  5JWP A;  3NR7 A;  1M57 C;  1FKA O;  3OTF A;  3VBB A;  4CS3 A;  1XHX A;  2ATK C;  4B3R B;  1BL8 A;  1YJ9 V;  4DV6 B;  1OJH A;  4DR3 O;  4B3S O;  3RGB A;  1VQ9 V;  1FXK A;  3ZHU A;  3LNN A;  3GWO A;  5H6Q A;  3RYC B;  3OEH G;  4RQE A;  4G27 B;  3ZHV A;  1R3K C;  2UXD O;  1XIL A;  5LXT B;  4J7Z A;  1FXK B;  4JYA B;  5BMV B;  3AG2 C;  3CX5 F;  2ZIM A;  3IC9 A;  2ZT9 B;  3KCY A;  2P4K A;  1DK1 A;  1AP6 A;  2DWD C;  2QDO A;  3TGU H;  1ENV A;  5EC1 C;  2EIJ B;  2WWW A;  1J95 A;  5KMG A;  2ZM6 O;  3E83 A;  2OCC B;  1KKC A;  4I0X B;  1JX9 A;  2LQT A;  4RQF A;  4X62 B;  2WSS G;  3N2K B;  1WB7 A;  3D3I A;  4F4L A;  5EZY A;  2EZP A;  4CH4 A;  4DV5 O;  2F23 A;  3OE7 G;  4JI4 B;  3OD4 A;  1N32 O;  2F43 G;  2OTL V;  3QF7 A;  5B1O A;  1S5H C;  4F6R B;  5B1A C;  3ZCC A;  4A5U B;  4LF8 O;  4FPP A;  1EN6 A;  4KFM A;  2XTA A;  3GWK C;  1EFR G;  1BHB A;  4BW9 A;  1WP8 A;  4PDV A;  1XDC A;  1W0K G;  2HVJ C;  2Q7G A;  3F5T A;  3OFN G;  2B1I A;  2PZS A;  4DV6 O;  1QR8 A;  1CP9 A;  4TOI A;  3OT7 A;  3E22 B;  1AR1 B;  4Z1V A;  2HG5 C;  1I7F A;  4LNU B;  4JYY A;  3O65 A;  5DN6 G;  4DXW A;  3B77 A;  4CBC A;  4JTC B;  2WLL A;  2CDY A;  5KHG A;  3BA9 A;  1TGO A;  1Z2G A;  2RN9 A;  3CCR V;  3JSN A;  2CTP A;  3R66 A;  2ZKO A;  1MZF A;  4WF9 V;  2AW9 A;  2ZM6 B;  1M4U A;  4D7S A;  4HNA B;  1IDS A;  4DYL A;  1N8R W;  4O4J A;  2JEU A;  1H38 A;  3SYA A;  4KL1 A;  4OGQ B;  4PDM A;  1XL4 A;  4X62 O;  2P5O A;  1M56 B;  3ASN B;  1NZ6 A;  2ILM A;  3C90 A;  4PDL A;  2XAQ A;  3PJS K;  4IL6 Z;  2ITD C;  1K5S A;  1V55 B;  4UCU A;  4QGP A;  5GTI Z;  4GKJ O;  4LFB O;  2HVK C;  1F7Y A;  5EIB D;  1PV0 A;  2QA4 V;  2AZ2 A;  4U3J B;  1QLE B;  4FMT A;  5IT9 N;  4PDR A;  1KC8 W;  1TVK A;  5ITZ A;  2ZXW B;  2V1D A;  3K06 A;  2AZ0 A;  3IJ4 A;  1B3Q A;  3AG7 A;  1VQ5 V;  2R9I A;  3FKS G;  3RN4 A;  5LP6 C;  4FFK A;  5CBH A;  1Q82 W;  4DV4 B;  1EZV H;  3ABL C;  1H8E G;  5GON A;  5JH7 A;  1KBH A;  4L87 A;  2JVD A;  4LBE C;  4MTX A;  4WFA V;  3T1Y O;  3N27 A;  1ZUQ A;  4OPA A;  2UUC B;  5EIB C;  2DYR C;  4MVM A;  4NTY A;  3OAA G;  3K0G A;  2EIL C;  2A7W A;  3AK2 A;  1X4T A;  1KD1 W;  4X66 B;  3HB3 B;  4O4H A;  1R1B A;  3ETG A;  4JI3 B;  4UB6 Z;  3CJH B;  3SPC A;  3CYO A;  4LCU C;  4U7O A;  3VQY A;  4R8C A;  3A0B Z;  3ABT A;  2EIL B;  2N04 A;  3ICX A;  1NR7 A;  1ZL8 A;  4PV1 B;  4GKJ B;  4LFB B;  1H2N A;  4DR6 O;  3F5W C;  1JA8 A;  1OCO B;  2F4V B;  1YVW A;  4JAA A;  2JGD A;  4O2A B;  1AVM A;  1GN6 A;  4H13 B;  2LFR A;  4EB6 A;  1TA8 A;  4X65 O;  5LGU A;  1XEQ A;  4JZG A;  1ZL8 B;  1ORQ C;  2IJJ A;  2B5U A;  2G38 A;  1SQF A;  4I4T B;  3P30 A;  2H94 A;  3WU2 Z;  1BSM A;  3QG5 A;  5GW7 A;  4B3T O;  3ZRV A;  1FFT B;  1GM9 A;  1XL6 A;  2ARH A;  5FLX N;  2EIN B;  4LC1 A;  3P3P A;  2EJR A;  1PNL A;  2YXH A;  5EK0 A;  1KQS U;  2ODM A;  1BE3 H;  1KYO F;  4LF7 O;  1M93 A;  4MVR A;  2YIB A;  3CRA A;  1JPX A;  2VQE B;  4P9O A;  1YTF D;  1Y67 A;  2KKW A;  2ZD9 A;  3I56 V;  5EYP B;  5J2T B;  1S76 D;  5TIS Z;  4JYC A;  1YEW A;  3QO5 A;  1IBM O;  4TUY B;  3K0D A;  1K33 A;  1RM1 B;  1BHA A;  1K3E A;  1P7G A;  5H9C A;  4J9Z B;  1GN4 A;  5K1X A;  2F95 B;  4MW8 A;  5IJ9 B;  4FLU A;  2WPD G;  4H33 A;  4WFF A;  3APO A;  5EYP A;  2X6C A;  5BMV A;  1OCC B;  1IXM A;  2IU0 A;  1PL0 A;  4CH3 A;  2P90 A;  1HNW B;  3C3S A;  3JAK A;  1XMQ B;  4XDL A;  2AGA A;  3CCV V;  1L8D A;  5JVD A;  4LF4 B;  4WFH A;  1XNQ O;  3W7T A;  3TXS A;  4DR6 B;  2BTQ B;  4JZ2 A;  3CME V;  2PY5 A;  1NU1 H;  4MS2 A;  1YJW V;  2FTK A;  1US6 A;  1VQ7 V;  1YI2 V;  5B1A B;  4WFG A;  1WLE A;  2W6J G;  1RSO B;  2Z3Y A;  4R6Z A;  5D5P A;  5CMU A;  2A9H A;  4UCR A;  2L35 A;  4O4I B;  4I7Z B;  2Q67 A;  2LGW A;  1VAR A;  4DW0 A;  3OMN B;  1I94 O;  2QKC A;  4U7N A;  1EM1 A;  1BQ0 A;  1FXK C;  1Q5O A;  2QSA A;  1D5N A;  5CA0 B;  1F23 A;  5KMG B;  1I5X A;  2OIE A;  3JAT B;  2JK5 C;  4MVZ A;  3OUS A;  3T1H B;  4I0X A;  1GM8 A;  1V54 C;  4JV5 B;  4LF5 B;  4LFA B;  4AQY O;  2UUB O;  4ZBM A;  5LGN A;  5D5Q A;  4JI7 O;  3E8G A;  4J41 A;  3ML0 A;  4LR3 A;  1XNR O;  1AI6 A;  3G67 A;  1QLE C;  3ZHR A;  4AHC A;  2IH1 C;  4DV7 B;  1W2B U;  1CPY A;  5C8Y A;  3RVZ A;  2PI4 A;  4JI5 B;  3BY6 A;  1EN5 A;  3E89 A;  2GUZ A;  2Y4T A;  2DQ3 A;  2WLI A;  1W0J G;  4X1Y A;  4JI0 O;  4LF4 O;  1CEZ A;  2X6A A;  1QVF U;  5L3E A;  1H2K A;  1YDX A;  2HLD G;  1E1Q G;  2BTO A;  3NXS A;  1YHQ V;  5EBW C;  4FM1 A;  2P4V A;  4MT8 A;  3ABL B;  1JFF B;  4CZZ A;  4DR3 B;  3IC7 A;  3U10 A;  2JDI G;  4MVQ A;  2Q9L A;  1GM7 A;  4X1Y B;  3CSX A;  4LFC O;  5H5N A;  1M56 C;  3SPI A;  4JAV A;  2QJ1 A;  1SQG A;  4BWA A;  1G1X B;  4KHP B;  1UPG A;  2UXD B;  4ZIB A;  1FOU A;  3SYC A;  1WA8 B;  3RFR A;  4LF6 O;  1R3L C;  5KHH A;  3D8C A;  3JAS B;  1MNG A;  5JQG B;  1FAF A;  3SPH A;  1R6T A; 
#chains in the Genus database with same CATH homology
 1BT8 A;  1JA8 A;  2RCV A;  1AVM A;  1GN6 A;  1SZX A;  1KKC A;  1VAR A;  1WB7 A;  1VEW A;  2QKC A;  4JZG A;  1EM1 A;  2GDS A;  1D5N A;  1AR5 A;  2QKA A;  3KDR A;  1LUV A;  1BSM A;  1N0N A;  1XRE A;  4GUN A;  1LUW A;  1EN6 A;  3EVK A;  1PM9 A;  1IXB A;  3RN4 A;  1WB8 A;  3DC6 A;  1GN2 A;  1XDC A;  1I0H A;  4FFK A;  3TJT A;  1Y67 A;  1MA1 A;  1I08 A;  1AR4 A;  3OT7 A;  4F6E A;  3LSU A;  1BS3 A;  1EN5 A;  2ADP A;  4JYY A;  1P7G A;  3MDS A;  1GN4 A;  4YIP A;  1AP5 A;  5A9G A;  1JR9 A;  3KKY A;  1ZUQ A;  3CEI A;  1MSD A;  1PL4 A;  3AK1 A;  1B06 A;  1ZTE A;  3C3S A;  4E4E A;  3AK2 A;  1XUQ A;  1MMM A;  2CDY A;  1IX9 A;  1ZLZ A;  4C7U A;  2ADQ B;  1ZSP A;  4YIO A;  1XIL A;  1EN4 A;  3C3T A;  2AW9 A;  4JZ2 A;  4BR6 A;  4X9Q A;  3IC9 A;  2CE4 A;  3K9S A;  1IDS A;  1N0J A;  1QNM A;  3BFR A;  2P4K A;  1GN3 A;  1AP6 A;  3QVN A;  1MNG A;  3AK3 A;  5AG2 A;  3DC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...